European PRRSV strain
09534207 ยท 2017-01-03
Assignee
Inventors
- Kim Burgard (Wadgassen, DE)
- Jeremy Kroll (Urbandale, IA)
- Sarah M. Layton (Newton, IA)
- Volker Ohlinger (Havixbeck, DE)
- Francois-Xavier Orveillon (Mainz, DE)
- Stefan Pesch (Munster, DE)
- Michael Dennis Piontkowski (Perry, KS)
- Michael B. Roof (Ames, IA)
- Philip Utley (Slater, IA)
- Eric Martin Vaughn (Ames, IA)
Cpc classification
C12N2770/10034
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
C12N2770/10021
CHEMISTRY; METALLURGY
International classification
C12N7/00
CHEMISTRY; METALLURGY
Abstract
The present invention is related to improved modified live PRRS vaccines containing new PRRSV European strains of PRRSV and methods of use and manufacture of such vaccines.
Claims
1. A method of immunizing swine against porcine reproductive and respiratory syndrome (PRRS), said method comprising the step of administering to swine a vaccine composition including a live porcine reproductive and respiratory syndrome virus mixed with a pharmacologically compatible carrier agent, said virus comprising PRRS 94881 virus passaged at least 36 times in cell culture to modify the virus such that when the modified virus is administered to a swine or other mammal prone to PRRS, it fails to cause clinical signs of PRRS disease but is capable of inducing an immune response that immunizes the mammal against pathogenic forms of PRRS.
2. The method of claim 1, wherein said swine presents no lung lesions after vaccination.
3. The method of claim 1, wherein said swine presents fewer lung lesions after vaccination as compared to vaccination with Porcilis vaccine.
Description
BRIEF DESCRIPTION OF SEVERAL VIEWS OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
DETAILED DESCRIPTION OF THE INVENTION
(11) The present invention provides methods of treating or reducing the severity of porcine reproductive and respiratory syndrome virus (PRRSV) infection, as well as, methods of preventing PRRSV infection. Generally, the method is for treating or reducing the severity of or incidence of porcine reproductive and respiratory syndrome virus (PRRSV) infection. Treating or reducing the severity of or incidence of refers to a reduction in the severity of clinical signs, symptoms, and/or pathological signs normally associated with infection, up to and including prevention of any such signs or symptoms. Pathological signs refers to evidence of infection that is found microscopically or during necropsy (e.g. lung lesions).
(12) The method generally includes the step of administering a therapeutic amount of a PRRSV antigen to a swine of a defined age or age range. For example, in one aspect of the invention, one therapeutic amount of a PRRSV antigen may be administered to a piglet about three-weeks-old or younger, and different therapeutic amounts of the antigen may be administered to a pig between about 3 weeks of age and 4 weeks of age. Similarly, an even different therapeutic amount might be administered to a pig between about four weeks and sixteen weeks of age (or any age within this range, e.g. five weeks to six weeks of age, nine weeks to fifteen weeks of age, seven weeks to ten weeks of age, etc.), or to pig older than sixteen weeks, such as an adult sow.
(13) In specific embodiments, the present invention relates to an attenuated, atypical PRRSV strain and corresponding improved modified-live vaccines which confer effective immunity to this newly discovered typical PRRSV strain. Effective immunity refers to the ability of a vaccine to prevent swine PRRSV infections, including atypical PRRSV infections, which result in substantial clinical signs of the disease. It should be understood that the immunized swine may or may not be serologically positive for PRRSV, but the swine do not exhibit any substantial clinical symptoms.
(14) In preferred forms, the vaccine of the invention includes a live European type PRRS live virus which has been attenuated in virulence. The resulting attenuated virus has been shown to be avirulent in challenged controlled host animal studies and to confer effective immunity. This particular strain of EU PRRS is not as virulent as others and hence, it is an attractive option as a vaccine candidate. The PRRSV 94881 parental strain does not cause severe, atypical PRRS disease in the pregnant sow nor severe lung lesions in young pigs. This strain was initially isolated from in the North Rhine Westphalia, Germany from a 3 week old piglet with severe respiratory disorder. The strain was subsequently attenuated via continuous passage in MA 104 cells. The attenuated strain was deposited in the European Collection of Cell Cultures (ECACC), Porton Down, Salisbury, Wiltshire, SP4 0JG, Great Britain, on Jan. 25, 2011 and was accorded Accession No. 11012502. This attenuated virus is a preferred Master Seed Virus (MSV) which has been subsequently passaged and developed as an effective PRRSV vaccine. The virulent parent strain denominated 94881 also was deposited in accordance with the Budapest Treaty at the European Collection of Cell Cultures (ECACC), Porton Down, Salisbury, Wiltshire, SP4 0JG, Great Britain, on Jan. 25, 2011 and was accorded Accession No. 11012501.
(15) In certain exemplary embodiments the modified live virus vaccine was tested at a dosage of 1 ml for pigs and 2 ml for sows via intramuscular injection and was shown to be efficacious in producing protective immunity.
(16) Passaging of the virus to attenuation was accomplished using classical virology methods. Specifically, the parental isolate PRRS 94881 was attenuated in vitro through continuous passing in MA 104 cells to achieve a maximum passage of 108 passes past initial isolation. Briefly, the material was passed at roughly 1 to 2 passes per week for a total of 108 passes in T-25 cm.sup.2 or T-75 cm.sup.2 flasks. Confluent MA 104 cell cultures with approximately 12-30 mL of Minimal Essential Medium (MEM) supplemented with 6% fetal bovine serum (FBS) were inoculated with 100 to 300 l of the virus. Cultures were incubated for 3-7 days in a humidified chamber incubator at 37 C. with 4-6% CO.sub.2. Once cultures reached >25% cytopathic effect (CPE), the flask was harvested by extracting the supernatant. A portion of the supernatant was passed into a new flask and 2 mL of the harvest was aliquoted for storage at 60 C. to 80 C.
(17) The skilled person using standard techniques in the art will be able to determine the underlying nucleic acid sequence of the attenuated virus has been deposited ECACC under Accession No. 11012502. The present invention therefore further embraces a nucleic acid sequence specific for the attenuated PRRSV 94481 deposited at ECACC under Accession No. 11012502. Preferably, the invention further embraces PRRS virus nucleic acid sequences that share at least 95% sequence homology with the sequence of SEQ ID NO:1 or SEQ ID NO:10 as such viruses may likely be effective at conferring immunity upon animals vaccinated with attenuated viruses containing such homologous sequences. The sequence shown in SEQ ID NO:1 is the full length sequence of the attenuated PRRS 94881 MSV and has a full length sequence of 14843 bp. The ORFS1 through 7 have been annotated for this sequence as follows:
(18) TABLE-US-00001 ORF Number CDS in SEQ ID NO: 1 Protein encoded ORF1a 178 to 7227 SEQ ID NO: 2 ORF1b 7209 to 11600 SEQ ID NO: 3 ORF2 11611 to 12360 SEQ ID NO: 4 ORF3 12219 to 13016 SEQ ID NO: 5 ORF4 12761 to 13312 SEQ ID NO: 6 ORF5 13309 to 13914 SEQ ID NO: 7 ORF6 13902 to 14423 SEQ ID NO: 8 ORF7 14413 to 14799 SEQ ID NO: 9
(19) The sequence shown in SEQ ID NO:10 is the full length sequence of the parental PRRSV 94881 strain, passage 5 and has a full length sequence of 14843 bp. The ORFS1 through 7 have been annotated for this sequence as follows:
(20) TABLE-US-00002 ORF Number CDS in SEQ ID NO: 10 Protein encoded ORF1a 178 to 7227 SEQ ID NO: 11 ORF1b 7209 to 11600 SEQ ID NO: 12 ORF2 11611 to 12360 SEQ ID NO: 13 ORF3 12219 to 13016 SEQ ID NO: 14 ORF4 12761 to 13312 SEQ ID NO: 15 ORF5 13309 to 13914 SEQ ID NO: 16 ORF6 13902 to 14423 SEQ ID NO: 17 ORF7 14413 to 14799 SEQ ID NO: 18
(21) With the isolation of this new attenuated European PRRS virus strain it is possible to produce improved PRRS vaccines containing a most recent PRRS strain that is reflective of virulent PRRS strains found currently in the field. In particular, the new attenuated European PRRS virus may be used to prepare modified live vaccines (MLV). A modified live vaccine is characterized in that it contains live virus which can replicate in pigs, but does not exert clinical disease of PRRS. Furthermore, upon administration it induces an immunological response in pigs which generally leads to a significant extent of protection against subsequent infection with pathogenic PRRS virus. Virus showing such characteristics is usually called attenuated virus. In addition, the present invention provides details of the sequences of the ORFs of both the parental and the attenuated strains of PRRSV 94881. Thus, it is contemplated that the skilled person may employ the sequences of any one or more of the ORFs shown herein in a subunit vaccine.
(22) As noted above, in general, attenuation of virus may be generated from pathogenic virus isolates by repeated passaging in suitable host cells that are permissive to the virus until the virus shows the desired properties (WO 92/21375, WO 93/06211, WO93/03760, WO 93/07898, WO 96/36356, EP 0 676 467, EP 0 732 340, EP 0 835 930). Alternatively, it may be generated by genetic reengineering through use of an infectious clone, normally a full-length complementary DNA transcript of the viral genome (WO 98/18933, EP 1 018 557, WO 03/062407, Nielsen et al, J Virol 2003, 77:3702-371 1). In a preferred embodiment, the present invention relates to a MLV containing attenuated PRRS virus of European genotype 94481 that is attenuated from a parental virus that is deposited at ECACC under Accession No. 11012501. A preferred MLV contains the attenuated virus of the present invention that is deposited at ECACC under Accession No. 11012502.
(23) In another aspect, the present invention contemplates preparation and isolation of a progeny or descendant of a PPRS virus that has been deposited on Jan. 25, 2011 with the European Collection of Cell Cultures (ECACC), Porton Down, Salisbury, Wiltshire, SP4 0JG, Great Britain, under the Accession Numbers ECACC 11012502 (attenuated strain for MLV) and 11012501 (parental strain). The invention therefore extends to PRRS virus strains which are derived from the deposited strains through propagation or multiplication in an identical or divergent form, in particular descendants which possess the essential characteristics of the deposited strains. Upon continued propagation, the strains may acquire mutations most of which will not alter the properties of these strains significantly.
(24) The strains of the invention may also be further modified to impart further desirable properties to them. This may be achieved by classical propagation and selection techniques, like continued propagation in suitable host cells to extend the attenuated phenotype. Alternatively, the strains may be genetically modified by directed mutation of the nucleic acid sequence of the genome of these strains by suitable genetic engineering techniques. The genome of PRRSV was completely or partly sequenced (Conzelmann et al., 1993; Meulenberg et al., 1993a, Murtaugh et al, 1995) and encodes, besides the RNA dependent RNA polymerase (ORFs 1a and 1b), six structural proteins of which four envelope glycoproteins named GP2 (ORF2), GP3 (ORF3), GP4 (ORF4) and GP5 (ORF5), a non-glycosylated membrane protein M (ORF6) and the nucleocapsid protein N(ORF7) (Meulenberg et al. 1995, 1996; van Nieuwstadt et al., 1996). Immunological characterization and nucleotide sequencing of European and US strains of PRRSV has identified minor antigenic differences within strains of PRRSV located in the structural viral proteins (Nelson et al., 1993; Wensvoort et al., 1992; Murtaugh et al., 1995). The PRRS 94881 MSV of the present invention has been compared with the European Reference Virus strain Lelystad Virus (LV) revealed nucleotide homologies ranging from 85.40 to 95.09 percent in the 8 different viral genes and amino acid identities from 86.39 to 97.27 percent between both virus strains. Two deletions in the ORF 1a of 94881 MSV could be identified compared to LV. For example, ORF1a of 94881 MSV has 85.40% nucleotide homology to Lelystad Virus resulting in an amino acid identity of 86.39%; ORF1b of 94881 MSV has 92.12% nucleotide homology to Lelystad Virus resulting in an amino acid identity of 97.27%; ORF2 of 94881 MSV has 91.07% nucleotide homology to Lelystad Virus resulting in an amino acid identity of 90.76%; ORF3 of 94881 MSV has 90.98% nucleotide homology to Lelystad Virus resulting in an amino acid identity of 89.43%; ORF4 of 94881 MSV has 90.58% nucleotide homology to Lelystad Virus resulting in an amino acid identity of 87.43%; ORF5 of 94881 MSV has 90.43% nucleotide homology to Lelystad Virus resulting in an amino acid identity of 88.56%; ORF6 of 94881 MSV has 95.02% nucleotide homology to Lelystad Virus resulting in an amino acid identity of 97.11%; ORF7 of 94881 MSV has 95.09% nucleotide homology to Lelystad Virus resulting in an amino acid identity of 92.97%;
(25) Indeed, the PRRS 94881 virus of the present invention may be made into a chimeric virus wherein the backbone of the PRRS virus under ECACC Accession No. 11012502 or indeed the parent strain deposited under ECACC Accession No 11012501 is modified to replace the endogenous sequence of one or more of ORF 1a, ORF 1b, ORF 2, ORF 3, ORF 4, ORF 5, ORF 6, or ORF 7 with the corresponding ORF from a different strain of PRRS virus. For example, the different strain of the PRRS virus may be a different European strain such as Lelystad virus strain (Lelystad Agent (CDI-NL-2.91), or other strains such as those deposited under the Accession Numbers ECACC 04102703, ECACC 04102702, ECACC 04102704, CNCM Accession No. I-1140, CNCM Accession No I-1387, CNCM Accession No I-1388, ATCC VR 2332, VR 2385, VR 2386, VR 2429, VR 2474, and VR 2402; CNCM I-1102, CNCM I-1140, CNCM I-1387, CNCM I-1388, or ECACC V93070108 or indeed may be a U.S. strain such as North American PRRS virus, pT7P129A; ATCC deposit VR-2332, ATCC deposit VR-2368; ATCC VR-2495; ATCC VR 2385, ATCC VR 2386, ATCC VR 2429, ATCC VR 2474, and ATCC VR 2402.
(26) Recombinant techniques for preparing modified sequences are well known to those of skill in the art and usually employ construction of a full-length complementary DNA copies (infectious clones) of the viral genome which may then be modified by DNA recombination and manipulation methods (like site-directed mutagenesis etc.). This way, for example antigenic sites or enzymatic properties of viral proteins may be modified. Infectious clones of PRRS virus strains of European and North American genotype have been reported in the literature.
(27) The PRRS virus strains of the present invention are suitable for vaccines of the invention can be grown and harvested by methods known in the art, e.g. by propagating in suitable host cells like the simian cell line MA-104, Vero cells, or porcine alveolar macrophages. PRRSV preferentially grows in alveolar lung macrophages (Wensvoort et al., 1991). A few cell lines, such as CL2621 and other cell lines cloned from the monkey kidney cell line MA-104 (Benfield et al., 1992; Collins et al., 1992; Kim et al., 1993) are also susceptible to the virus.
(28) Vaccines comprising any one of PRRSV strain PRRS virus under ECACC Accession No. 11012501, 11012501 Accession Numbers ECACC 04102703, ECACC 04102702, ECACC 04102704, CNCM Accession No. I-1140, CNCM Accession No I-1387, and CNCM Accession No I-1388 as well as any combination of these strains or their descendants are thus preferred embodiments of the present invention. In specific embodiments, the PRRS virus 94881 is grown in a process wherein there is a concurrent seeding of the virus and the host cells together on the same day into a bioreactor as shown in
(29) Preferably, vaccines according to the present invention are modified live vaccines comprising one or more of these strains alive in a suitable carrier, but inactivated virus may also be used to prepare killed vaccine (KV). MLV are typically formulated to allow administration of 10.sup.1 to 10.sup.7 viral particles per dose, preferably 10.sup.3 to 10.sup.5 particles per dose, more preferably 10.sup.4 to 10.sup.5 particles per dose (4.0-5.0 log.sub.10 TCID.sub.50). KV may be formulated based on a pre-inactivation titer of 10.sup.3 to 10.sup.10 viral particles per dose. The vaccine may comprise a pharmaceutically acceptable carrier, for example a physiological salt-solution.
(30) Pigs can be infected by PRRSV via the oronasal route. Virus in the lungs is taken up by lung alveolar macrophages and in these cells replication of PRRSV is completed within 9 hours. PRRSV travels from the lungs to the lung lymph nodes within 12 hours and to peripheral lymph nodes, bone marrow and spleen within 3 days. At these sites, only a few cells stain positive for viral antigen. The virus is present in the blood during at least 21 days and often much longer. After 7 days, antibodies to PRRSV are found in the blood. The combined presence of virus and antibody in PRRS infected pigs shows that the virus infection can persist for a long time, albeit at a low level, despite the presence of antibody. During at least 7 weeks, the population of alveolar cells in the lungs is different from normal SPF lungs.
(31) A vaccine according to the present invention may be presented in form of a freeze-dried preparation of the live virus, to be reconstituted with a solvent, to result in a solution for injection. The solvent may e.g. be water, physiological saline, or buffer, or an adjuvanting solvent. The solvent may contain adjuvants. The reconstituted vaccine may then be injected into the a pig, for example as an intramuscular or intradermal injection into the neck. For intramuscular injection, a volume of 2 ml may be applied, for an intradermal injection it is typically 0.2 ml. In a further aspect, the present invention therefore is a vaccine product, comprising in separate containers a freeze-dried composition of the virus, and a solvent for reconstitution, and optionally further containing a leaflet or label comprising instructions of use.
(32) A vaccine according to the present invention may not only comprise one or more of the aforementioned strains, but may include further components active against PRRS or other porcine viral or bacterial diseases, like porcine circovirus or classical swine fever virus. Therefore, the invention further relates to a vaccine as described, characterized in that it contains at least one further antigen active against a porcine disease which is not PRRS. For example, such further antigens may include Mycoplasma hyopneumoniae, PCV2, SIV, H. parasuis, E. rhusiopathiae, S. suis, A. suis, Leptospira sp. Parvovirus and the like. In addition, the vaccine may comprise certain pharmaceutically or veterinary acceptable adjuvants. The invention provides new vaccine compositions, in particular, PRRS virus vaccines comprising PRRSV 94881 that further comprise adjuvants that enhance the efficacy of the vaccine such that a better clinical response/outcome is seen with the administration of the combination of the adjuvant and the vaccine as compared to administration of the vaccine alone. For example, the vaccine compositions of the invention may comprise a PRRSV 94881 virus vaccine and an adjuvant selected from the group consisting of MCP-1, -tocopherol (e.g., -tocopherol acetate, an exemplary version of which is sold as DILUVAC FORTE), Haemophilus sonmus fractions, carbopol and combinations thereof. In some embodiments, the virus vaccine comprising PRRS 94881 virus vaccine, which may be a recombinant subunit vaccine or alternatively may be a live attenuated virus vaccine. An exemplary live vaccine that exists is INGELVAC PRRS MLV and the PRRS 94881 may be formulated in a manner similar to INGELVAC PRRS MLV.
(33) In addition to the above, the immunogenic compositions of the invention may contain other ingredients so long as the other ingredients do not interfere with the adjuvants or the underlying virus vaccine. Such other ingredients include, for example, binders, colorants, desiccants, antiseptics, wetting agents, stabilizers, excipients, adhesives, plasticizers, tackifiers, thickeners, patch materials, ointment bases, keratin removers, basic substances, absorption promoters, fatty acids, fatty acid ester, higher alcohols, surfactants, water, and buffer agents. Preferred other ingredients include buffer agents, ointment bases, fatty acids, antiseptics, basic substances, or surfactants.
(34) The content or amount of the adjuvants used in the invention may vary and can be determined by taking into consideration, for example, the properties of the PRRS virus vaccine being used, and the dosage form. The adjuvant may comprise, for example, 1 to 100% by weight. The PRRSV 94881-based compositions of the invention are produced by mixing together the adjuvant component and the virus vaccine component, either alone or with various other ingredients. The compositions may be such that the virus vaccine and the adjuvant are presented as one formulation or alternatively, the adjuvant and the vaccine are presented in distinct formulations that can be administered simultaneously or sequentially.
(35) The adjuvant component of the immunogenic compositions of the invention thus may be administered separately from the virus vaccine in the administration to organisms. Alternatively, the adjuvant according to the present invention, together with the virus vaccine, can be administered as a single vaccine composition. The virus vaccine may be any virus vaccine. More specific embodiments contemplate the use of a PRRS virus vaccine comprising PRRSV 94881. In addition such a vaccine may be combined with other vaccines such as INGELVAC PRRS MLV and/or Porcilis. This is merely one exemplary PRRS virus combination vaccine and other such vaccine combinations can be readily prepared.
(36) The immunogenic compositions described herein are particularly advantageous in the induction of the production of an antibody response to PRRS virus. Administration of the vaccines preferably will produce a lessening of the severity of one or more clinical symptoms, such as lung lesions, anorexia, skin discolorations, lethargy, respiratory signs, mummified piglets, coughing, diarrhea and combinations thereof, that are associated with PRRSV infection.
(37) The compositions thus particularly enhance the clinical outcome in a diseased animal as compared to the outcome from administration of PRRS virus vaccine alone. In specific embodiments, the enhanced clinical outcome is a reduction of the percentage of lung lesions by at least 50% when compared to animals not receiving the immunogenic composition in combination with said adjuvant. In other embodiments, the enhance clinical outcome is a reduction of viremia in animals by at least 45% when compared to animals not receiving the immunogenic composition in combination with said adjuvant.
(38) Thus, in one aspect, the invention relates to an improved vaccine, more particularly and improved PRRS virus vaccine, wherein the improvement comprises admixing with the virus vaccine an adjuvant selected from the group consisting of MCP-1, Haemophilus sonmus fractions, carbopol and combinations thereof. The vaccine composition of the invention may further comprise a pharmaceutically acceptable carrier.
(39) The vaccine compositions of the invention may be formulated by any method known in the art of formulation, for example, into liquid preparations, suspensions, ointments, powders, lotions, W/O emulsions, 0/W emulsions, emulsions, creams, cataplasms, patches, and gels and is preferably used as medicaments. Thus, according to another aspect of the present invention, there is provided a pharmaceutical composition comprising the above vaccine composition. The vaccine composition according to the present invention, when dermally administered, can significantly induce antibody production. Accordingly, in another preferred embodiment of the present invention, the vaccine composition can be provided as a transdermal preparation.
(40) Further, as described above, the virus and adjuvant in the present invention may be administered, to an organism, together as a single vaccine composition, or as an adjuvant preparation separate and distinct from the antigenic PRRS virus component of the vaccine, whereby the adjuvant acts in a manner such that amount of an antibody produced in the organism in response to the PRRS virus vaccine can be significantly increased as compared to administration of the PRRS virus vaccine alone.
(41) When the adjuvant and the PRRS virus vaccine are administered to an organism, the clinical outcome of the animal is enhanced. The effective amount of the adjuvant and the immunologically effective amount of the PRRS virus vaccine may be readily determined by a person having ordinary skill in the art by taking into consideration, for example, the type and properties of the antigenic substance, the species of organisms, age, body weight, severity of diseases, the type of diseases, the time of administration, and administration method and further using the amount of an antibody produced against the antigenic substance in the organism as an index.
(42) The PRRS virus vaccine, the adjuvant, or combinations thereof can be administered to organisms by any suitable method selected depending, for example, upon the condition of animals and properties of diseases. Examples of such methods include intraperitoneal administration, dermal administration for example, subcutaneous injection, intramuscular injection, intradermal injection, and patching, nasal administration, oral administration, mucosal administration (for example, rectal administration, vaginal administration, and corneal administration). Among them, intramuscular administration is preferred.
(43) An exemplary therapeutic dose of PRRSV MLV is about two milliliters (2 mLs). Skilled artisans will recognize that the dosage amount may be varied based on the breed, size, and other physical factors of the individual subject, as well as, the specific formulation of PRRSV MLV and the route of administration. Preferably, the PRRSV MLV is administered in a single dose; however, additional doses may be useful. Again, the skilled artisan will recognize through the present invention that the dosage and number of doses is influenced by the age and physical condition of the subject pig, as well as, other considerations common to the industry and the specific conditions under which the PRRSV MLV is administered.
(44) In certain other embodiments, the vaccine may be a multivalent vaccine that comprises two or more PRRS viruses where at least one of the PRRS viruses is the attenuated 94881 virus deposited under ECACC Accession No. 11012502. The other PRRS viruses may be one or more selected from the group consisting of PRRSV strain Lelystad virus (Lelystad Agent (CDI-NL-2.91), or other strains such as those deposited under the Accession Numbers ECACC 04102703, ECACC 04102702, ECACC 04102704, CNCM Accession No. I-1140, CNCM Accession No I-1387, CNCM Accession No I-1388, ATCC VR 2332, VR 2385, VR 2386, VR 2429, VR 2474, and VR 2402; CNCM I-1102, CNCM I-1140, CNCM I-1387, CNCM I-1388, or ECACC V93070108 or indeed may be a U.S. strain such as North American PRRS virus, pT7P129A; ATCC deposit VR-2332, ATCC deposit VR-2368; ATCC VR-2495; ATCC VR 2385, ATCC VR 2386, ATCC VR 2429, ATCC VR 2474, and ATCC VR 2402.
(45) The vaccines based on PRRS viruses may be used to vaccinate both piglets and sows. In one aspect of the invention, a particular dose regimen is selected based on the age of the pig and antigen selected for administration. This will permit pigs of any age to receive the most efficacious dose. In a preferred method, a therapeutic amount of PRRSV 94881 MLV is administered to a pig or piglet that is about two weeks old5 days of age. The amount selected will vary depending upon the age of the pig. Alternatively, a different therapeutic amount of such an MLV is administered to a pig or piglet that is older than about 3 weeks, and this amount will also change as the pig receiving such an administration ages or becomes older. Accordingly, pigs about four weeks old, six weeks old, eight weeks old, ten weeks old, twelve weeks old, fourteen weeks old, sixteen weeks old, a gilt, or a sow will all receive different amounts. Therapeutic dose to be used will be optimized in the field and is typically, determined in clinical studies in which a minimal immunizing dose is defined based on protection against a virulent heterologous PRRSV challenge in susceptible swine. Preferably, the PRRSV MLV produced according to the methods described herein is administered intramuscular administration; however, other methods of administration such as intradermal, intranasal, intraretinal, oral, subcutaneous, and the like, that are well-known and used in the art may be used.
(46) The skilled person will recognize that the vaccination methods may involve determining the proper timing and dosage for vaccination of a pig against PRRSV. Such methods generally comprises the steps of determining at least one variable selected from the group consisting of age, health status, innate immunity level and active immunity level, of the pig, and adjusting a standard dosage level to account for these variables. Generally, the innate immunity level and active immunity level will be determined by referring to a standard comprised of average levels from a population of pigs of similar age and health status. In a particularly preferred method, all variable are considered prior to determining the optimum dosage level and timing of administration.
(47) In preferred embodiments, the present invention also relates to isolated nucleic acids that code specific open reading frames of attenuated 94881 virus deposited under ECACC Accession No. 11012502 and the parent virulent 94881 virus deposited under ECACC Accession No. 11012501. For example, the complete nucleotide sequence of the attenuated 94881 virus deposited under ECACC Accession No. 11012502 has a sequence of SEQ ID NO:1 which encodes ORF1a, ORF1b, ORF2, ORF3, ORF4, ORF5, ORF6, ORF7 protein sequences of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, and SEQ ID NO:9, respectively. The complete nucleotide sequence of the parent virulent 94881 virus deposited under ECACC Accession No. 11012501 has a sequence of SEQ ID NO:10 which encodes ORF1a, ORF1b, ORF2, ORF3, ORF4, ORF5, ORF6, ORF7 protein sequences of SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, and SEQ ID NO:18, respectively.
(48) The PRRSV 94881 vaccine can be administered in any conventional fashion and in some preferred methods the administration is intramuscularly. It is preferred that the administered PRRSV vaccine provide its benefits of treating or reducing the severity of or incidence of PRRSV infection after a single dose, as with INGELVAC, however, if other antigens or combination or multivalent vaccines are selected, it should be understood that they can be administered in their conventional fashion, which may include one or more booster doses after the initial administration. Those of skill in the art will be able to determine appropriate dosing levels based on the PRRSV vaccine selected and the age range of the animal to which the antigen will be administered.
(49) In specific examples presented herein below pigs and sows were challenged with a new European derived strain of PRRSV that was able to reproducibly produce respiratory disease in piglets. Historically, European-derived PRRSV strains have been unable to reproduce respiratory disease in piglet model and hence respiratory challenge models relied on infection with non-European strains. Because of high genetic diversity there is a demand in Europe for a new vaccine based on an European strain. In additional examples, the animals were challenged with a strain that produced reproductive failure in gilts/sows challenge models. It has been found that the efficacy of the MLV vaccines based on attenuated 94881 virus deposited under ECACC Accession No 11012502 or any virus prepared from this strain or from the parental strain deposited at ECACC Accession No 11012501 can be shown using a variety of challenge models because this strain also is effective in other models of PRRS virus-induced respiratory or reproductive failure.
EXAMPLES
Example 1
Description of PRRSV Respiratory Challenge Model
(50) As noted above, historically, EU-derived PRRSV strains are unable to reproduce respiratory disease in piglet model. Because of the high genetic diversity there is a demand in Europe for a new vaccine based on a European strain and a good, reproducible respiratory challenge model utilizing virulent a European-derived PRRSV strain is necessary for the conduction of the studies. In the following example, the inventors show that challenge of pigs with low passage European challenge strain (passage 4) reliably produced respiratory symptoms.
(51) In this study, 3 groups with 12 animals, 3 weeks of age at allocation and appr. 10 weeks of age at challenge were used:
(52) Group 1: Control group
(53) Group 2: Challenge group (SD 35)
(54) Group 3: Vaccinated with PORCILISPRRSV (SD 0) and then challenged (SD 35).
(55) The study was conducted over a 56 day period necropsy of 6 animals from each group was measured 10 days after challenge; necropsy of all remaining animals 21 days after challenge. Daily investigated parameters included: rectal temperature, respiratory and other clinical signs. Further parameters investigated included: body weight, mortality, viremia, seroconversion, pathological and histological examination of the lungs.
(56) At study day 7 the groups of pigs were allocated to each group. At study day 0, Group 3 was vaccinated with PORCILISPRRSV. At study day 35 group 2 and group 3 were challenged with a European challenge strain. At day 45 6 animals from each group were euthanized. The remaining animals were euthanized at day 56.
(57)
(58) Measurement of average daily weight (
(59) Viremia was monitored using PCR (
(60) Macroscopic examination of the lungs was also performed (
(61) In summary, coughing, total clinical scores and rectal temperatures increased after challenge in the challenge controls and Porcilis vaccinated groups. Body weight was significantly (p<0.05) less in the challenge controls and Porcilis group in comparison to the negative control group. All animals from the Porcilis group were positive for PRRS virus and antibodies after vaccination. All animals from the challenge controls were positive for PRRS virus and antibodies after challenge. Macroscopical and histological analysis of the lungs showed severe macroscopic and microscopic lung lesions in the challenge controls and Porcilis group in comparison to the negative control group.
(62) This study thus confirmed that the European challenge strain used does induce significant (p<0.05) disease when compared to the negative control group: fever, coughing, reduced weight and severe macroscopic and microscopic lung lesions.
(63) In addition, the European challenge strain has successfully demonstrated consistent and reproducible PRRSV-specific respiratory disease in the pig challenge model and therefore, is suitable for use as a challenge virus in future efficacy studies. Porcilis PRRS shows a lack of efficiency against the European challenge strain within the parameters of this study.
Example 2
Evaluation of Minimum Immunizing Dose of Attenuated PRRS Virus 94881 in Susceptible 2 Week Old Piglets Following Challenge with Heterologous European PRRS Isolate
(64) A vaccination-challenge study was performed to evaluate the minimum immunizing dose (MID) of Porcine Reproductive and Respiratory Syndrome Vaccine European-derived isolate 94881, Modified Live Virus (PRRS 94881 MLV) at three different titer levels, administered to Porcine Reproductive and Respiratory Syndrome (PRRS) susceptible piglets, that were approximately 14 days of age, to provide relevant reduction in lung lesions following challenge with a heterologous European isolate of PRRS. Fifteen piglets were included in each vaccinated group (Groups 1-3) as well as in the challenge control group (Group 4). Ten piglets were included in the negative control group (Group 5).
(65) The vaccine groups and the challenge control groups were monitored for a number of parameters including: viremia post-challenge, clinical assessments post-vaccination, PRRS serology, viremia post-vaccination, clinical observations post-challenge, average daily weight gain (ADWG), rectal temperatures and PRRS virus detection in the lungs. A negative control group (Group 5), which was not challenged, was also included in the study for study validation purposes by demonstrating that biosecurity was not breached throughout the duration of the study.
(66) The challenge control and negative control groups were PRRS negative up to the day of challenge (D28) and the negative control group remained PRRS negative for the remainder of the study (D38), thus validating the study.
(67) Challenge was at 4 weeks post-vaccination. At this time, only 2 animals in low titer vaccine group, 1 animal in the medium titer vaccine group and 3 animals in the high titer vaccine group were PRRS qPCR positive in serum.
(68) The challenge control group exhibited significant lung lesions typical of PRRS post-challenge. Post-challenge, the low, medium and high titer vaccine groups had median total lung lesion scores of 0.13%, 0.55%, and 0.40%, respectively; while the challenge control group had a median total lung lesion score of 33.40%. The median total lung lesion scores for the three vaccine titer groups were significantly lower than the challenge control group (p<0.0001). There were no statistical differences between vaccine titer groups (p0.1484) for total lung lesion scores. The negative control group had a median total lung lesion score of 0.00%.
(69) On study Days 31, 35 and 38 of the post-challenge period, the three vaccine titer groups had significantly less viremia than the challenge control group (p0.0093). There were no statistical differences between vaccine titer groups for viremia post-challenge except on D35, when the high titer vaccine group exhibited significantly lower viremia than the medium titer vaccine group (p=0.0442). Negative control piglets were negative for viremia on D31, D35 and D38.
(70) Clinically, severity (p0.0082) and frequency (p0.0268) of coughing was less severe in the three vaccine titer groups than the challenge control group during the post-challenge period; Day 29-Day 38. Pyrexia was more prominent in the challenge control group than in the three vaccine titer groups post-challenge. ADWG was significantly higher for the three vaccine titer groups compared with the challenge control group (p0.0027).
(71) The MID of PRRS 94881 MLV as determined in this study is associated with the low titer vaccine level of 110.sup.2.77 TCID.sub.50/mL, based on a relevant reduction in gross lung lesions for all three titer levels in comparison to the challenge controls after receiving a virulent heterologous European-derived PRRS challenge. When secondary parameters were examined, all three vaccine titer levels were associated with efficacy and no clear distinctions between titer groups were evident.
(72) General Design of Study:
(73) This was a blinded randomized design study conducted in 70 weaned, PRRS susceptible piglets, 14-16 days of age on Day 0 (D0). A description of treatment groups is shown below in Table 2.1:
(74) TABLE-US-00003 TABLE 2.1 Treatment Groups No. of Animals Group on D0 Treatment on Day 0 1 15 IVP No. 1 (mean titer of 1 10.sup.2.77 of PRRS 94881 MLV) 2 15 IVP No. 2 (mean titer of 1 10.sup.4.42 of PRRS 94881 MLV) 3 15 IVP No. 3 (mean titer of 1 10.sup.5.84 of PRRS 94881 MLV) 4 15 CP (Placebo matched product without PRRS 94881 MLV) 5 10 CP (Placebo matched product without PRRS 94881 MLV)
(75) Eighty-three piglets met the study inclusion criteria, of which the first 70 numerical numbers were randomly assigned to one of five groups on D3 by a biostatistician. Piglets were assigned 15 per group to Groups 1-4 and ten piglets to Group 5. All 83 piglets were PRRS seronegative.
(76) Piglets were observed from D1 to D26 for clinical assessments post-vaccination and observations will be recorded on the Clinical Assessment Record form.
(77) Serology:
(78) Venous whole blood was collected from piglets on D0, D7, D14, D21, D28. Sample collections were recorded. Blood samples were spun down and serum was harvested from each tube, split and transferred to appropriately labeled tubes. One set of serum samples were held at 2-8 C. and the other set of serum samples were held at 7010 C. The set of serum samples collected on days 0, 7, 14, 21, 28 and 38 and held at 2-8 C. were tested for PRRS antibodies. Results were reported as negative (ELISA S/P ratio of <0.4) or positive (ELISA S/P ratio of 0.4).
(79) PRRS Viremia:
(80) The set of serum samples collected on days 0, 7, 14, 21, 28, 31, 35, and 38 and held at 7010 C. were tested for PRRSv RNA by qPCR (Addendum 1, Attachment 7). Results were reported as n.d. (not detected), positive (EU PRRSv detected, but not quantifiable, GE/mL (genome equivalent)=<3.3 log) or a reported value (log GE/mL). For statistical purposes, not detected was assigned a value of 0 log GE/mL and a positive value was assigned a value of 3.0 log GE/mL.
(81) Average Daily Weight Gain (ADWG):
(82) Each pig was weighed on a calibrated scale and individual body weights were recorded. The average daily gain was determined from the D0 to D28 and from D28 to D38.
(83) Clinical Observations Post-Challenge:
(84) Piglets were observed by the Study Investigator or designees for clinical signs of disease from D27 to D38 and were recorded on the Clinical Observation Record form. Observations included respiration, behavior and cough based on the clinical observation scoring system as shown below in Table 2.2
(85) TABLE-US-00004 TABLE 2.2 Clinical Observation Scoring System Respiration Score Behavior Score Cough Score 0 = normal respiration 0 = normal 0 = no coughing 1 = panting/rapid 1 = mild to moderate 1 = soft or intermittent respiration lethargy cough 2 = dyspnea 2 = severely lethargic 2 = harsh or severe, 3 = dead or recumbent repetitive cough 3 = dead 3 = dead
(86) A daily total clinical observation score for each piglet was determined by the summation of its daily respiration, behavior and cough scores.
(87) Rectal temperatures were collected from D27 to D38.
(88) Total Lung Lesion Score:
(89) All piglets that died before D38 and remaining piglets that were euthanized on D38 were necropsied. Each set of lungs was examined for any gross lung pathology and determination of the % pathology for each lung lobe. If pathology of other organs were noted, these were described and noted as well.
(90) Lung qPCR for PRRSV:
(91) For each set of lungs, two samples from the Left and Right Apical lobes, the Left and Right Cardiac lobes, the Left and Right Diaphragmatic lobes and the Intermediate lobe, were retained. For one set of lung samples, all three samples from the left side were combined into one container; while all three samples from the right side and the Intermediate lung lobe sample were combined into another container. Each container was filled with a sufficient amount of 10% formalin solution. For the other set of lung samples, all three lung samples from the left side were combined into one WHIRLPAK; while all three samples from the right side and the Intermediate lung lobe sample were combined into another WHIRLPAK.
(92) Frozen lung tissue samples were held at 7010 C. until further analysis. For each piglet, all left lung samples were homogenized and tested as a single combined sample; and all right lung tissues and the intermediate lung lobe sample were homogenized and tested as a single combined sample. Results were reported as n.d. (not detected), positive (EU PRRSv detected, but not quantifiable, GE/mL (genome equivalent)=<3.3 log) or a test value (log GE/mL) for left and right lung samples. For analysis purposes for each piglet, the mean of left and right lung sample qPCR results were noted. For statistical purposes, not detected was assigned a value of 0 log GE/mL and a positive value was assigned a value of 3.0 log GE/mL.
(93) Results
(94) Total Lung Lesion Score Post-Challenge:
(95) A summary of group minimum, maximum, median, 95% confidence interval, Q range and mean for total lung lesion scores showed that the low, medium and high titer vaccine groups had median total lung lesion scores of 0.13%, 0.55%, and 0.40%, respectively; while the challenge control group had a median total lung lesion score of 33.40%. The median total lung lesion scores for the three vaccine titer groups were significantly lower than the challenge control group (p<0.0001). There were no statistical differences between vaccine titer groups (p0.1484) for total lung lesion scores. The negative control group had a median total lung lesion score of 0.00%.
(96) For one of the animals (high titer vaccine group), histologically mild suppurative interstitial pneumonia with copious fibrinopurulent pleuritis was noted. Airways and alveoli were relatively unremarkable except for scattered neutrophils. Lung tissue was IHC negative for M. hyo, PCV2, PRRSv and SIV antigens. Lung lesions were consistent with serositis generally associated with bacterial agents (Addendum 12; Accession 2009030254). Several pure bacterial cultures from lung tissue were isolated and identified as Bordetella bronchiseptica and a coagulase negative Staphylococcus. Although two types of bacteria were isolated from lung tissues, this piglet was not removed from Group 3 total lung lesion score analyses.
(97) Two of 10 negative control piglets exhibited very minor lung lesions (No. 1767, 0.55%; No. 1789, 0.61%). These lesions were considered insignificant and not indicative of PRRS. Two of 10 negative control piglets exhibited very minor lung lesions (No. 1767, 0.55%; No. 1789, 0.61%). These lesions were considered insignificant and not indicative of PRRS.
(98) PRRS Viremia Post-Challenge:
(99) Individual PRRS viremia post-challenge results (D31-D38) were tabulated and it was found that all piglets were viremic post-challenge in the three vaccine titer groups and the challenge control group. At all three time points post-challenge, the three vaccine titer groups had significantly less viremia than the challenge control group (p0.0093). There were no differences between vaccine titer groups for viremia post-challenge except on D35, when the high titer vaccine group exhibited a lower mean viremia than the medium titer vaccine group (p=0.0442). Negative control piglets were negative for viremia on D31, D35 and D38. Area under curve (AUC) represents both the quantity and duration of viral load and is a good assessment tool for examining viremia. Significant differences were also detected between the three vaccine titer groups and the challenge control group with respect to AUC at both D28 to D38 (p0.0162), and D31 to D38 (p<0.0001). No differences were detected between vaccine titer groups with respect to AUC (p0.3669) at both time intervals.
(100) The group frequency of viremic positive piglets was also summarized for D31 to D28 and is shown in Table 2.3. Since all vaccine and challenge control piglets were viremia positive post-challenge, the frequency viremia positive piglets was 100% for each group at each time point. Hence, no analyses were conducted on post-challenge frequency for viremia.
(101) TABLE-US-00005 TABLE 2.3 Summary of Group Frequency of Viremic Positive Piglets - D 31 to D 38 No. Total Study Day Group* Positive % Positive 95% CI No. 31 1 14 100 76.8 100.0 14 2 15 100 78.2 100.0 15 3 15 100 78.2 100.0 15 4 14 100 76.8 100.0 14 5 0 0 0.0 30.8 10 35 1 14 100 76.8 100.0 14 2 15 100 78.2 100.0 15 3 15 100 78.2 100.0 15 4 14 100 76.8 100.0 14 5 0 0 0.0 30.8 10 38 1 14 100 76.8 100.0 14 2 15 100 78.2 100.0 15 3 15 100 78.2 100.0 15 4 14 100 76.8 100.0 14 5 0 0 0.0 30.8 10 *Group 1 = Low titer PRRS 94881 MLV; Group 2 = Medium titer PRRS 94881 MLV; Group 3 = High titer PRRS MLV; Group 4 = Challenge control group; Group 5 = Negative control group
(102) Lung qPCR Results:
(103) Individual lung virus isolation results post-challenge were summarized as was the frequency of qPCR positive lung sample test results (p-values) for differences between groups. Lung tissues from piglets in all three vaccine titer groups and the challenge control group were qPCR positive for PRRSv post-challenge. There were no significant differences detected between vaccine titer groups and the challenge control group (p=1.0000). Since all vaccine titer piglets were qPCR positive for PRRSv, no tests were conducted between vaccine titer groups.
(104) Although no differences were detected between vaccine titer groups and the challenge control group for frequency of qPCR positive lung tissues, differences were evident for viral load in lung tissues. Indeed, the low, medium and high titer vaccine groups had median lung qPCR values of 6.88, 6.80 and 6.81 log.sub.10 GE/mL, respectively; while the challenge control group had a median lung qPCR value of 8.13 log.sub.10 GE/mL. The differences between the vaccine titer groups and the challenge control group were significant (p0.0001). Conversely, no differences were detected between vaccine titer groups for median lung qPCR values (p0.7379).
(105) Clinical Observation Scores Post-Challenge:
(106) Abnormal respiration and behavior were not severe post-challenge, as evidenced by median maximum clinical scores of 0 (a score of 0 represented normal respiration or normal behavior) for all five groups. In addition, no significant differences were detected between vaccine titer groups and the challenge control group for both abnormal respiration and behavior (p0.0996).
(107) Coughing was noted in all three vaccine titer groups and the challenge control, but was more severe in the challenge control group. For the three vaccine titer groups, each group had a maximum cough score of 1, which represented soft or intermittent coughing and median maximum cough score of 0. Conversely, the challenge control group had a maximum cough score of 2, which represented harsh or severe, repetitive coughing, and a median maximum cough score of 1. The three vaccine titer groups had significantly less severe coughing than the challenge control group (p0.0082). Coughing was not noted in the negative control group.
(108) All three vaccine titer groups had maximum total scores of 1 and median maximum scores of zero. Conversely, the challenge control group had a maximum total score of 4 and a median maximum score of 1. The three vaccine groups had significantly lower maximum total clinical scores than the challenge control group (p0.0047). Again, the negative control group had a maximum total clinical score of zero and a median maximum total clinical score of zero.
(109) The frequency of abnormal respiration or behavior for at least one day from D29 to D38 was low for all groups. Indeed, no abnormal respiration was noted in low and medium vaccine titer groups from D29 to D38. The high titer vaccine group had one of 15 (7%) piglets and the challenge control group had 3 of 14 (21%) piglets with abnormal respiration. Abnormal behavior was not noted in any vaccine titer group; while 2 of 14 (14%) challenge control piglets exhibited abnormal behavior for at least one day post-challenge. No significant differences were detected between vaccine titer groups and the challenge control group for frequency of abnormal respiration or behavior for at least one day post-challenge (p0.0996). Abnormal respiration or behavior was not noted in the negative control group.
(110) The frequency of coughing was much higher in the challenge control than in the three vaccine titer groups. Indeed, the frequency of coughing for at least one day post-challenge was 14%, 13% and 27% for the low, medium and high titer vaccine groups, respectively. Conversely, the frequency of coughing for at least one day post-challenge for the challenge control group was 71%. The three vaccine titer groups had significantly less frequency of coughing than the challenge control group (p0.0268).
(111) The frequency of any clinical sign post-challenge, as represented by a total clinical score>0, was higher in the challenge control group than in the three vaccine titer groups. Similar to the frequency of cough, the frequency of any clinical sign for at least one day post challenge was 14%, 13%, and 33% for the low, medium, and high titer vaccine groups, respectively; while 79% of piglets in the challenge control group had a least one clinical sign post-challenge. The three vaccine groups had significantly lower frequency of any clinical sign post-challenge than the challenge control group (p0.0253). No clinical signs were noted in the negative control group during this same time period.
(112) Mean scores for abnormal respiration or behavior from D29 to D38 were low for all groups. Indeed, the mean respiration scores for the low and medium vaccine titer groups were 0.00 (normal), the high titer vaccine had a mean respiration score of 0.01 and the challenge control had a mean respiration score of 0.03. The mean score for behavior was 0.00 for all three vaccine titer groups; while the challenge control had a mean behavior score of 0.01. No significant differences were detected between vaccine titer groups and the challenge control group for mean respiration and behavior scores (p0.0996). Respiration and behavior mean scores for the negative control group were 0.00.
(113) The challenge control group had a higher mean cough score than the three vaccine titer groups. Indeed, the mean cough scores were 0.01, 0.01 and 0.04 for the low, medium and high titer vaccine groups, respectively. Conversely, the mean cough score for the challenge control group was 0.28. The three vaccine titer groups had significantly lower mean cough scores than the challenge control group (p0.0077).
(114) The mean total score was higher in the challenge control group than in the three vaccine titer groups. Similar to the mean cough scores, the mean total scores post challenge were 0.01, 0.01, and 0.04 for the low, medium, and high titer vaccine groups, respectively; while the mean total score for the challenge control group was 0.32. The three vaccine groups had significantly lower mean total scores than the challenge control group (p0.0025).
(115) Rectal Temperatures Post-Challenge:
(116) The maximum group mean rectal temperatures for low, medium, and high titer vaccine groups between D29 to D38 were 40.20 C. (D33), 40.33 C. (D35), and 40.20 C. (D37), respectively. The maximum group mean rectal temperature for the challenge control group and the negative control group between D29 and D38 were 40.51 C. (D33) and 39.95 C. (D33), respectively.
(117) The low titer vaccine group had significantly lower rectal temperatures than the challenge control group on D29 (39.47 vs. 39.90 C.), D31 (39.85 vs. 40.20 C.), D35 (39.80 vs. 40.22 C.) and D38 (39.86 vs. 40.32 C.) (p0.0317); while the low titer vaccine had a significantly higher rectal temperature than the challenge control group on D30 (40.08 vs. 39.58 C.; p=0.0003). No significant differences were detected between the low titer vaccine group and the challenge control group on D32-D34 and D36-D37 (p0.0545).
(118) The medium titer vaccine group had significantly lower rectal temperatures than the challenge control group on D31 (39.62 vs. 40.20 C.), D33 (40.15 vs. 40.51 C.), and D38 (39.58 vs. 40.32 C.) (p0.0227). No significant differences were detected between the medium titer vaccine group and the challenge control group on D29-D30, D32, and D34-D37 (p0.0580).
(119) The high titer vaccine group had a significantly lower rectal temperature than the challenge control group on D33 (40.12 vs. 40.51 C.), D35 (39.79 vs. 40.22 C.), and D38 (39.55 vs. 40.32 C.) (p0.0147); while the high titer vaccine group had a significantly higher rectal temperature than the challenge control group on D32 (40.31 vs. 39.90 C.; p=0.0063). No significant differences were detected between the high titer vaccine group the challenge control group on D29-D31, D34 and D36-37 (p0.0708).
(120) There was less frequency of pyrexia in the three vaccine titer groups post-challenge compared with the challenge control group. The frequency of pyrexia was low overall and similar between vaccine titer groups.
(121) Average Daily Weight Gain (ADWG):
(122) The least square mean ADWG from D0 to D28 for the low, medium and high titer vaccine groups were 0.4, 0.3, and 0.4 kg/day, respectively. The least square mean ADWG during this same time period for the challenge control group was 0.3 kg/day. The low titer vaccine group had a significantly higher least square mean ADWG than the challenge control group from D0 to D28 (p=0.0292); while no other significant differences were detected between vaccine titer groups and the challenge control group (p0.1262), or between vaccine titer groups (p0.1293), for least square mean ADWG. During this same time period, the negative control group had mean ADWG of 0.5 kg/day.
(123) The least square mean ADWG from D28 to D38 for the low, medium and high titer vaccine groups were 0.5, 0.5 and 0.4 kg/day, respectively. The least square mean ADWG during this same time period for the challenge control group was 0.3 kg/day. The three vaccine titer groups significantly out gained the challenge control group post-challenge (p0.0027). During this same time period, the negative control group had a mean ADWG of 0.6 kg/day.
(124) Clinical Assessments Post-Vaccination:
(125) In the low titer vaccine group, one piglet (1735) was noted as thin from D0 to D10. In addition, one piglet beginning on D6 was noted as thin for 16 days, exhibited cough for 2 days and depression for 9 days, and was euthanized on D21 for animal welfare reasons due to poor health. Piglet 1727 had a total lung lesion score of 10.8%. Since this value was determined pre-challenge, it was not included in post-challenge total lung lesion analysis. In addition, areas of red/purple consolidation in the cranioventral areas of the lungs were noted, the liver was pale and kidneys had multiple red/purple areas in the renal pelvis. The pathologist noted fatty infiltration in central lobules in the liver, commonly seen in cases of negative energy balance and consequent lipolysis. No other lesions were observed in sections of liver, kidney and lung. Lung tissue was positive for EU PRRS by PCR. No growth was detected for routine bacterial culture.
(126) In the medium titer vaccine group, one piglet was excluded from the study on D0 prior to treatment due to poor health and was replaced by another piglet. Two Piglets exhibited coughing for one and three days, respectively, beginning on D12. Four piglets were noted as thin on D2, D3 or both D2 and D3.
(127) In the high titer vaccine group, one piglet (1728) exhibited lameness or lameness and swelling in one leg from D7 to D26. Beginning 18 days post-vaccination, one piglet was noted as thin for 6 days, and exhibited coughing for one day and rough hair coat for 4 days. Another Piglet was noted as thin on D2. Two Piglets exhibited coughing for two days and one day, respectively, beginning on D9. One piglet exhibited diarrhea for one day (D14).
(128) In the challenge control group, six piglets exhibited periodic coughing for a cumulative of one to six days, beginning with a first piglet on D7 and ending with three piglets on D21. Two piglets were noted as thin for two and 11 days, respectively, beginning on D1 for one of these piglets. The second of these two Piglets also exhibited depression and rough hair coat for 4 days, weak on legs for one day and was found dead on D15. At necropsy for this piglet there were no lung lesions (lung lesion score of 0%) noted, no feed in the stomach and no abdominal fat, and diagnosed starvation as the cause of death. Since this lung lesion score was determined pre-challenge, it was not included in post-challenge lung lesion analysis.
(129) The group test results (p-values) were summarized for any abnormal clinical assessment for at least one day from D1 to D26. No significant differences were detected between vaccine titer groups and the challenge control group (p0.0502); nor between vaccine titer groups (p0.3898). No piglets in the negative control group exhibited an abnormal clinical assessment from D1 to D26.
(130) PRRS Serology:
(131) Individual piglet PRRS ELISA serology results were summarized. Piglets in the negative control group remained PRRS seronegative throughout the study. Seroconversion could be observed in the 3 vaccine titer groups by 14 days post-vaccination; while the challenge control group remained PRRS seronegative until post-challenge. Ten days post-challenge (D38) all piglets in the low and high titer vaccine groups and the challenge control group were PRRS seropositive; while 14 of 15 piglets in the medium titer vaccine groups were PRRS seropositive.
(132) PRRS ELISA positive serology test results (p-values) were determined for differences between groups. The three vaccine titer groups had significantly higher frequencies of PRRS ELISA positive piglets than the challenge control group on D14, D21 and D28 (p<0.0001). No significant differences were detected between the three vaccine titer groups and challenge control on D38 (p=1.0000 or no test conducted) nor between the three vaccine titer groups at any time point (p=1.0000 or no test conducted).
(133) PRRS Viremia Post-Vaccination:
(134) Individual PRRS viremia results post-vaccination were determined. For statistical purposes, a not detected result was assigned a value of 0 log GE/mL and a positive value was assigned a value of 3.0 log GE/mL. All groups were PRRS viremia negative on D0. The group viremia (qPCR)D7 to D28 post-vaccination titer (log GE/mL) data was assessed. Piglets in the three vaccine titer groups reached peak mean viremia on D7, after which titers levels for all three groups slowly declined prior to challenge (SD28). Conversely, the challenge control group and the negative control group remained negative for viremia during the pre-challenge phase of the study. From the group test results (p-values) for D7, D14, D21 and D28 qPCR results it was seen that all three vaccine titer groups had significantly higher median qPCR values than the challenge control group for D7-D28 (p0.0159). The medium vaccine titer group had a significantly higher qPCR median value than the low titer vaccine group (p=0.0193); otherwise, no differences were detected for qPCR median values between vaccine groups pre-challenge (p0.0594).
(135) Four weeks post-vaccination, the frequency of viremia was low in the three vaccine titer groups.
(136) The following conclusions can be made based upon these study results: The absence of any break of biosecurity during the study and the confirmation of piglet's susceptibility to PRRS confirmed the validation of the study and its suitability for interpretation Substantial PRRS clinical disease was evident in the challenge control group, thus validating this challenge model as an adequate laboratory tool to evaluate PRRS vaccine efficacy and more specifically, the MID of PRRS 94881 MLV All three dose levels of PRRS 94881 MLV were associated with significant reduction in lung lesions, as well as significant reduction in viremia post-challenge, viral load in lung tissues, coughing, total clinical observation scores, pyrexia and ADWG The MID of PRRS 94881 MLV as determined in this study is associated with the low titer vaccine level of 110.sup.2.77 TCID.sub.50/mL, based on a relevant reduction in gross lung lesions for all three titer levels in comparison to the challenge controls after receiving a virulent heterologous European-derived PRRS challenge.
(137) Further Depiction of Results
(138) Clinical observations were taken every day. Quantitative RT-PCR was performed using PRRSV European specific primers for samples form blood, oral, fecal, and nasal swab, as well as lung lavages.
(139) From these studies data showed that the piglets showed normal health except for a few pigs that were lame. Post-mortem there were no abnormalities at necropsy except that 1-2 animal showed signs of mildly enlarged inguinal lymph nodes. Importantly, it was seen that there were no lung lesions observed with the vaccinated group.
(140)
Example 3
Exemplary Materials and Methods for Use in Testing Vaccine Efficacy Using PORCILIS PRRS as an Example
(141) A selected number, for example, fourteen healthy pregnant sows from a confirmed PRRSV negative herd (tested virologically and serologically) were used in this study. Sows faced first or second parturition and were confirmed to be pregnant at the time of vaccination/challenge infection on day 94 of gestation. The sows were divided into three treatment groups. The first group was treated with a commercial dose of Porcilis PRRS of 2 ml containing at least 10.sup.4 TCID.sub.50 via intramuscular administration at day 94 of gestation. The challenge control group (group 2) received a dose of 10.sup.4.72 TCID.sub.50 in 2 ml cell culture medium of the pathogenic European field isolate (passage 4) intranasally. Group 3 was vaccinated with a dose of 2 ml containing 10.sup.7.6TCID.sub.50 i.m. PRRS MLV containing attenuated PRRS strain deposited at ECACC Accession No. 11012502 on Jan. 25, 2011 seven days before insemination and was challenged with the European field isolate (passage 4) (10.sup.4.72 TCID.sub.50 in 2 ml cell culture medium i.n.) at day 94 of gestation.
(142) Animals from group 1 were monitored until day 5 post-farrowing. Animals from group 2 and 3 were monitored until day 28 post farrowing.
(143) Animal Phase: All sows were accustomed to the animal facilities 1 week before vaccination. Sows and piglets were observed for their general health status by the investigator on a daily basis. Every animal that died or was euthanized was subjected to post-mortem examination and subsequent laboratory analysis.
(144) Pregnancy was confirmed with ultrasound examination. Serum from sows was obtained on study days 0, 7, 14 and at farrowing for PCR and ELISA investigations. Any material that was associated with abortion was subjected to laboratory investigations.
(145) Routine gross pathology was performed on all deadborn piglets. Lung tissue samples from all lung lobes were collected from deadborn piglets and from mummies. Samples for PCR testing were stored at 70 C. 2 ml of precolostral blood from each piglet was collected on the day of birth. Serum was prepared and aliquots were stored at 70 C. Serum was used to test for viremia to evaluate the transplacental infection. All piglets of group 1 that survived until day 5 were euthanized at 5 days of age.
(146) Clinical and Reproductive Performance Parameters: The following criteria are exemplary criteria that may be investigated (priority order): number of live born piglets per litter, number of stillborn piglets per litter, number of mummified fetuses per litter and number of piglets surviving through day 5 or 28 of age, respectively. The number of piglets born viremic was determined using pre-colostral serum. The frequency of PCR positive blood and tissue samples from sows and/or piglets was investigated to evaluate the epidemiology and course of infection.
(147) Field Samples: The field samples investigated in this study were taken from routine PRRSV diagnostics and consisted of blood, serum and various organ materials, mostly lungs and lymph nodes, from different European countries. The samples were stored at 20 C. for a maximum of 3 days before RNA preparation and residual material was subsequently transferred to 70 C. for long term storage. RNA and RT-PCR products were stored at 20 C.
(148) Cell Culturing: MA104 cells (clone CL2621) were grown in MEM (Dulbecco, Germany) supplemented with 10% FCS and antibiotics.
(149) Porcine alveolar macrophages were harvested using a method described by Wensvoort et al. (Wensvoort, G. et al. Vet. Quat. 1991, 13:121-130) and modified as follows: each lung lobe was infused with 50-100 ml PBS and subsequently massaged for 3 to 5 min. Then the fluid was rescued from the lobe and passed through a gaze filter. This procedure was repeated until the lavage fluid was clear. The pooled lavage fluid was centrifuged at 500 g for 15 min at room temperature. The pellet was washed in PBS and aliquots of 110.sup.7 cells in 50% RPMI 1640 (Biochrom), 40% FCS and 10% DMSO were frozen at 196 C. For further use the PAMs were cultured in RPMI 1640 medium supplemented with 10% FCS and antibiotics.
(150) Preparation of Organ Material for Virus Isolation in Cell Culture: About 0.5 cm.sup.3 of tissue material was transferred into a tube containing one steel homogenizer ballet in 1.8 ml of sterile PBS. The tubes were agitated for 10 min until the organ material was homogenized. Cell debris was pelleted by centrifugation for 2 min at 450 g and room temperature. The supernatant was passed through a 0.45. mu.m pore sterile filter and stored at 70 C. Aliquots of 30 l were used to inoculate one semiconfluent cell culture monolayer using 24 well microtiter plates.
(151) RNA Isolation: RNA from organ material was extracted with the RNeasy Mini Kit and from serum, plasma, cell culture supernatant and vaccine solution with the QTAamp Viral RNA Mini Kit (both Qiagen) according to the manufacturer's recommendations, using approximately 100 mg organ material and 140 l fluid material, respectively, for each preparation. The RNA was finally eluted in 65 l buffer as recommended by the manufacturer.
(152) Plaque Purification of Virus: Confluent monolayers of Ma104 cells in cell culture dishes of 10 cm seeded 48 hours before were infected with the respective virus at tenfold dilutions from 10.sup.1 to 10.sup.4. The cells were incubated for 1 hour with the virus dilutions which were then removed, and the cells were overlaid with 30 ml of Ma104 medium containing 5% methylcellulose (Sigma). Plaques were picked after five to seven days and were transferred to Ma104 monolayers in 24 well plates. Virus from these plates was harvested at about 50% CPE and was subjected to further analysis.
(153) Immunofluorescence Assay: Cells were fixed at 20 C. for 15 min using ice-cold aceton:methanol (1:1) and air-dried thereafter. After rehydration in PBS, cells were incubated with the PRRSV specific monoclonal antibody SDOW17 (Rural Technologies Inc., USA) diluted 1:1000 in PBS for 1 hour. After 3 washes with PBS, cells were incubated with goat anti-mouse FITC conjugated secondary antibody (Dianova, Hamburg, Germany) (1:150 in PBS) for another hour. After 3 final washes with PBS, cells were overlaid with glycerine:PBS solution (1:1) and subjected to immunofluorescence microscopy.
(154) Diagnostic nRT-PCR: A diagnostic RT-nPCR can be carried out to check the samples for the presence of PRRSV-EU virus.
(155) An exemplary diagnostic RT-nPCR can be carried out with the Titan One Tube Kit (Roche Molecular Biochemicals) as follows: [5 l total RNA preparation, 1*RT-PCR buffer, 0.4 mM dNTPs, 20 pmol of primers PLS and PLR, 5 mM dithiothreitol, 1 mM MgCl.sub.2, 2.5-5 U RNasin (Promega Ltd), 1-2.5 U enzyme mixture, adjusted to a final volume of 25 l with DEPC treated aqua dest]. Routine cycling conditions used can be: 45 C. for 1 hour, 94 C. for 2 min and 30 cycles of 94 C. for 30 sec, 58 C. for 45 sec and 68 C. for 45 sec, final elongation step at 68 C. for 5 min. The nested PCR reaction was carried out with Qiagen Taq (Qiagen AG) as follows: [1 l RT-PCR product, 1*PCR buffer, 10 l Q-solution, 3.5 mM MgCl.sub.2, 0.3 mM dNTPs, 20 pmol of each EU-7-n-s and EU-7-n-as primers, 2.5 U Taq polymerase, adjusted to a final volume of 50 l with aqua dest]. Cycling conditions were as follows: 7 cycles with 94 C. for 1 min, 58 C. for 1 min and 72 C. for 1 min, followed by 30 cycles with 94 C. for 1 min and 70 C. for 1.5 min (no annealing step), final elongation step at 70 C. for 5 min.
(156) Nucleotide Sequencing: Nucleotide sequencing can be performed on the nested PCR products which had been generated with primers that contained an M13 tag, either directly from the PCR reaction or from PCR products that had been excised from agarose gels and purified with the JETsorb gel extraction kit (Genomed). Sequencing was done using the automated sequencer LI-COR DNA Analyzer GENE READIR 4200 (LI-COR Inc., Lincoln, Nebr., USA). Nucleotide and deduced amino acid sequences can be analyzed with ALIGNIR, vs1.1 (LI-COR Inc., Lincoln, Nebr., USA) and the DNASIS 2.6 software package (Hitachi Software Genetic Systems Inc., San Francisco, USA).
Example 4
Determination of the Full Length Genome Sequence PRRSV 94881
(157) The present example shows the determination of the full length genome nucleotide sequences of the attenuated 94881 strain and its parental strain 94881, passage 5. These sequences did not show any unclear nucleotide position what indicates the presence of a homogeneous viral content. The comparison of the 94881 Master Seed Virus with the European Reference Virus strain Lelystad Virus (LV) revealed nucleotide homologies ranging from 85.40 to 95.09 percent in the 8 different viral genes and amino acid identities from 86.39 to 97.27 percent between both virus strains. Two deletions in the ORF 1a of 94881 MSV could be identified compared to LV. The comparison between 94881 Master Seed Virus and its parental strain, passage 5, showed 26 nucleotide exchanges between both resulting in a total number of 14 amino acid exchanges.
(158) For the full length genome sequence determination of the 94881 Master Seed Virus a total number of 1 reverse transcription, 17 external PCRs and 58 internal PCRs was performed, resulting in 40 PCR products which were used for sequencing. In case of 94881, passage 5, 1 reverse transcription, 17 external PCRs and 67 internal PCRs were performed, resulting in 40 PCR products, also, used for sequencing.
(159) Overlapping sequence alignment analyses resulted in a full length sequence of 14843 nucleotides for both virus isolates comprising the complete open reading frames (ORFs) 1a to 7, each. Additionally, 177 nucleotides of the 5-non translated region (5 NTR) and 43 nucleotides of the 3-non translated region (3NTR) could be determined, each. Compared with the European PRRSV reference virus isolate Lelystad (LV) (GenBank Assession no. M96262) 44 nucleotides of the 5NTR and 83 nucleotides of the 3NTR could not be determined as those regions were used for primer annealing regions.
(160) The sequencing reactions resulted for both virus strains in a clear nucleotide sequence without any wobbles or any other indication on a mixed sequence. After translation into amino acids clear amino acid sequences without any questionable amino acid were available for sequence comparison of 94881 MSV with the LV and with the parental strain 94881 passage 5. The alignments and comparisons of the nucleotide sequences between 94881 MSV and Lelystad virus were performed and showed that there were substantial differences at the nucleotide and amino acid level. Alignments also were performed between 94881 MSV and its parental strain, passage 5.
(161) Sequence comparisons with LV resulted in nucleotide homologies from 85.40 to 95.09 percent in the 8 different viral genes and amino acid identities from 86.39 to 97.27 percent between both virus strains. Two deletions in the ORF 1a of 94881 MSV can be identified compared to LV. One deletion of 138 nucleotides is located at position 2154 to 2292 of LV and results in 46 missing amino acids. At position 2686 to 2688a further triplet is deleted resulting in the missing amino acid Phenylalanine. An arrangement of all nucleotide homologies and amino acid identities between LV and both 94881 strains is shown in Table 4.1.
(162) TABLE-US-00006 TABLE 4.1 Arrangement of nucleotide and amino acid sequence comparisons of the 94881 Master Seed Virus to the European Reference Virus Lelystad Virus no. of genetic no. of amino nucleotide homology amino acid acid deviations to Lelystad deviations identity length of the viral to Lelystad Virus in to Lelystad to Lelystad ORF gene/protein nn/aa Virus percent Virus Virus in 5NTR 177*/ 9 94.92 1a 7050**/2349 1050 85.40 326 86.39 1b 4392/1463 346 92.12 40 97.27 2 750/249 67 91.07 23 90.76 3 798/265 72 90.98 28 89,43 4 552/183 52 90.58 23 87.43 5 606/201 58 90.43 23 88.56 6 522/173 26 95.02 5 97.11 7 387/128 19 95.09 9 92.97 3NTR 44***/ 2 95.45 NTR: non translated region *= Only 177 nucleotides were compared between Lelystad Virus and 94881 MSV. The remaining 44 nucleotides, located upstream, had not been determined. **= The isolate 94881 MSV shows two deletions in the ORF 1a, one with 138 nucleotides and one with 3 nucleotides, respectively. The complete nucleotide and amino acid sequences of the Reference virus LV were used for the homology and identity calculations, deletions are assessed as deviations. The length of the corresponding viral gene of LV is 7191 nucleotides and the corresponding polyprotein 2396 amino acids, calculations of genetic homology and amino acid identity refer to the numbers of 7191 nucleotides and 2396 amino acids, respectively. ***= Only 44 nucleotides were compared between Lelystad Virus and 94881 MSV. The remaining 83 nucleotides, located downstream, had not been determined
(163) The sequence comparison of the full length nucleotide sequences of 94881 Master Seed Virus and 94881 Parental Strain, passage 5, revealed a total number of 26 nucleotide exchanges between both. The nucleotide exchanges were distributed as follows: 15 in the ORF 1a, 4 in the ORF 1b, 2 in the ORF 2, none in the ORF 3, 1 in the ORF 4, 3 in the ORF 5, 1 in the ORF 6 and none in the ORF 7. These nucleotide exchanges resulted in a total number of 14 amino acid exchanges which were distributed as follows: 8 in the polyprotein 1a, 1 in the polyprotein 1b, 1 in the glycoprotein 2, none in the glycoprotein 3, 1 in the glycoprotein 4, 2 in the glycoprotein 5 and 1 in the matrix protein. Both strains showed the same deletions compared to Lelystad Virus in ORF 1a. An arrangement of all nucleotide exchanges and resulting amino acid exchanges including the positions in the viral genes and corresponding proteins is shown in detail in Table 4.2.
Example 5
Culture of Deposited Virus and MSV
(164) As noted above, PARENT (low passage) 94881 is deposited at European Collection of Cell Cultures (ECACC) under the Accession Numbers ECACC 11012501, 94881 Master Seed Virus (MSV) is deposited at European Collection of Cell Cultures (ECACC) under the Accession Numbers ECACC 11012502. The growth and culture conditions for the parent virus and the MSV are provided in the present example.
(165) Parent 94881:
(166) This is a virus of a genotype which is PRRSV type 1, as such it is a European genotype PRRSV. The virus has a porcine host. The parent virus deposited at 11012501 was deposited at a titer of 5.81 Log 10 TCID.sub.50/mL. Host cells for virus propagation are MA 104 cells. These cells are cultured Minimal Essential Medium (MEM) with 3.7 g/L sodium bicarbonate containing 6% irradiated Fetal Bovine Serum at 371 C. The cells are plated in T-flasks (75 cm.sup.2) with a plating density of 210.sup.4 to 210.sup.5 cells/cm.sup.2 and cultivated for 3 to 7 days until 100% confluent prior to passage. For virus growth, the virus is added to the cells at a MOI of 0.001-0.01 in T-flasks. The cells infected are at a confluency of about 80-100%, typically 1-3 days post cell planting. The infected cells are cultivated at 371 C. for 3-10 days post infection and the virus is then harvested. The harvest is performed when monolayer cells exhibit approximately 80-100% cytopathic effect (CPE) at 3-10 days post infection. The supernatant of infected MA104 tissue cultures (spent media+PRRSV from a culture with 80-100% CPE) is harvested and contains the virus that has been propagated. This supernatant may be stored at 70 C./80 C. for several months until use. The virus is assessed for TCID.sub.50 with Spearman and Kaerber calculation to determine log 10 TCID.sub.50/mL of sample.
(167) Vaccine (high passage) 94881 Master Seed Virus (MSV): This is a virus of a genotype which is PRRSV type 1, as such it is a European genotype PRRSV. The virus has a porcine host. The MSV deposited at 11012502 was deposited at a titer of 6.43 Log 10 TCID50/mL. Host cells used for the propagation of the MSV are MA 104 cells. These cells are cultured Minimal Essential Medium (MEM) with 1.4 g/L sodium bicarbonate and containing 10% irradiated Fetal Bovine Serum at 362 C. The cells are plated in T-flasks (75-150 cm2) or 850 cm2 roller bottles with a planting density of 1104 to 1105 cells/cm2 and cultivated for 3 to 7 days until 100% confluent prior to passage. For virus growth, the virus is added to the cells at a MOI of 0.001-0.01 in T-flasks or roller bottles. The cells infected are at a confluency of about 80-100%, typically 1-3 days post cell planting. The infected cells are cultivated at 362 C. for 3-14 days post infection and the virus is then harvested. The harvest is performed when monolayer cells exhibit approximately 80-100% cytopathic effect (CPE) at 3-14 days post infection. The supernatant of infected MA104 tissue cultures (spent media+PRRS from a culture with 80-100% CPE) is harvested and contains the virus that has been propagated. This supernatant may be stored at 2-8 C. for 5-10 days, 70 C. for several months until use. The MSV is assessed for TCID50 with Reed and Muench calculation to determine log 10 TCID50/mL of sample.
(168) TABLE-US-00007 TABLE 4.2 Arrangement of nucleotide and amino acid sequence comparisons of the 94881 Master Seed Virus to 94881 Parental strain exchange exchange (nn) from no. of (aa) from no. of position parental synonymous/ deviating position parental deviating in viral strain to non amino in viral strain to ORF nucleotides gene MSV synonymous acids protein MSV 1a 15 309 C to T synonymous 8 753 G to T non 251 E to D synonymous 1474 G to A non 492 V to I synonymous 1789 G to A non 597 V to I synonymous 2094 C to T synonymous 2987 T to C non 996 L to S synonymous 3034 A to G non 1012 T to A synonymous 3065 A to G non 1022 E to G synonymous 3736 A to G non 1246 T to A synonymous 3966 C to T synonymous 4101 T to C synonymous 5803 C to T non 1935 L to F synonymous 6354 T to G synonymous 6519 C to T synonymous 6588 T to C synonymous 1b 4 591 T to C synonymous 1 1833 C to T synonymous 1932 C to T synonymous 3682 G to A non 1228 V to I synonymous 2 2 13 C to T non 1 5 H to Y synonymous 195 C to T synonymous 3 0 0 4 1 529 T to C non 1 177 F to L synonymous 5 3 109 A to G non 2 37 N to D synonymous 364 C to T non 122 L to F synonymous 570 C to T synonymous 6 1 214 C to T non 1 72 L to F synonymous 7 0 0
Example 6
PRRS 94881 MLV Gilt MID Stud
(169) Summary
(170) The objective of this vaccination-challenge study was to evaluate the minimum immunizing dose (MID) of Porcine Reproductive and Respiratory Syndrome Vaccine European-derived Isolate 94881, Modified Live Virus, Code 19T1.U_(PRRS 94881 MLV) in gilts. Two different titer levels were administered to PRRS seronegative gilts approximately 28 days pre-breeding (Day 0; D0), gilts were challenged with a heterologous European isolate of PRRSv at approximately 90 days of gestation (D118) and gilts were evaluated for the total number of live born piglets or percentages of live born piglets and weaned piglets at 20 days of age to determine the MID. At the time of challenge on Day 118 (D118), the challenge control group consisted of 8 pregnant gilts (Group 1, Placebo), the low titer group consisted of 8 pregnant gilts (Group 2, 110.sup.2.43 TCID.sub.50/dose), the high titer group consisted of 8 pregnant gilts (Group 3, 110.sup.3.90 TCID.sub.50/dose), and the negative control group consisted of 5 pregnant gilts (Group 4, Placebo, not challenged).
(171) Both the low titer and the high titer groups were associated with higher percentages of live piglets per litter at farrowing (P0.0455) and higher percentages and numbers of live piglets per litter at weaning (P0.0203) in comparison to the challenge control group.
(172) With regard to supportive efficacy parameters, the high dose group was associated with a higher percentage and number of healthy piglets per gilt at farrowing (P0.0211), a lower percentage and number of weak and mummified feti (P0.0090), a lower percentage of qPCR positive gilts and lower viral load in gilts post-challenge on D125, DOF 0 and DOF+13 (P0.0155), a lower percentage of piglets per gilt qPCR positive and lower piglet viral load on DOF 0 (P0.0030), a lower percentage of piglets per gilt with clinical disease (P<0.0001), and higher piglet body weights on DOF+20 and ADWG (P<0.0013), in comparison with the challenge control group.
(173) The low dose group was associated with a higher percentage of healthy piglets per gilt at farrowing (P=0.0138), a lower percentage and number of mummified feti (P0.0190), a lower percentage of qPCR positive gilts and lower viral load in gilts post-challenge on D125, D132, DOF 0 and DOF+13 (P0.0290), a lower percentage of piglets per gilt qPCR positive on DOF 0 (P=0.0381), a lower percentage of piglets per gilt with clinical disease (P<0.0001), and higher piglet body weight on DOF+20 and ADWG (P<0.0028), in comparison to the challenge control group.
(174) In conclusion, the study objective was met and data from this study establishes the MID of PRRS 94881 MLV in gilts as 110.sup.2.43 TCID.sub.50/2 mL. In addition, this study establishes duration of immunity (DOI) in gilts of approximately 4 months.
(175) Objective(s)/Purpose of the Study
(176) The objective of this vaccination-challenge study was to evaluate the minimum immunizing dose (MID) of Porcine Reproductive and Respiratory Syndrome Vaccine European-derived Isolate 94881, Modified Live Virus, Code 19T1.U_(PRRS 94881 MLV), at two different titer levels (Group 2, low titer; Group 3, high titer), administered to PRRS seronegative gilts pre-breeding to provide higher percentages of live born piglets and weaned piglets at 21 days of age, following challenge of gilts with a heterologous European isolate of Porcine Reproductive and Respiratory Syndrome virus (PRRSv) at approximately 90 days of gestation. The primary criteria to satisfy this objective was that one or both vaccine groups must demonstrate relevantly higher percentage or number of live born piglets and weaned piglets at 20 days of age (DOF+20), compared with the challenge control group (Group 1).
(177) Other parameters analyzed between the vaccine groups and the challenge control group included gilt clinical assessments post-vaccination, gilt PRRS serology, gilt viremia, gilt clinical observations, piglet viremia, total piglets per litter, healthy live piglets per litter, weak live piglets per litter, mummies per litter, stillborns per litter, crushed/mortalities piglets per litter, piglet clinical observations, and piglet average daily weight gain (ADWG). These parameters were analyzed as supportive parameters and did not serve as primary parameters to satisfy the study objective.
(178) Schedule of Events
(179) TABLE-US-00008 TABLE 6.1 Gilt Schedule of Events Study Day(s) Dates Key Study Event 2 or 1 20 Jul. 2010 to Health examination 21 Jul. 2010 1 to 21 21 Jul. 2010 to Groups 1-4: Daily Clinical Assessments 12 Aug. 2010 0 22 Jul. 2010 Groups 1-4: Blood collection; Vaccinated Groups 1 and 4 with Control Product (CP); Vaccinated Group 2 with Investigational Veterinary Product (IVP) No. 1 (low titer vaccine group); and vaccinated Group 3 with IVP No. 2 (high titer vaccine group) 8 to 21 30 Jul. 2010 to Groups 1-4: Treated gilts once daily with 12 Aug. 2010 Matrix to synchronize estrus cycles 7, 14, 21, 56 29 Jul. 2010, Groups 1-4: Blood collection and 84 05 Aug. 2010, 12 Aug. 2010, 16 Sep. 2010, 14 Oct. 2010 22 to 113 13 Aug. 2010 to Groups 1-4: Clinical Assessments at least 12 Nov. 2010 three times a week 26 to 32 17 Aug. 2010 to Groups 1-4: Observed for heat detection 23 Aug. 2010 and bred gilts by artificial insemination (Al) 84 14 Oct. 2010 Groups 1-4: Pregnancy check by ultrasound 116 to 20 15 Nov. 2010 to Groups 1-4: Clinical Observations, days after 05 Jan. 2011 recorded abortions, stillbirths, mummies, farrowing live piglets, weak born piglets 118 (approx. 17 Nov. 2010 Groups 1-4: Blood collection 90 days of Groups 1-3: Challenged with PRRSv gestation) isolate 190136 125,132, 24 Nov. 2010, Groups 1-4: Blood collection farrowing/ 01 Dec. 2010, abortion 03 Dec. 2010 to (DOF*), DOF 16 Dec. 2010, +7, DOF + 13 10 Dec. 2010 to 23 Dec. 2010, 16 Dec. 2010 to 29 Dec. 2010 DOF + 20 23 Dec. 2010 to Groups 1-4: Blood collection from 05 Jan. 2011 remaining gilts; Euthanized remaining gilts; Disposal DOF + 20 or 25 Dec. 2010 to Groups 1-4: Euthanized remaining gilts; later 05 Jan. 2011 Disposal *DOF = Day of Farrowing
(180) TABLE-US-00009 TABLE 6.2 Piglet Schedule of Events Study Day(s) Dates Key Study Event DOF 03 Dec. 2010 to All dead piglets: Weighed; Necropsied; 16 Dec. 2010 Collect Collected blood/body fluid if possible; lung samples All live piglets: Weighed; Blood collection (pre-colostral or peri-natal (within 12 hours of birth)) DOF +1 to 04 Dec. 2010 to All live piglets: Clinical Observations DOF +20 05 Jan. 2011 Dead piglets: Weighed; Necropsied; Collected blood/body fluid if possible; Collected lung samples DOF +7 10 Dec. 2010 to All live piglets: Blood collection 23 Dec. 2010 DOF +13 16 Dec. 2010 to All live piglets: Blood collection 29 Dec. 2010 DOF +20 23 Dec. 2010 to All live piglets: Weighed; Blood 05 Jan. 2011 collection; DOF +20 or 25 Dec. 2010 to Group 1-3 piglets: Euthanized later 05 Jan. 2011 remaining piglets, Disposal; Group 4 piglets: Assigned to another BIVI project
(181) Study Design
(182) TABLE-US-00010 TABLE 6.3 Study Design Challenged on D 118 with 6.0 mL Number Treatment on D 0 Number (2 mL/nostril; 2 mL IM) of gilts on (approximately of gilts on of 1 10.sup.6.30 TCID.sub.50 Group D 0 28 days prior to breeding) D 118 of PRRSv 190136 1 28 2.0 mL IM of Control Product 16 Yes (Challenge (Placebo matched product control without PRRS 94881 MLV) group) 2 28 2.0 mL IM of IVP No. 1 (1 16 Yes (Low titer 10.sup.2.43 TCID.sub.50 of PRRS group 94881 MLV) 3 28 2.0 mL IM of IVP No. 2 (1 16 Yes (High titer 10.sup.3.90 TCID.sub.50 of PRRS group) 94881 MLV) 4 10 2.0 mL IM of Control 5 No (Negative Product control group)
(183) Blinding Criteria
(184) The Study Investigator and designees were blinded with regard to gilts assigned to Groups 1-4. To maintain blinding of the Study Investigator and designees, a person not collecting data administered the IVPs and CP to assigned gilts on D0. Laboratory personnel were blinded to the treatment each gilt received while conducting their respective tasks.
(185) Materials
(186) Investigational Veterinary Products (IVP) and Control Product (CP)
(187) TABLE-US-00011 TABLE 6.4 Investigational Veterinary Products (IVPs) Generic Porcine Reproductive and Respiratory Syndrome, Product Name: Modified Live Virus Isolate: Isolate 94881 Formulation: The Manufacturer's Batch Protocol (MBP) for PRRS 94881 MLV vaccine, Lot 390-005 (cake) is presented in Appendix 1. The MBP for Sterile Carbopol Adjuvanted Diluent, Lot 808-002 (diluent) is presented in Section 15.1, Appendix 1. D 0 just prior to vaccination, BIVI- Ames reconstituted/diluted PRRS 94881 MLV vaccine, Lot 390-005 with Sterile Carbopol Adjuvanted Diluent, Lot 808-002 to formulate the two IVPs. IVP No. 1 was formulated to a targeted titer level of approximately 1 10.sup.3.0 TCID.sub.50/2 mL and IVP No. 2 was formulated to a targeted titer level of approximately 1 10.sup.4.5 TCID.sub.50/2 mL. An adequate volume of each IVP was formulated for vaccination and testing. IVP Lot/Serial IVP No. 1: N270-142 Nos.: IVP No. 2: N270-143 Manufacturer: Boehringer Ingelheim Vetmedica, Inc. 2621 North Belt Highway St. Joseph, MO 64506 Expiration An expiration date of 22 Jul. 2010 was assigned to each Date: IVP for study purposes only. Storage Rehydrated/diluted IVP was stored at 2-8 C. or on ice Requirements: Testing: PRRS 94881 MLV, Serial 390-005 and Sterile Carbopol Adjuvanted Diluent, Lot 808-002 were tested by BIVI- QC. At the start and end of the vaccination procedure, BIVI-Ames was contacted. BIVI-Ames tested pre- and post-vaccination aliquots of each IVP for virus titer in accordance with the PRRSv Titer Procedure (Section 15.1). Test Results: Test results for PRRS 94881 MLV, Serial 390-005 and for Sterile Carbopol Adjuvanted Diluent, Lot 808-002 were satisfactory IVP No. 1 had an average titer of 1 10.sup.2.43 TCID.sub.50/2 mL and IVP No. 2 had an average titer of 1 10.sup.3.90 TCID.sub.50/2 mL IVP Transfer: Two vials containing 35 mL of each IVP were transferred to the study site on D 0 just prior to vaccination. IVP Retention: A retention sample of each IVP is currently stored at 70 10 C. at BIVI-Ames until the final report has been signed.
(188) TABLE-US-00012 TABLE 6.6 Control Product (CP) Generic Product Placebo Name: Formulation: BIVI-Production produced lyophilized placebo product containing inert material comprised in the vaccine serial without PRRS 94881 MLV (Lot N240-191-062409, On D 0, BIVI-Ames reconstituted Lot N240-191-062409 with Sterile Carbopol Adjuvanted Diluent, Lot 808-002 to formulate the CP, Lot No. 270-141. Manufacturer: Boehringer Ingelheim Vetmedica, Inc. 2621 North Belt Highway St. Joseph, MO 64506, USA Lot Number: N270-141 Expiry Date: An expiration date of 22 Jul 2010 was assigned to the CP for study purposes only. Storage Lyophilized vaccine: 2-8 C. Conditions: Rehydrated CP: 2-8 C. or on ice Testing: CP was tested by BIVI-QC for EP sterility in accordance with Special Outline No. 96 Test Results: CP was determined to be sterile CP Transfer: Two vials containing 50 mL each of CP were transferred to the study site on D 0 just prior to vaccination. CP Retention: CP was formulated for this study only and was not retained.
(189) Challenge Material
(190) TABLE-US-00013 TABLE 6.7 Challenge Material Name/number of Porcine Reproductive and Respiratory Syndrome virus isolate Location and date Isolate 190136, Passage 2. Isolate #190136 was of isolation incl. obtained from lung tissue of a new born piglet from a clinical symptoms farm showing typical reproductive signs of PRRS (abortions in gilts and weakness in new born piglets) during an outbreak in Lower Saxony, Germany, in April 2004. The attending veterinarians submitted the samples to bioScreen (sample arrived on 21 Apr. 2004). Isolate #190136 could directly be propagated on AK-MA104 cells. Formulation: Challenge virus was thawed and diluted with MEM (Minimum Essential Medium) to a targeted titer of approximately 1 10.sup.6 TCID.sub.50/3 mL on D 118. An adequate volume of challenge material was prepared. Two aliquots were removed from challenge material. Lot Number: N289-034 Manufacture: Boehringer Ingelheim Vetmedica, Inc.-USA Storage conditions Bulk challenge material was stored at 70 10 C. Once prepared, diluted challenge material was maintained on ice until it was administered. Testing: At the start and end of the challenge procedure, BIVI- Ames was contacted. BIVI-Ames laboratory personnel tested pre- and post-challenge aliquots for virus titer in accordance with the PRRSv Titer Procedure Test Results: The challenge material had a mean titer of 1 10.sup.6.30 TCID.sub.50/6 mL dose Challenge material Three vials containing 101 mL each of challenge transfer: material were transferred to the study site on D 118 just prior to administration. Administration 2.0 mL/nostril and 2.0 mL IM in the left neck route (administered to all gilts in Groups 1, 2 and 3 on D 118). Challenge material Challenge material was formulated for this study only retention: and was not retained.
(191) Additional Treatments
(192) MATRIX (6.8 mL; Alternogest; Intervet/Schering Plough Animal Health) was administered in each gilt's feed from D8 to D21 to synchronize estrus cycles.
(193) Oxytocin (VetTek) was administered at parturition to assist gilts with farrowing, but not for initiation of farrowing. At farrowing, all live piglets received 1.0 mL iron injection (Phoenix or Durvet), 1M, in the right ham for prevention of iron deficiency anemia shortly after birth. Additionally, all live piglets received gentamicin (SparHawk Laboratories Inc.) as a scour preventative shortly after birth. All treatments were recorded on the Biological & Pharmaceutical Treatment Record form.
(194) Treatments
(195) Dosing Justification
(196) Each IVP was administered as a 2.0 mL dose to assigned gilts to evaluate the MID of PRRS 94881 MLV. A 2.0 mL dose of the CP was administered to gilts assigned to groups 1 and 4.
(197) Dosing Regimen
(198) On D0, each IVP or CP was administered to each respective gilt IM in the right neck region using a sterile 3.0 mL Luer-lock syringe and a sterile 18 g1 inch (2.54 cm) needle by a person not collecting study data. The dosing regimen is shown below in Table 6.8.
(199) TABLE-US-00014 TABLE 6.8 Dosing Regimen Group Number Treatment Dose/Route Study Day 1 28 CP 2.0 mL IM D 0 2 28 IVP No. 1 2.0 mL IM D 0 (low titer dose) 3 28 IVP No. 2 2.0 mL IM D 0 (high titer dose) 4 10 CP 2.0 mL IM D 0
(200) Methods and Precautions for Study Personnel
(201) Personnel administering IVPs, the CP and challenge material adhered to safety precautions and wore personal protective equipment as outlined for the specific study site.
(202) Animal Information
(203) Details of Study Animals
(204) TABLE-US-00015 TABLE 6.9 Animal Information Source: Wilson Prairie View Farms N5627 Highway DD Burlington, WI 53105 Number of gilts: 94 Arrival date: Gilts arrived at the Veterinary Resources, Inc. facilities in two shipments on 15 Jul. 2010 (D-7) and 20 Jul. 2011 (D-2). Identification: Individually ear tagged with unique number Species: Porcine Breed: Commercial crossbred Gender: Females Age range: Approximately 8 months of age on D 0 Ownership of test Boehringer Ingelheim Vetmedica, Inc. animals: Physiological All gilts were PRRS ELISA seronegative on D 0. Gilts status: selected for assignment to the study were observed by the Study Investigator on D-2 or D-1 and determined to e in good health and nutritional status. Pregnancy results: Gilts were checked for pregnancy on D 84. Group-Gilt Group 1 (n = 28): 1, 3, 5, Group 2 (n = 28): 12, 26, 31, Assignments on 6, 8, 11, 15, 18, 19, 34, 32, 41, 47, 49, 56, 58, 59, D 0 35, 39, 40, 52, 54, 68, 60, 64, 67, 69, 70, 72, 73, 79, 82, 88, 90, 95, 96, 75, 76, 77, 78, 85, 89, 93, 98, 101, 102, 107, 109 94, 100, 103 and 104 and 110 Group 3 (n = 28): 2, 7, Group 4 (n = 10): 4, 10, 13, 14, 22, 23, 25, 27, 28, 16, 17, 20, 21, 24, 29, and 30, 33, 36, 42, 46, 48, 108 51, 53, 57, 61, 62, 65, 66, 80, 84, 86, 91, 92, 105 and 106 Group-Gilt Nos. Group 1 (n = 16): 1, 6, Group 2 (n = 16): 12, 26, 31, Remaining in the 11, 18, 19, 40, 54, 68, 32, 41, 47, 49, 58, 64, 67, Study On D 118 79, 82, 88, 95, 96, 102, 72, 85, 89, 93, 100, and 104 98 102 and 107 Group 3 (n = 16): 7, 14, Group 4 (n = 5): 4, 13, 16, 23, 27, 33, 36, 46, 48, 17, and 108 57, 61, 62, 65, 66, 84, 92, and 106
(205) Inclusion/Exclusion Criteria
(206) All gilts enrolled in this study were PRRS ELISA negative, non-bred and were healthy at the time of vaccination as determined by observation.
(207) Post-Inclusion Removal of Gilts
(208) Five (5)Group 1 gilts (Nos. 5, 15, 34, 35 and 52), two (2)Group 2 gilts (Nos. 77 and 94), three (3)Group 3 gilts (Nos. 2, 25, and 30) and one (1)Group 4 gilt (No. 20) did not display estrus and were subsequently not bred. These gilts were removed from the study by D47.
(209) Two (2)Group 1 gilts (Nos. 109 and 110), nine (9)Group 2 gilts (Nos. 56, 59, 60, 69, 73, 75, 76, 78, and 103), four (4)Group 3 gilts (Nos. 22, 28, 51 and 53) and one (1)Group 4 gilt (No. 21) were removed from the study by D89 due to lameness, not pregnant, or late breeding.
(210) The study protocol stated that if >16 pregnant gilts per group for Groups 1-3 were still in the study prior to challenge, extra gilts would be randomly selected for removal from the study; thus leaving 16 pregnant gilts per group for Groups 1-3. Five (5)Group 1 gilts (Nos. 3, 8, 39, 90 and 101), one (1)Group 2 gilt (No. 70) and five (5)Group 3 gilts (Nos. 42, 80, 86, 91, and 105) were removed from the study by D104 based on randomizations by the statistician or selection by non-study person, reducing the group size to 16 gilts for Groups 1-3.
(211) Due to space limitations, the Study Investigator requested that the size of Group 4 be reduced from eight (8) to five (5). The statistician randomly selected three (3) gilts (Nos. 10, 24 and 29) for removal from the study, which were removed on D109.
(212) Animal Management and Housing
(213) Animal Housing
(214) Low IVP titer gilts were housed in Rooms 1 and 2, and high IVP titer gilts were housed in Rooms 3 and 4, in Building CB at VRI-Cambridge from D1 to study completion. Gilts assigned to the challenge control and negative control groups were housed in a single room at VRI-Risdal from D1 to D85. On D85, remaining gilts in the challenge control and negative control groups were moved to VRI-Cambridge. Sixteen (16)challenge control gilts were housed in Building CB, Rooms 5-8 and eight (8)negative control gilts were housed in Building CA, Room 12, for the remainder of the study. From D85 onward, each room was identical in layout with two rows of 4 farrowing crates per row. Each crate held one gilt and her progeny. Each crate was approximately 5 feet7 feet in size, was elevated off of the floor, metal rod panels for sides and plastic-mesh for flooring. There was no nose-to-nose contact between adjacent crates. The floor of each crate was washed down at least once daily to remove excrement and waste. Each room had separate heat and ventilation, preventing cross-contamination of air between rooms. Each room was cleaned and disinfected prior to use for this study. Animal Services staff showered and donned clean clothes before entering each room.
(215) Treatment group isolation was necessary in this study as it is well known within the scientific community that PRRSv readily spreads from pig to pig via various mechanisms including aerosolization. This includes avirulent live PRRS vaccines as these biological products include attenuated virus particles that mimic the characteristics of virulent wild-type PRRS without the capability to cause disease. Proper methods were in place to ensure that biosecurity was maintained and that vaccinated animals did not accidentally cross-contaminate non-vaccinated, PRRSv nave negative control animals.
(216) Each room in the facility has fans and heaters to aid in sufficient air circulation and heating. The ventilation system is separate yet identical for each room, so air is not shared between rooms. Solid feed was stored in bags, free from vermin. Water was ad libitum from a well located at the animal facility. Gilts were fed a commercially prepared, non-medicated gestation or lactation ration (Heart of Iowa Cooperative, Roland, Iowa) appropriate for their size, age, and condition.
(217) Gilts were in good health and nutritional status before initiation of the study as determined by the Study Investigator. During the study, two gilts were observed with mild lameness and one gilt was observed with a swelling in the left neck region. The Study Investigator considered all of these to be non-specific conditions that commonly occur in groups of gilts housed in confinement. The Study Investigator determined that concomitant treatments were not required for any animals during this study.
(218) All gilts and their pigs assigned to Groups 1-3 were disposed of by commercial incineration after euthanasia. Gilts assigned to Group 4 were disposed of by rendering after euthanasia. Group 4 piglets were not euthanized and disposed of, but were assigned to another BIVI project. No food products from animals enrolled in this study entered the human food chain.
(219) Assessment of Efficacy
(220) To assess the MID of PRRS 94881 MLV, low titer group (Group 2) and the high titer group (Group 3) were challenged on D118 and reproductive performance and weaned piglets post-challenge were evaluated. The primary criteria to satisfy this objective were that one or both vaccine groups must demonstrate statistically higher percentage or number of live born piglets and weaned piglets at 20 days of age (DOF+20), compared with the challenge control group (Group 1).
(221) Other parameters analyzed to support efficacy between vaccine groups and the challenge control group included gilt clinical assessments post-vaccination, gilt PRRS serology, gilt viremia, gilt clinical observations post-challenge, piglet viremia at farrowing, total number of piglets per litter, healthy live piglets per litter, weak live piglets per litter, mummies per litter, stillborns per litter, crushed/mortalities piglets per litter, piglet clinical observations, and piglet ADWG.
(222) Criteria for a Valid Test
(223) The negative control group (Group 4) was not included in any analyses. The negative control group was included in the study to demonstrate that source gilts were PRRS negative at the time that the other three groups were challenged. Furthermore, the negative control group had to remain PRRS negative until study completion to exclude a possible introduction of a field PRRSv or accidental cross contamination from challenged groups.
(224) Pre-purchase and D0 serum samples were all required to be negative for PRRS antibodies. Serum samples collected from Groups 1 and 4 up to the day of challenge and from Group 4 until study completion had to be free of PRRS antibodies for the study to be valid.
(225) Primary Outcome Parameters
(226) The primary efficacy variables for statistical evaluation were live piglets per gilt at birth (mean number or percentage) and live piglets per litter at DOF+20 (mean number and percentage).
(227) 9.2.1 Percentage of Live Piglets at Birth Per Gilt
(228) Farrowing data was recorded for each gilt during the study. The day of farrowing (DOF) for each gilt was defined as the day that the first piglet was born. At the time of farrowing, each piglet was classified into one of five categories listed below in Table 6.10. A live piglet at birth was defined as any piglet that received an observation rating at birth as healthy live piglet, weak live piglet or crushed/mortality piglet (death due to crushing was confirmed at necropsy as described below). Observations were conducted by the Study Investigator or a designee and were recorded on the Farrowing/Litter Processing Record form.
(229) TABLE-US-00016 TABLE 6.10 Farrowing Result Categories Term Definition Mummy A mummified fetus that is not completely developed and is exhibiting severe autolysis or a completely developed fetus exhibiting a shiny gun metal green appearance and with no or very little hair Stillborn Piglet A completely developed dead piglet with hair Weak Live Piglet A poor-doing piglet that cannot nurse or walk Healthy Live Piglet A healthy, nursing piglet that is able to walk Crushed/Mortality A fully developed piglet that appears to have died shortly after farrowing due to being crushed by the gilt
(230) Live Piglets Per Litter at DOF+20
(231) Piglets were observed for clinical signs of disease as outlined below in Table 6.11 from DOF+1 to DOF+20. Observations were conducted by the Study Investigator or designees and were recorded on the Clinical Observations Record form.
(232) TABLE-US-00017 TABLE 6.11 Clinical Observation Scoring System Respiration Behavior Cough 0 = normal respiration 0 = normal 0 = none 1 = panting/rapid 1 = mild to moderate 1 = soft or intermittent respiration lethargy cough 2 = dyspnea 2 = severely lethargic 2 = harsh or severe, 3 = dead or recumbent repetitive cough 3 = dead 3 = dead
(233) A daily total clinical observation score was determined as a summation of respiration, behavior and cough scores by the statistician using SAS program. Any piglet receiving a clinical score of zero to eight on DOF+20 was evaluated as alive on DOF+20.
(234) Supportive Parameters
(235) Other parameters analyzed between vaccine groups and the challenge control group included gilt clinical assessments post-vaccination, gilt PRRS serology, gilt viremia, gilt clinical observations, piglet viremia, total piglets per litter, healthy live piglets per litter, weak live piglets per litter, mummies per litter, stillborns per litter, crushed/mortalities piglets per litter, piglet clinical observations, and piglet average daily weight gain (ADWG).
(236) Gilt Daily Assessments
(237) All gilts were observed once daily from D1 to D21 and from D22 to 115 at least three times a week for daily assessments post-vaccination by the Study Investigator or designees. Observations were recorded on the Daily Assessment Record form.
(238) Gilt PRRS Serology
(239) Venous whole blood was collected from gilts prior to purchase and on D0, D7, D14, D21, D56, D84, D118, D125, D132, DOF 0, DOF+7, DOF+13 and DOF+20. Blood collections from gilts at the time of farrowing/abortions (DOF 0) were conducted immediately after farrowing/abortions were completed or up to 8 hours post-farrowing/abortion.
(240) Briefly, approximately 10 mL of blood was collected from each gilt into an appropriate sized Serum Separator Tube(s) (SST). Sample collections were recorded on the Sample Collection Record form. Blood in SSTs was allowed to clot at room temperature. Blood samples collected on weekdays were delivered to BIVI-Ames on the day of collection. Blood samples collected on weekends were processed by VRI personnel on the day of collection. Serum samples at VRI were held at 2-8 C. At either BIVI-Ames or VRI, blood samples were spun down and serum was harvested, split and transferred to appropriate tubes. Each tube was labeled with the gilt's ID number, the study number, the date of collection, the study day and the sample type. Serum samples at VRI were delivered to BIVI-Ames at the earliest convenient time. A completed Specimen Delivery Record form was included with each shipment. At BIVI-Ames, one set of serum samples were held at 2-8 C. and the other set of serum samples were held at 7010 C.
(241) The set of gilt serum samples held at 2-8 C. were tested by BIVI-Ames for PRRS antibodies. Results were reported as negative (ELISA S/P ratio of <0.4) or positive (ELISA S/P ratio of 0.4).
(242) Gilt Clinical Observations Post-Challenge
(243) Gilts were observed for clinical signs of disease from D116 to DOF+20. Observations were conducted by the Study Investigator or designees. Gilts were observed each day for respiration, behavior and cough based on the clinical observation scoring system outlined above in Table 6.11.
(244) 9 Piglet PRRS Viremia
(245) Venous whole blood was collected from piglets on DOF 0, DOF+7, DOF+13 and DOF+20, or when a piglet was found dead. Pre-colostral blood collection was preferred from newborn piglets, but was not mandatory. If pre-colostral blood could not be collected, peri-natal blood within 12 hours of farrowing was permissible. Samples not collected before first suckling were labeled as Peri-natal and kept separately from pre-colostral samples.
(246) Briefly, approximately 2.0 to 2.5 mL of blood was collected from each live piglet into an appropriate sized Serum Separator Tube(s) (SST). A minimum of 5.0 mL of blood was collected from each piglet on DOF+20 just prior to euthanasia. Blood was collected from each mummy or stillbirth or if blood could not be collected from a dead fetus, thoracic or abdominal fluid was collected. Sample collections were recorded on the Sample Collection Record form.
(247) Piglet Average Daily Weight Gain
(248) Individual piglets were weighed on DOF 0 and DOF+20, or on the day a piglet was found dead by the Study Investigator or designees. Individual body weights on DOF 0 were recorded on the Farrowing/Litter Processing Record form and body weights after DOF 0 were recorded on the Body Weight Record form.
(249) PRRS Virus Quantitation in Lung Tissue
(250) All piglets dead at delivery or dying before DOF+20 were necropsied by the Study Investigator. Necropsy results and a diagnosis were recorded on the Necropsy Report form. Two lung samples were collected from each necropsied piglet. One sample was placed into a separate WHIRLPAK container and another sample was placed into an appropriate container filled with a sufficient volume of 10% formalin. Sample collections were recorded on the Necropsy Report form.
(251) WHIRLPAKS and formalin containers were appropriately labeled with animal number, study number, date of sampling, study day, sample type and whether the samples were from the left side, right side or both. Samples in WHIRLPAKS were stored at 7010 C. and samples in 10% formalin were stored at room temperature until delivered to BIVI-Ames. A completed Specimen Delivery Record form was included with each delivery of samples. At BIVI-Ames, samples in WHIRLPAKS were stored at 7010 C. until shipped from BIVI-Ames to Germany, and formalin fixed samples were stored at BIVI-Ames at room temperature.
(252) After the study was completed, frozen tissue samples in WHIRLPAKS were shipped and tested as described above.
(253) Formalin fixed tissue samples were submitted to ISU VDL within one week of collection for embedding in paraffin blocks). Tissues in paraffin blocks were returned to BIVI and are currently held by BIVI-Ames at room temperature for possible future testing. A decision of whether to retain these samples or discard them will be made by the Study Sponsor and Monitor after the study report is completed.
(254) Adverse Events
(255) No adverse events attributed to the IVPs were reported during this study. For more information on adverse events, see Section 12.6, Gilt Assessments Post-Vaccination.
(256) Statistical Methods
(257) Experimental Unit
(258) Treatment groups had to be housed in separate rooms in this study to avoid transmission of live PRRSv vaccine to non-vaccinated groups. Therefore, room was the experimental unit. However, for the purposes of this analysis, possible bias due to confounding room and treatment effects were ignored, and gilt and her corresponding litter were analyzed as the experimental unit.
(259) Randomization
(260) Ninety-four (94) PRRS seronegative gilts from a pool of 107 test-eligible gilts were randomly assigned to one of 4 groups prior to D0. Groups 1-3 each consisted of 28 gilts. Group 4 consisted of 10 gilts. For Group 1, Nos. 45 and 55 were excluded by the farm manager prior to shipment due to health reasons and were replaced by two extra gilts, Nos. 15 and 18, respectively. For Group 3, gilt No. 44 was excluded by the farm manager prior to shipment due to health reasons and was replaced by extra gilt No. 25.
(261) Due to space limitations at the time of challenge, Groups 1-3 were restricted to 16 gilts per group and Group 5 was restricted to 5-8 gilts. On D85, 16 gilts per group were randomly selected to remain in the study for Groups 1-3. Since Group 4 consisted of 8 gilts on D85, this group was not further reduced by randomization. Afterwards, the Study Investigator requested that Group 4 be reduced from 8 gilts to 5 gilts. On D109, 5 gilts were randomly selected to remain in the study for Group 4.
(262) All randomizations procedures were conducted by a biostatistician.
(263) Analysis
(264) The statistical analyses and data summaries were conducted by Dr. rer. hort. Martin Vanselow, Biometrie & Statistik, Zum Siemenshop 21, 30539 Hannover, Germany, +49(0) 511 606 777 650, m.vanselow@t-online.de.
(265) The main objective of the statistical analysis was the comparison of two PRRS 94881 MLV vaccine groups (Groups 2 and 3) to an unvaccinated challenged control group (Group 1). All data were imported into SAS for management and evaluation. The data were received from the study sponsor in the form of verified SAS data sets. Cases which had been withdrawn from the study were considered for the respective parameter of analysis until date of exclusion. All data were summarized descriptively (m, minimum, maximum, mean, median, standard deviation, interquartile range, or frequency distributions, confidence interval) based on the type of the variable. The statistical analyses were performed using SAS software release 8.2 (SAS, 2001, Cary, N.C., USA: SAS Institute Inc.).
(266) Variables for the Statistical Evaluation of the Study:
(267) Primary Variables
(268) Proportions of live piglets at farrowing/abortion (DOF+0)
(269) Proportions of live piglets at 20 days of age (DOF+20)
(270) Supportive Variables
(271) Gilt clinical assessments post-vaccination
(272) Gilt PRRS serology
(273) Gilt viremia
(274) Gilt clinical observations
(275) Piglet viremia
(276) Reproductive performance
(277) Piglet clinical observations
(278) Piglet average daily weight gain (ADWG)
(279) Hypothesis to be Tested and Assumptions Made:
(280) The unchallenged negative control group (Group 4) was excluded from statistical tests. The low titer and high titer groups (Groups 2 and 3, respectively) were compared to the challenge control group (Group 1). All tests between groups were designed as two-sided tests on differences. In the case of all tests, differences were considered as statistically significant only if P0.05. Efficacy was demonstrated if the percentage or number of live born piglets and the percentage or number of weaned piglets at DOF+20 were significantly higher for one or both vaccine groups compared with the challenged control group.
(281) Details on Data Manipulations and Evaluation:
(282) Clinical Assessments of Gilts Post-Vaccination
(283) Frequency tables of animals with at least one positive finding between study days 1 and 21 and between study days 1 and 113 were generated. Differences between the challenge control and vaccine groups were tested by Fisher's exact test.
(284) Clinical Observations of Gilts Post-Challenge
(285) Frequency tables of animals with at least one positive finding between study day 116 and DOF+20 were generated. Differences between the challenge control group and vaccine groups were tested by Fisher's exact test.
(286) Serology of Gilts
(287) Frequency tables of positive ELISA results on study days 7, 14, 21, 56, 84, 118, 125, 132 (pre-farrowing) and DOF+0, DOF+7, DOF+13 and DOF+20 were generated. Differences between the challenge control and vaccine groups were tested by Fisher's exact test.
(288) Viremia of Gilts
(289) Viremia data were evaluated for each day of investigation separately (pre-farrowing study days 7, 14, 21, 56, 84, 118, 125, 132 and DOF+0, DOF+7, DOF+13 and DOF+20). For the qualitative evaluation of the qPCR data the analytical results not detected (n.d.) and negative were classified as negative and the analytical results positive and a measured value were classified as positive. For the quantitative evaluation not detected (n.d.) and negative were replaced by a log.sub.10 GE/mL value of 0.0 and positive was replaced by 3.0. The quantitative PCR data (PRRS viral load [log.sub.10 GE/mL]) were used for comparisons between challenge control (group 1) and treatment groups 2 and 3 using the Wilcoxon Mann-Whitney test. Frequency tables of positive qPCR results were generated. Differences between the challenge control group and vaccine groups were tested by Fisher's exact test.
(290) Reproductive Performance
(291) Absolute frequencies per gilt of total number, alive, healthy, weak, stillborn, dead and alive piglets at DOF+20 were determined and used as single values for the comparisons between groups. Relative frequencies per gilt of alive, healthy, weak, stillborn and dead piglets were calculated in relation to the total number of piglets at farrowing and used as single values for the comparisons between groups. The percentage of live piglets per litter at DOF+20 was calculated in relation to the number of live piglets at farrowing minus number of mortalities and crushed piglets. Differences between the challenge control group and vaccine groups were tested by the Wilcoxon Mann-Whitney test.
(292) Viremia of Piglets
(293) Viremia data were evaluated for each day of investigation separately (DOF+0, DOF+7, DOF+13 and DOF+20). For the qualitative evaluation of the qPCR data the analytical results not detected (n.d.) and negative were classified as negative and the analytical results positive and a measured value were classified as positive. The percentages of positive piglets per litter were calculated and used as single values for the comparisons between groups by the Wilcoxon Mann-Whitney test. For the quantitative evaluation not detected (n.d.) and negative were replaced by a log.sub.10 GE/mL value of 0.0 and positive was replaced by 3.0. The median qPCR values per litter were calculated and used as single values for the comparisons between groups by the Wilcoxon Mann-Whitney test. For the summary statistics the individual qPCR data were used. The viral loads in lung samples were evaluated descriptively only.
(294) Body Weight and Average Daily Weight Gain of Piglets
(295) Individual average daily weight gains (ADWG) were calculated for the time periods between DOF+0 and DOF+20. Differences between treatment groups were tested by analysis of variance (ANOVA) and subsequent t-tests. Least squares means of the groups and differences between least squares means with 95% confidence intervals were derived from the ANOVA. The analysis for DOF+20 and ADWG was repeated with weight at DOF+0 as a covariate. The weight data of piglets per gilt were summarized descriptively.
(296) Clinical Observations of Piglets
(297) The percentage of piglets per litter with at least one positive finding between study days DOF+1 and DOF+20 were calculated and used as single values for the comparisons between groups by the Wilcoxon Mann-Whitney test. Data were analyzed assuming a completely random design structure.
(298) Results
(299) Gilt Reproductive Performance
(300) Mean percentages of live piglets per litter at farrowing (healthy+weak+crushed/mortality) were 54.4%, 75.1%, 72.3%, and 93.0% for the challenge control, low titer, high titer, and negative control groups, respectively. The low titer and high titer groups had significantly higher percentage of live piglets per litter at farrowing compared to the challenge control group (P0.0455). Mean number of live piglets per litter at farrowing were 6.5, 8.3, 8.6 and 10.8 for the challenge control, low titer, high titer, and negative control groups, respectively. No significant differences were detected between groups for the number of live piglets per litter at farrowing (P0.1039).
(301) Mean percentages of healthy live piglets per litter were 41.4%, 65.8%, 67.9%, and 93.0% for the challenge control, low titer, high titer, and negative control groups, respectively. The low titer and high titer groups had significantly higher percentages of healthy live piglets per litter at farrowing compared to the challenge control group (P0.0138). Mean number of healthy live piglets per litter at farrowing were 4.9, 7.2, 8.1 and 10.8 for the challenge control, low titer, high titer, and negative control groups, respectively. The high titer group had a significantly higher number of healthy live piglets per litter at farrowing (P=0.0211), while no difference was detected for the low titer group in comparison with the challenge control group (P=0.0640).
(302) Mean percentages of weak live piglets per litter at farrowing were 7.4%, 7.1%, 0.4%, and 0.0% for the challenge control, low titer, high titer, and negative control groups, respectively. Mean number of weak live piglets per litter at farrowing were 0.9, 0.8, 0.1 and 0.0 for the challenge control, low titer, high titer, and negative control groups, respectively. The high titer group had significantly lower percentage and number of weak live piglets per litter at farrowing compared to the challenge control group (P0.0090). Conversely, no differences were detected between the low titer group and the challenge control group for percentage or number of weak live piglets at farrowing (P0.8569).
(303) Mean percentages of mummies per litter at farrowing were 28.1%, 14.1%, 8.7%, and 0.0% for the challenge control, low titer, high titer, and negative control groups, respectively. Mean number of mummies per litter at farrowing were 3.1, 1.6, 0.9, and 0.0 for the challenge control, low titer, high titer, and negative control groups, respectively. Both the low titer and high titer groups had significantly lower percentages and numbers of mummies per litter at farrowing compared with the challenge control group (P0.0190).
(304) No significant differences were detected between the two vaccine titer groups and the challenge control group for percentage or number of stillborn or mortalities/crushed piglets per litter at farrowing (P0.1681).
(305) A summary of group reproductive performance results (% piglets per litter and number of piglets per litter) on the DOF is shown below in Tables 6.12 and 6.13.
(306) TABLE-US-00018 TABLE 6.12 Summary of Group Reproductive Performance Results (% piglets per litter) on the DOF Piglets Group * N Min. Max. Median Mean 95% CI SD P Alive 1 16 0 92 57.3 54.4 41.1 67.7 24.91 2 16 33 100 81.9 75.1 64.5 85.7 19.88 0.0184 3 16 17 100 75.6 72.3 59.5 85.1 24.01 0.0455 4 5 83 100 91.7 93.0 84.2 101.8 7.11 Healthy 1 16 0 92 48.1 41.4 27.5 55.3 26.13 2 16 8 92 71.4 65.8 52.2 79.5 25.57 0.0138 3 16 17 100 71.8 67.9 54.4 81.3 25.25 0.0082 4 5 83 100 91.7 93.0 84.2 101.8 7.11 Weak 1 16 0 25 3.6 7.4 2.6 12.2 9.04 2 16 0 25 0.0 7.1 2.1 12.2 9.43 0.9441 3 16 0 7 0.0 0.4 0.5 1.3 1.67 0.0024 4 5 0 0 0.0 0.0 0.0 0.0 0.00 Stillborn 1 16 0 50 9.5 17.5 8.5 26.4 16.83 2 16 0 42 3.8 10.7 3.3 18.2 13.94 0.1965 3 16 0 83 10.6 19.0 7.0 31.0 22.54 0.9033 4 5 0 17 8.3 7.0 1.8 15.8 7.11 Mummies 1 16 0 63 25.8 28.1 18.8 37.4 17.50 2 16 0 55 9.1 14.1 6.0 22.3 15.25 0.0190 3 16 0 50 3.3 8.7 1.2 16.3 14.14 0.0006 4 5 0 0 0.0 0.0 0.0 0.0 0.00 Mortalities/ 1 16 0 27 0.0 5.6 1.1 10.2 8.55 Crushed 2 16 0 18 0.0 2.1 0.6 4.8 5.07 0.2276 3 16 0 25 0.0 4.0 0.1 7.8 7.25 0.6108 4 5 0 0 0.0 0.0 0.0 0.0 0.00 Alive on 1 15 0 100 33.3 43.6 23.0 64.3 37.28 DOF + 20 2 16 13 100 84.5 73.8 58.5 89.2 28.80 0.0203 3 16 44 100 86.6 83.8 75.1 92.5 16.37 0.0022 4 5 100 100 100.0 100.0 100.0 100.0 0.00 * Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(307) TABLE-US-00019 TABLE 6.13 Summary of Group Reproductive Performance Results (No. of piglets per litter) on the DOF Piglets Group * N Min. Max. Median Mean 95% CI SD P Total 1 16 6 15 12.0 11.6 10.4 12.9 2.31 2 16 9 13 11.0 11.1 10.4 11.7 1.24 0.1857 3 16 7 15 12.0 11.6 10.3 12.9 2.42 0.9623 4 5 10 14 12.0 11.6 9.5 13.7 1.67 Alive 1 16 0 11 6.0 6.5 4.7 8.3 3.35 2 16 4 12 8.0 8.3 7.0 9.5 2.27 0.1543 3 16 2 13 9.0 8.6 6.6 10.6 3.77 0.1039 4 5 9 14 10.0 10.8 8.4 13.2 1.92 Healthy 1 16 0 11 5.5 4.9 3.1 6.7 3.36 2 16 1 12 7.0 7.2 5.7 8.7 2.83 0.0640 3 16 2 13 8.5 8.1 6.1 10.1 3.76 0.0211 4 5 9 14 10.0 10.8 8.4 13.2 1.92 Weak 1 16 0 3 0.5 0.9 0.3 1.5 1.09 2 16 0 3 0.0 0.8 0.2 1.4 1.11 0.8569 3 16 0 1 0.0 0.1 0.1 0.2 0.25 0.0090 4 5 0 0 0.0 0.0 0.0 0.0 0.00 Stillborn 1 16 0 6 1.0 2.0 0.9 3.1 2.03 2 16 0 5 0.5 1.3 0.4 2.1 1.65 0.1681 3 16 0 10 1.0 2.1 0.8 3.5 2.58 0.9478 4 5 0 2 1.0 0.8 0.2 1.8 0.84 Mummies 1 16 0 7 3.0 3.1 2.1 4.1 1.89 2 16 0 6 1.0 1.6 0.7 2.5 1.67 0.0125 3 16 0 4 0.5 0.9 0.2 1.5 1.20 0.0003 4 5 0 0 0.0 0.0 0.0 0.0 0.00 Mortalities/ 1 16 0 3 0.0 0.7 0.1 1.2 1.01 Crushed 2 16 0 2 0.0 0.3 0.1 0.6 0.58 0.2200 3 16 0 2 0.0 0.4 0.0 0.8 0.73 0.6115 4 5 0 0 0.0 0.0 0.0 0.0 0.00 Alive on 1 16 0 10 2.0 2.9 1.2 4.7 3.21 DOF + 20 2 16 1 10 6.5 6.2 4.5 7.9 3.19 0.0063 3 16 2 12 7.5 6.9 5.0 8.9 3.71 0.0026 4 5 9 14 10.0 10.8 8.4 13.2 1.92 * Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(308) Live Piglets at DOF+20
(309) These scores highlight the number of live piglets at weaning (20 days of age). A summary of group percentage and number of live piglets per litter on DOF+20 is shown above in Tables 6.12 and 6.13.
(310) Mean percentages of live piglets per litter at weaning (DOF+20) were 43.6%, 73.8%, 83.8%, and 100.0% for the challenge control, low titer, high titer, and negative control groups, respectively. Mean number of live piglets per litter at weaning were 2.9, 6.2, 6.9 and 10.8 for the challenge control, low titer, high titer, and negative control groups, respectively. Both the low titer and high titer groups had significantly higher percentages and numbers of alive piglets per litter at weaning (DOF+20) compared with the challenge control group (P0.0203).
(311) Gilt qPCR Viremia
(312) All gilts were qPCR negative for PRRSv RNA on D0. All challenge control and negative control gilts remained qPCR negative for PRRSv RNA up to and including the day of challenge (D118). The negative control group remained qPCR negative for the remainder of the study, with exception of gilt No. 108, which was positive on DOF+7. Gilt No. 108 was negative at other time points for PRRSv RNA by qPCR testing.
(313) Post-vaccination, 50% and 36% of low titer and high titer gilts, respectively, were qPCR positive for PRRSv RNA (P0.0007) on D7. From D14 to D56, only 4% of low titer gilts remained qPCR positive while up to 4% of high titer gilts were qPCR positive intermittently during this observation period. No differences were detected between vaccine groups and the challenge control group from D14 to D56 for the percentage of gilts qPCR positive for PRRSv RNA (P=1.0000 or no test conducted). All vaccinated gilts were qPCR negative for PRRSv RNA on D84 and D118 (day of challenge).
(314) Post-challenge, the low titer and higher groups had statistically lower percentages of gilts qPCR positive for PRRSv RNA compared with the challenge control group on Days 125, DOF 0, and DOF+13 (P0.0155). On D132, the low titer group had a significantly lower percentage of gilts qPCR positive for PRRSv RNA (P=0.0290); while no statistical difference was detected between the high titer group and the challenge control group (P=0.1556). No significant differences were detected between vaccine groups and the challenge control group on DOF+7 and DOF+20 for the percentage of gilts qPCR positive for PRRSv RNA (P0.1719).
(315) A summary of group percentage of gilts qPCR positive for PRRSv RNA from D7 to DOF+20 is shown below in Tables 6.14 and 6.15.
(316) TABLE-US-00020 TABLE 6.14 Summary of Group Percentage of Gilts qPCR Positive for PRRSv RNA from D 7 to D 132 Study Day Group* N % 95% CI Total P 7 1 0 0 0.0 12.3 28 2 14 50 30.6 69.4 28 <0.0001 3 10 36 18.6 55.9 28 0.0007 4 0 0 0.0 30.8 10 14 1 0 0 0.0 12.3 28 2 1 4 0.1 18.3 28 1.0000 3 0 0 0.0 12.3 28 n.a. 4 0 0 0.0 30.8 10 21 1 0 0 0.0 12.3 28 2 1 4 0.1 18.3 28 1.0000 3 1 4 0.1 18.3 28 1.0000 4 0 0 0.0 30.8 10 56 1 0 0 0.0 14.8 23 2 1 4 0.1 19.6 26 1.0000 3 1 4 0.1 20.4 25 1.0000 4 0 0 0.0 33.6 9 84 1 0 0 0.0 14.8 23 2 0 0 0.0 13.2 26 n.a. 3 0 0 0.0 13.7 25 n.a. 4 0 0 0.0 33.6 9 1 0 0 0.0 20.6 16 118 (Day of 2 0 0 0.0 20.6 16 n.a. challenge) 3 0 0 0.0 20.6 16 n.a. 4 0 0 0.0 52.2 5 125 1 16 100 79.4 100.0 16 2 5 31 11.0 58.7 16 0.0001 3 4 25 7.3 52.4 16 <0.0001 4 0 0 0.0 52.2 5 132 1 10 63 35.4 84.8 16 2 3 19 4.0 45.6 16 0.0290 3 5 31 11.0 58.7 16 0.1556 4 0 0 0.0 52.2 5 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS94881 MLV group; Group 4 = Negative control group; n.a. = not applicable, no test conducted
(317) TABLE-US-00021 TABLE 6.15 Summary of Group Percentage of Gilts qPCR Positive for PRRSv RNA from DOF 0 to DOF + 20 Study Day Group* N % 95% CI Total P DOF + 0 1 15 94 69.8 99.8 16 2 4 25 7.3 52.4 16 0.0002 3 1 6 0.2 30.2 16 <0.0001 4 0 0 0.0 52.2 5 DOF + 7 1 5 31 11.0 58.7 16 2 2 13 1.6 38.3 16 0.3944 3 1 6 0.2 30.2 16 0.1719 4 1 20 0.5 71.6 5 DOF + 13 1 7 47 21.3 73.4 15 2 0 0 0.0 20.6 16 0.0024 3 1 6 0.2 30.2 16 0.0155 4 0 0 0.0 52.2 5 DOF + 20 1 3 19 4.0 45.6 16 2 3 19 4.0 45.6 16 1.0000 3 0 0 0.0 20.6 16 0.2258 4 0 0 0.0 52.2 5 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(318) Both vaccine groups had significantly higher median viral loads compared with the challenge control group on D7 (P0.0007). No differences were detected between vaccine groups and the challenge control group from D14 to D56 for viral load (P=1.0000). All vaccinated gilts had zero viral load on D84 and D118 (day of challenge).
(319) Post-challenge, the low titer and higher groups had statistically lower median viral loads compared with the challenge control group on D125, DOF 0, and DOF+13 (P0.0155). On D132, the low titer group had a significantly lower median viral load (P=0.0230); while no statistical difference was detected between the high titer group and the challenge control group (0.94 and 1.97 log.sub.10 GE/mL respectively; P=0.1144). No significant differences for viral load were detected between vaccine groups and the challenge control group on DOF+7 and DOF+20 (P0.1719).
(320) A summary of group mean gilt qPCR GE/mL results from D7 to DOF+20 is shown below in Tables 6.16 and 6.17.
(321) TABLE-US-00022 TABLE 6.16 Summary of Group Gilt qPCR Results (log.sub.10 GE/mL) From D 7 to D 132 Study Day Group * N Min. Max. Median 95% CI QRange Mean P 7 1 28 0.00 0.00 0.000 0.000 0.000 0.000 0.000 2 28 0.00 3.00 1.500 0.000 3.000 3.000 1.500 <0.0001 3 28 0.00 3.00 0.000 0.000 3.000 3.000 1.071 0.0007 4 10 0.00 0.00 0.000 0.000 0.000 0.000 0.000 14 1 28 0.00 0.00 0.000 0.000 0.000 0.000 0.000 2 28 0.00 3.00 0.000 0.000 0.000 0.000 0.107 1.0000 3 28 0.00 0.00 0.000 0.000 0.000 0.000 0.000 1.0000 4 10 0.00 0.00 0.000 0.000 0.000 0.000 0.000 21 1 28 0.00 0.00 0.000 0.000 0.000 0.000 0.000 2 28 0.00 3.00 0.000 0.000 0.000 0.000 0.107 1.0000 3 28 0.00 3.00 0.000 0.000 0.000 0.000 0.107 1.0000 4 10 0.00 0.00 0.000 0.000 0.000 0.000 0.000 56 1 23 0.00 0.00 0.000 0.000 0.000 0.000 0.000 2 26 0.00 3.00 0.000 0.000 0.000 0.000 0.115 1.0000 3 25 0.00 3.00 0.000 0.000 0.000 0.000 0.120 1.0000 4 9 0.00 0.00 0.000 0.000 0.000 0.000 0.000 84 1 23 0.00 0.00 0.000 0.000 0.000 0.000 0.000 2 26 0.00 0.00 0.000 0.000 0.000 0.000 0.000 1.0000 3 25 0.00 0.00 0.000 0.000 0.000 0.000 0.000 1.0000 4 9 0.00 0.00 0.000 0.000 0.000 0.000 0.000 118 (Day 1 16 0.00 0.00 0.000 0.000 0.000 0.000 0.000 of 2 16 0.00 0.00 0.000 0.000 0.000 0.000 0.000 1.0000 challenge) 3 16 0.00 0.00 0.000 0.000 0.000 0.000 0.000 1.0000 4 5 0.00 0.00 0.000 0.000 0.000 0.000 0.000 125 1 16 3.00 5.38 4.495 4.130 4.880 0.765 4.419 2 16 0.00 6.46 0.000 0.000 3.000 3.000 1.293 0.0001 3 16 0.00 3.00 0.000 0.000 3.000 1.500 0.750 <0.0001 4 5 0.00 0.00 0.000 0.000 0.000 0.000 0.000 132 1 16 0.00 4.47 3.000 0.000 3.000 3.000 1.967 2 16 0.00 3.00 0.000 0.000 0.000 0.000 0.563 0.0230 3 16 0.00 3.00 0.000 0.000 3.000 3.000 0.938 0.1144 4 5 0.00 0.00 0.000 0.000 0.000 0.000 0.000 * Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(322) TABLE-US-00023 TABLE 6.17 Summary of Group Gilt qPCR Results (log.sub.10 GE/mL) From DOF 0 to DOF + 20 Study Day Group * N Min. Max. Median 95% CI QRange Mean P DOF + 0 1 16 0.00 3.00 3.000 3.000 3.000 0.000 2.813 2 16 0.00 3.00 0.000 0.000 3.000 1.500 0.750 0.0002 3 16 0.00 3.00 0.000 0.000 0.000 0.000 0.188 <0.0001 4 5 0.00 0.00 0.000 0.000 0.000 0.000 0.000 DOF + 7 1 16 0.00 3.00 0.000 0.000 3.000 3.000 0.938 2 16 0.00 5.55 0.000 0.000 0.000 0.000 0.534 0.3944 3 16 0.00 3.00 0.000 0.000 0.000 0.000 0.188 0.1719 4 5 0.00 3.00 0.000 0.000 3.000 0.000 0.600 DOF + 13 1 15 0.00 3.00 0.000 0.000 3.000 3.000 1.400 2 16 0.00 0.00 0.000 0.000 0.000 0.000 0.000 0.0024 3 16 0.00 3.00 0.000 0.000 0.000 0.000 0.188 0.0155 4 5 0.00 0.00 0.000 0.000 0.000 0.000 0.000 DOF + 20 1 16 0.00 3.00 0.000 0.000 0.000 0.000 0.563 2 16 0.00 6.45 0.000 0.000 0.000 0.000 0.903 0.7924 3 16 0.00 0.00 0.000 0.000 0.000 0.000 0.000 0.2258 4 5 0.00 0.00 0.000 0.000 0.000 0.000 0.000 * Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(323) Gilt Clinical Observations Scores Post-Challenge
(324) From D116 to DOF+20, 25%, 25%, 38% and 60% of challenge control, low titer, high titer and negative control gilts, respectively, exhibited clinical disease for at least one day from D116 to DOF+20. No significant differences were detected between vaccine groups and the challenge control group for the frequency of gilts positive for clinical disease from D116 to DOF+20 (P0.7043).
(325) A summary of group percentage of gilts positive for clinical disease (a clinical observation score of >0) for at least one day from D116 to DOF+20 is shown below in Table 6.18.
(326) TABLE-US-00024 TABLE 6.18 Summary of group percentage of gilts positive for clinical disease (a clinical observation score of > 0) for at least one day from D 116 to DOF + 20 Study Days Group* N % 95% CI Total P 116- 1 4 25 7.3 52.4 16 DOF + 20 2 4 25 7.3 52.4 16 1.0000 3 6 38 15.2 64.6 16 0.7043 4 3 60 14.7 94.7 5 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(327) Gilt PRRS ELISA Serology
(328) All gilts were PRRS seronegative on D0 and D7. All challenge control and negative control gilts remained PRRS seronegative up to and including the day of challenge (D118); while the negative control group remained PRRS seronegative for the remainder of the study (DOF+20).
(329) On D14, 18% and 21% of low titer and high titer gilts, respectively, were PRRS seropositive. The high titer group had a significantly higher percentage of PRRS seropositive gilts on D14 (P=0.0232), while no difference was detected for the low titer group in comparison with the challenge control group (p=0.0515). These percentages reached group highs of 65% and 60% for the low titer and high titer groups, respectively on D56 (P<0.0001). On the day of the challenge (D118), 56% and 50% of low titer and high titer gilts were PRRS seropositive (P0.0024). On D125, 6%, 88%, and 100% of challenge control, low titer and high titer gilts, respectively, were PRRS seropositive; and the difference between the vaccine groups and the challenge control group were significant (P<0.0001). After D125, all remaining challenge control, low titer and high titer gilts were PRRS seropositive for the remainder of the study (no test conducted).
(330) A summary of group PRRS ELISA serology results from D14 to DOF+20 is shown below in Tables 6.19 and 6.20.
(331) TABLE-US-00025 TABLE 6.19 Summary of Group Gilt PRRS ELISA Serology Results from D 14 to Day 132 Study Day Group* N % 95% CI Total P 7 1 0 0 0.0 12.3 28 2 0 0 0.0 12.3 28 n.a. 3 0 0 0.0 12.3 28 n.a. 4 0 0 0.0 30.8 10 14 1 0 0 0.0 12.3 28 2 5 18 6.1 36.9 28 0.0515 3 6 21 8.3 41.0 28 0.0232 4 0 0 0.0 30.8 10 21 1 0 0 0.0 12.3 28 2 13 46 27.5 66.1 28 <0.0001 3 11 39 21.5 59.4 28 0.0003 4 0 0 0.0 30.8 10 56 1 0 0 0.0 14.8 23 2 17 65 44.3 82.8 26 <0.0001 3 15 60 38.7 78.9 25 <0.0001 4 0 0 0.0 33.6 9 84 1 0 0 0.0 14.8 23 2 15 58 36.9 76.6 26 <0.0001 3 14 56 34.9 75.6 25 <0.0001 4 0 0 0.0 33.6 9 118 1 0 0 0.0 20.6 16 2 9 56 29.9 80.2 16 0.0008 3 8 50 24.7 75.3 16 0.0024 4 0 0 0.0 52.2 5 125 1 1 6 0.2 30.2 16 2 14 88 61.7 98.4 16 <0.0001 3 16 100 79.4 100.0 16 <0.0001 4 0 0 0.0 52.2 5 132 1 16 100 79.4 100.0 16 2 16 100 79.4 100.0 16 n.a. 3 16 100 79.4 100.0 16 n.a. 4 0 0 0.0 52.2 5 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group, n.a. = not applicable, no test conducted
(332) TABLE-US-00026 TABLE 6.20 Summary of Group Gilt PRRS ELISA Serology Results from DOF 0 to DOF + 20 Study Day Group* N % 95% CI Total P DOF + 0 1 16 100 79.4 100.0 16 2 16 100 79.4 100.0 16 n.a. 3 16 100 79.4 100.0 16 n.a. 4 0 0 0.0 52.2 5 DOF + 7 1 15 100 78.2 100.0 15 2 16 100 79.4 100.0 16 n.a. 3 16 100 79.4 100.0 16 n.a. 4 0 0 0.0 52.2 5 DOF + 13 1 16 100 79.4 100.0 16 2 16 100 79.4 100.0 16 n.a. 3 16 100 79.4 100.0 16 n.a. 4 0 0 0.0 52.2 5 DOF + 20 1 16 100 79.4 100.0 16 2 16 100 79.4 100.0 16 n.a. 3 15 100 78.2 100.0 15 n.a. 4 0 0 0.0 52.2 5 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group. **No test conducted on sample from Gilt No. 106. n.a. = not applicable, no test conducted
(333) Gilt Assessments Post-Vaccination
(334) No abnormal assessments from D1 to 21 were detected in any groups and no test was conducted. From D1 to D113, 4%, 4%, 0% and 10% of challenge control, low titer, high titer and negative control gilts, respectively, exhibited an abnormal assessment for at least one day from D1 to D113. No significant differences were detected between vaccine groups and the challenge control group for abnormal assessments from D1 to D113 (P=1.0000).
(335) Individually, No. 109 (challenge control group) exhibited lameness of the right rear leg on D85, No. 12 (low titer group) exhibited a swelling in the left neck region from D78 to D89, and No. 21 (negative control group) exhibited lameness from D81 to D83.
(336) A summary of group percentage of gilts that exhibited an abnormal assessment for at least one day from D1 to D21 and from D1 to D113 is shown below in Table 6.21.
(337) TABLE-US-00027 TABLE 6.21 Summary of Group Abnormal Assessments for At Least One Day from D 1 to D 113 Study Days Group* N % 95% CI Total P 1-21 1-4 no positive findings 1-113 1 1 4 0.1 18.3 28 2 1 4 0.1 18.3 28 1.0000 3 0 0 0.0 12.3 28 1.0000 4 1 10 0.3 44.5 10 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(338) Piglet Clinical Observations Scores
(339) Mean percentages of piglets per litter positive for clinical disease (a clinical observation score of >0) for at least one day from DOF+1 to DOF+20 were 91.6%, 32.5%, 33.4% and 3.2% for the challenge control, low titer, high titer, and negative control groups, respectively. Low and high titer groups had significantly lower percentages of piglets per litter positive for clinical disease for at least one day from DOF+1 to DOF+20 compared with the challenge control group (p0.0001).
(340) A summary of group percentage of piglets per litter that were positive for clinical disease (a clinical observation score of >0) for at least one day from DOF+1 to DOF+20 is shown below in Table 6.22.
(341) TABLE-US-00028 TABLE 6.22 Summary of group percentage of piglets per litter positive for clinical disease (a clinical observation score of > 0) for at least one day from DOF + 1 to DOF + 20 Study Days Group* N Min. Max. Median Mean 95% CI SD P DOF + 1 1 15 56 100 100.0 91.6 82.9 100.4 15.78 to 2 16 0 100 25.0 32.5 15.6 49.4 31.64 <0.0001 DOF + 20 3 16 0 100 25.0 33.4 19.0 47.9 27.16 <0.0001 4 5 0 9 0.0 3.2 2.3 8.8 4.50 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(342) Piglet Serum/Body Fluids qPCR Results
(343) A mean of 86.3%, 58.1%, 55.0% and 0% of piglets per litter for the challenge control, low titer, high titer and negative control groups, respectively, were qPCR positive for PRRSv RNA on DOF 0. The low titer and higher groups had statistically lower percentages of piglets per litter qPCR positive for PRRSv RNA compared with the challenge control group on DOF 0 (P0.0381). On DOF+7, again the low titer and high titer groups had significantly lower percentages of piglets per litter qPCR positive for PRRSv RNA compared with the challenge control group (P0.0293). On DOF+13, only the low titer group had a significantly lower percentage of piglets per litter qPCR positive (P=0.0216); while no significant differences were detected for the high titer group and the challenge control for the percentage of piglets per litter qPCR positive (P=0.0860). No significant differences were detected between groups on DOF+20 (P0.0614).
(344) A summary of group percentage of serum/body fluid qPCR PRRSv positive piglets per gilt is shown below in Table 6.23.
(345) TABLE-US-00029 TABLE 6.23 A Summary of Group Percentage of Serum/Body Fluid qPCR PRRSv Positive Piglets per Gilt Study Day Group* N Min. Max. Median Mean 95% CI SD P DOF + 0 1 16 50 100 96.4 86.3 76.8 95.8 17.87 2 16 0 100 68.3 58.1 37.3 78.9 39.07 0.0381 3 16 0 100 60.0 55.0 37.0 73.0 33.77 0.0018 4 5 0 0 0.0 0.0 0.0 0.0 0.00 DOF + 7 1 12 100 100 100.0 100.0 100.0 100.0 0.00 2 16 10 100 100.0 76.6 57.1 96.0 36.51 0.0293 3 16 0 100 100.0 78.6 60.6 96.6 33.83 0.0175 4 5 0 0 0.0 0.0 0.0 0.0 0.00 DOF + 13 1 11 100 100 100.0 100.0 100.0 100.0 0.00 2 16 0 100 100.0 75.4 55.0 95.8 38.31 0.0216 3 16 0 100 100.0 84.0 68.2 99.9 29.75 0.0860 4 5 0 0 0.0 0.0 0.0 0.0 0.00 DOF + 20 1 11 0 100 100.0 90.9 70.7 111.2 30.15 2 16 0 100 93.8 75.3 55.6 95.0 36.97 0.0614 3 16 0 100 100.0 81.6 65.0 98.1 31.06 0.1832 4 5 0 0 0.0 0.0 0.0 0.0 0.00 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(346) The high titer group had a significantly lower median qPCR result compared with the challenge control group on DOF 0 (P=0.0030); while no difference was detected between the low titer group and the challenge control group (P=0.0620). On DOF+7, DOF+13 and DOF+20, both vaccine groups had significantly lower median qPCR values compared with the challenge control group (p0.0122).
(347) A summary of group piglet serum/body fluid qPCR GE/mL results per gilt is shown below in Table 6.24.
(348) TABLE-US-00030 TABLE 6.24 Summary of Group Piglet Serum/Body Fluid qPCR results (log.sub.10 GE/mL) per Gilt (P values for differences between groups based on median qPCR values) Study Day Group * N Min. Max. Median 95% CI QRange Mean P DOF + 0 1 180 0.00 8.69 6.400 6.080 6.790 3.195 5.556 2 176 0.00 8.47 3.000 3.000 4.420 6.945 3.560 0.0620 3 183 0.00 8.76 3.000 0.000 3.000 6.580 3.049 0.0030 4 58 0.00 0.00 0.000 0.000 0.000 0.000 0.000 DOF + 7 1 58 4.47 8.76 6.950 6.610 7.370 1.300 6.914 2 103 0.00 8.12 3.000 3.000 4.930 5.640 3.337 <0.0001 3 115 0.00 6.91 4.280 3.000 4.630 2.120 3.642 <0.0001 4 54 0.00 0.00 0.000 0.000 0.000 0.000 0.000 DOF + 13 1 52 4.19 8.62 6.835 6.430 6.970 0.995 6.549 2 100 0.00 8.22 3.000 3.000 3.000 4.530 2.678 <0.0001 3 113 0.00 6.54 3.000 3.000 3.000 1.580 3.413 <0.0001 4 54 0.00 0.00 0.000 0.000 0.000 0.000 0.000 DOF + 20 1 46 0.00 6.94 5.595 5.270 6.520 1.770 5.554 2 98 0.00 6.59 3.000 3.000 3.000 4.000 2.502 0.0122 3 111 0.00 6.28 3.000 3.000 3.000 1.160 3.218 0.0005 4 54 0.00 0.00 0.000 0.000 0.000 0.000 0.000 * Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(349) Piglet ADWG
(350) No differences were detected between groups for LS Mean body weights on DOF 0 (p0.2972). Both vaccine groups had higher least square mean body weights compared with the challenge control group on DOF+20 (P<0.0028), with or without DOF 0 body weights factored as a covariate in the analyses.
(351) Mean ADWG from DOF 0 to DOF+20 were 0.1 kg/day, 0.2 kg/day, 0.2 kg/day and 0.2 kg/day for the challenge control, low titer, high titer, and negative control groups, respectively. Both vaccine groups had significantly higher ADWG compared with the challenge control group (P<0.0028), with or without DOF 0 body weights factored as a covariate in the analyses.
(352) A summary of group DOF 0 and DOF+20 piglet body weights and DOF 0 to DOF+20 ADWG (kg/day) is shown below in Tables 6.25 and 6.26.
(353) TABLE-US-00031 TABLE 6.25 Summary of Group DOF 0 and DOF + 20 Piglet Body Weights and DOF 0 to DOF + 20 ADWG (kg/day) Study Day(s) Group* N Min. Max. Median Mean 95% CI SD DOF + 0 1 47 0.9 2.0 1.40 1.34 1.274 1.411 0.234 Body 2 99 0.9 2.1 1.40 1.43 1.388 1.479 0.227 Weights 3 111 0.9 2.0 1.40 1.40 1.360 1.448 0.234 4 54 0.9 1.9 1.40 1.39 1.335 1.454 0.218 DOF + 20 1 47 1.5 6.1 3.70 3.80 3.462 4.146 1.164 Body 2 99 2.4 8.3 5.50 5.42 5.168 5.673 1.266 Weights 3 111 2.1 8.2 5.30 5.19 5.000 5.388 1.032 4 54 2.4 6.9 5.20 5.26 5.008 5.511 0.922 ADWG 1 47 0.015 0.235 0.1150 0.1231 0.10649 0.13968 0.05653 (DOF + 0 to 2 99 0.065 0.340 0.2000 0.1993 0.18770 0.21099 0.05837 DOF + 20) 3 111 0.055 0.330 0.1950 0.1895 0.18078 0.19823 0.04638 4 54 0.060 0.260 0.1925 0.1932 0.18305 0.20343 0.03733 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(354) TABLE-US-00032 TABLE 6.26 Summary of Group LS Mean Body Weights and DOF 0 to DOF + 20 ADWG (kg/day)Test Results (P values) on Differences between Groups 95% confidence Study Day(s) Group* LS Mean interval P DOF + 0 1 1.32 1.169 1.477 Body 2 1.42 1.318 1.522 Weights 3 1.41 1.317 1.497 Diff. 1-2 0.10 0.281 0.088 0.2972 Diff. 1-3 0.08 0.262 0.094 0.3467 DOF + 20 1 3.82 3.072 4.567 Body 2 5.32 4.827 5.819 Weights 3 5.35 4.910 5.785 Diff. 1-2 1.50 2.401 0.606 0.0016 Diff. 1-3 1.53 2.394 0.662 0.0010 D0F + 20** 1 4.01 3.341 4.685 Body 2 5.28 4.843 5.727 Weights 3 5.34 4.950 5.728 Diff. 1-2 1.27 2.078 0.466 0.0028 Diff. 1-3 1.33 2.103 0.550 0.0013 ADWG 1 0.125 0.0903 0.1594 (DOF + 0 to 2 0.195 0.1722 0.2181 DOF + 20) 3 0.197 0.1768 0.2172 Diff. 1-2 0.070 0.1118 0.0289 0.0014 Diff. 1-3 0.072 0.1122 0.0322 0.0008 ADWG 1 0.130 0.0969 0.1640 (DOF + 0 to 2 0.194 0.1720 0.2161 DOF + 20**) 3 0.197 0.1773 0.2162 Diff. 1-2 0.064 0.1039 0.0233 0.0028 Diff. 1-3 0.066 0.1052 0.0275 0.0013 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group. **weight at DOF + 0 was used as a covariate
(355) Piglet Necropsy Observations and Diagnoses
(356) Feti listed as stillborns, mummies or crushed at farrowing were confirmed at necropsy as correctly categorized with the exception of 8 feti. Two-challenge control feti were listed as stillborns (40-S1, 66-S1), but necropsy results revealed inflated lungs indicating they were alive at the time of birth. Two-challenge control feti were listed as crushed (1-C1, 79-C2), but necropsy results revealed non-inflated lungs for both feti, indicating they did not breath. One-low titer fetus was listed as a stillborn (85-S2), but necropsy results revealed inflated lungs indicating the piglet was alive at the time of birth. Three-high titer piglets were listed as crushed (36-C1, 36-C2, 65-C1), but necropsy results revealed non-inflated lungs for both feti, indicating they did not breath. Due to the low number of feti incorrectly listed at time of farrowing, no changes were made to gilt performance analyses.
(357) One-challenge control piglet 102-428 died subsequently to blood collection, which was confirmed by necropsy.
(358) Piglet Lung qPCR Results
(359) Of the feti and dead piglets necropsied, the mean lung qPCR results were 4.68, 4.09, 3.55 and 0.0 log.sub.10 GE/mL for the challenge control, low titer, high titer, and negative control groups, respectively. No statistical analyses were conducted on these data.
(360) A summary of group lung PRRSv qPCR results (log.sub.10 GE/mL) is shown below in Table 6.27.
(361) TABLE-US-00033 TABLE 6.27 Summary of Group Piglet Lung PRRSv qPCR Results (log.sub.10 GE/mL) Group N Min. Max. Median 95% CI QRange Mean 1 141 0.00 7.95 5.140 4.810 5.390 2.990 4.676 2 79 0.00 7.45 4.780 3.000 5.260 2.620 4.092 3 75 0.00 6.84 4.220 3.000 5.100 5.620 3.547 4 4 0.00 0.00 0.000 0.000 0.000 0.000 0.000 *Group 1 = Challenge control group; Group 2 = Low titer PRRS 94881 MLV group; Group 3 = High titer PRRS 94881 MLV group; Group 4 = Negative control group
(362) Discussion/Conclusion
(363) To achieve the study objective, four groups of PRRS susceptible gilts were included in the study design on D0: a challenge control group that received control product (Group 1); a low titer vaccine group that received 110.sup.2.43 TCID.sub.50 of PRRS 94881 MLV (IVP No. 1, Group 2); a high titer vaccine group that received 110.sup.3.90 TCID.sub.50 of PRRS 94881 MLV (IVP No. 2, Group 3); and a negative control group (Group 4) that also received control product. Each treatment was administered as a 2.0 mL dose IM at approximately 28 days prior to breeding (D0).
(364) To determine the minimum immunizing dose of PRRS 94881 MLV, the two vaccine titer groups and the challenge control group were challenged on D118 (approximately 90 days of gestation) with a heterologous European isolate of PRRSv (isolate 190136) and evaluated post-challenge for percentage and number of live piglets per litter at birth (day of farrowing, DOF) and percentage and number of live piglets per litter at 21 days of age (DOF+21).
(365) Validation of the Study (Negative Control Group 4)
(366) To ensure that source gilts were free of PRRSv and that no extraneous PRRSv exposure or cross-contamination among treatment and control groups occurred during the study, a negative control group (Group 4) was included in the study design. Negative control gilts were negative for PRRS antibodies throughout the study. In addition, this group of gilts and their progeny were also negative for PRRSv viremia (qPCR) at all tested time points with exception of No. 108 on DOF+7. Gilt No. 108 was positive on DOF+7, while qPCR negative at all other time points and her piglets were negative for PRRSv RNA as well. This result was considered an error due to sample contamination and not due to PRRSv infection. These results support that the negative control group remained free of PRRS infection during the study and validate the results of this trial.
(367) Validation of the PRRSv Reproductive Challenge Model (Challenge Control Group 1)
(368) A challenge model involving a virulent EU-derived strain of PRRSv that induces sufficient and reproducible PRRS clinical disease is necessary to adequately evaluate PRRS vaccine efficacy in a laboratory setting. Following inoculation with European PRRS isolate 190136 (110.sup.6.30 TCID.sub.50/6 mL), the challenge control group exhibited only 54.4% live piglets per litter at birth (93.0% for the negative control group), 17.5% and 28.1% per litter of stillborns and mummies, respectively (7.0% and 0.0%, respectively, for the negative control group), 91.6% piglets per litter exhibited clinical disease for at least one day from DOF+1 to DOF+20 (3.2% piglets per litter for the negative control group), a mean of 2.9 live piglets per litter at 20 days of age (a mean of 10.8 for the negative control group), and 86.3% of piglets per litter viremic at birth (0% for the negative control group). These results highlight that severe PRRS-specific clinical disease was induced in the unvaccinated, challenge control group of gilts and their progeny, thus validating this challenge model as an adequate clinical laboratory tool to evaluate PRRS vaccine efficacy and more specifically, the MID of PRRS 94881 MLV in gilts.
(369) Determination of the minimum immunizing dose of PRRS 94881 MLV in gilts (low and high titer vaccine doses; Groups 2-3)
(370) Determination of the MID of PRRS 94881 MLV in gilts was based upon the vaccine group that received the lowest titer of vaccine that resulted in higher percentages or number of live piglets per litter at birth and higher percentages of number of live piglets per litter at 20 days of age post-challenge compared with the challenge control group.
(371) Live piglets per litter (either percent or number) at farrowing was selected as one of two key criteria for determining the MID of PRRS 94881 MLV. The first key criterion was based upon the fact that PRRSv infection in pregnant gilts and sows typically results in stillborns and mummies, with low numbers of live piglets at farrowing. Live piglets per litter at birth were defined as the summation of healthy live, weak live and crushed-mortality piglets at farrowing. Piglets listed as crushed or mortality were included in the live category because necropsy findings confirmed these piglets were alive at birth and died shortly thereafter due to trauma. Both the low titer and high titer groups exhibited significantly higher percentages of live piglets per litter at farrowing compared with the challenge control (P0.0455), thus this criterion for vaccine efficacy was met. Although no significant differences were detected between the low and high titer vaccine groups and the challenge control group with respect to the mean number of live piglets per litter at farrowing (P0.1857), the low titer and high titer groups did exhibit considerably higher mean number of live piglets per litter at farrowing (mean 8.3 and 8.6 piglets per litter, respectively) in relationship to the challenge control group (mean 6.5 piglets per litter) thus, providing further evidence and support that a beneficial vaccine treatment effect was observed in these animals post-challenge.
(372) Live piglets per litter (either percent or number) at 20 days of age was the second criterion for determining the MID of PRRS 94881 MLV because gilt PRRS immunity will influence in utero infection of piglets and shedding of virus from gilts to live piglets. Piglets infected with PRRS in utero and born alive or infected with virulent PRRS post-farrowing via shedding from the gilt usually die before weaning secondary to PRRS. In this study, the challenge control, low titer, high titer and negative control group exhibited 43.6%, 73.8%, 83.8% and 100% live piglets per litter, respectively, at 20 days of age (P0.0203). Likewise, the challenge control, low titer, high titer and negative control groups had a mean number of 2.9, 6.2, 6.9 and 10.8 piglets per litter, respectively, at 20 days of age (P0.0063). Both vaccine groups had significantly higher percentage and number of live piglets at weaning (P0.0203), thus this criterion of the study objective was met.
(373) Further analyses of farrowing data revealed more information that supports vaccine efficacy following PRRSv challenge, especially with respect to the high titer group. The high titer group exhibited statistically a higher percentage and a higher mean number of healthy piglets at birth (P0.0211); while exhibiting significantly lower percentages and mean numbers of weak and mummified feti (P0.0090), in comparison with the challenge control group. These data support that the high vaccine dose induced protective immunity against a virulent and heterologous PRRSv challenge strain. The low titer group also exhibited vaccine efficacy at farrowing, as evident by a higher percentage of healthy live piglets per litter (P=0.0138) and significantly lower percentages and mean numbers of mummified feti (P0.0190). Conversely, no differences were detected between groups for the percentage or number of stillborn feti or crushed/mortalities at farrowing (P0.1681).
(374) Seven days after challenge (D125), the low titer and high titer groups had significantly lower percentages of gilts positive for PRRSv RNA by qPCR testing, as well as significantly lower viral load for both groups, in comparison to the challenge control group (P0.0001). These data further support that both vaccine dose levels induced adequate immunity in gilts to significantly lower viral replication following challenge. Likewise, the low and high titer groups had significantly lower percentages of gilts qPCR positive on DOF 0 and DOF+13, as well as lower viral load for both groups on these study days (P0.0155). The low titer group had significantly lower percentage of gilts qPCR positive and lower viral load on D132 (P0.0290); while no statistical differences were detected between the high titer and the challenge control group for the same set of parameters (P0.1144). No statistical differences were detected between vaccine groups and challenge control group for percentage of gilts qPCR positive or viral load on DOF+7 and DOF+20 (P0.1719).
(375) Typically PRRSv does not induce clinical disease in gilts and sows, other than abortion. In this study 25%, 25%, 38% and 60% of challenge control, low titer, high titer and negative control gilts, respectively, exhibited clinical disease (received a clinical observation score>0) for at least one day post-challenge. No significant differences were detected between the vaccine groups and the challenge control group with respect to percentage of gilts with clinical disease for at least one day from D116 to DOF+20 (P0.7043). Gilts that exhibited some form of clinical disease did so at peri-parturition and not immediately after challenge. The high percentage of negative control gilts (60%) that exhibited clinical disease and the fact that clinical disease was noted primarily around the time of farrowing for all groups in this study supports that clinical disease was not attributed to PRRS disease but rather to physiological changes associated with parturition.
(376) All gilts in the study were PRRS ELISA seronegative on D0 thus providing confirmation of the inclusion criteria for the test animals entering the study. Likewise, all gilts were PRRS ELISA seronegative on D7. Vaccinated gilts began to exhibit PRRS ELISA seropositive results on D14 and the low and high dose groups exhibited their highest rate of seroconversion of 65% and 60%, respectively, on D56 (P<0.0001). Conversely, the challenge control group remained PRRS ELISA seronegative until 7 days post-challenge (D125). From D132 to study conclusion, all low titer, high titer and challenge control gilts were PRRS ELISA seropositive. The percentage of viremia positive gilts post-vaccination peaked on D7 for both vaccine groups as evidenced by 50% and 36% for the low and high titer groups, respectively (P0.0007). Viremia quickly dropped to 4% (1 of 28, No. 64) and 0% (0 of 28) for the low titer and high titer groups, respectively on D14 (P=1.0000 or no test conducted). Viremia remained at 4% for low titer (1 of 28, No. 56) and high titer (1 of 28, No. 91) groups on D21. On D56, one of 26 (4%, No. 89) low titer gilts and one of 25 (4%, No. 66) high titer gilts were positive for viremia. All gilts were negative for viremia on D84 and D118.
(377) No significant differences were detected between both vaccine titer groups and the challenge control group with respect to percentage of gilts per group post-vaccination with an abnormal clinical assessment for at least one day from D1 to D113 (P=1.0000). Individually, only three gilts exhibited any abnormal assessments during this time frame. Two gilts exhibited lameness (one challenge control gilt and one negative control gilt) and onelow titer gilt exhibited swelling in the left neck region. Since vaccine was administered in the right neck region, no adverse events associated with this vaccine were noted.
(378) Piglet PRRS viremia results on the DOF gave further insight to the level of protection in gilts in preventing cross-placental infection of piglets. On the DOF, a mean of 58.1% and 55.0% piglets per gilt in the low titer and high titer groups, respectively, were qPCR positive. Conversely, a mean of 86.3% piglets per gilt in the challenge control group were qPCR positive in serum/body fluids, which was significantly higher than both vaccine groups (P0.0381). When piglet viral load on DOF 0 was examined, high titer piglets had significantly lower viral load in comparison to challenge control piglets (P=0.0030); while no difference was detected for viral load between low titer and challenge control piglets (P=0.0620). Significant reductions (P0.05) in the percentage of piglets per gilt positive for viremia indicate reduced vertical transmission of virulent PRRSv from vaccinated gilt to off-spring when immunized with either dose of EU PRRS 94881 MLV. In addition, the high titer group had a median qPCR piglet value per gilt of 3.00 log.sub.10 GE/ml on the DOF; while the challenge control group had a median qPCR piglet value per gilt of 6.40 log.sub.10 GE/mL in serum/body fluids (P=0.0030). No significant difference was detected between the low dose group and the challenge control group for piglet viral load on DOF (P=0.0620). This data further supports the efficacy of the high dose of PRRS 94881 MLV when administered to gilts and sows.
(379) The low titer and high titer groups exhibited means of 32.5% and 33.4%, respectively, for piglets per litter with clinical disease (a clinical observation score of >0) for least one day from DOF+1 to DOF+20. These results were significantly lower than for the challenge control group, which exhibited a mean of 91.6% piglets per litter for the same parameter (P0.0001), further supporting vaccine efficacy for both dose levels.
(380) No significant difference was detected between groups for piglet mean body weights on DOF 0 (P0.2972); while both vaccine groups had significantly higher body weights on DOF+20 and ADWG from DOF 0 to DOF+20 (P0.0028). Once again, these results support the efficacy of both doses of PRRS 94881 MLV.
(381) Necropsy results confirmed the correct categorization of almost all feti at farrowing. Due to the very small number of feti that were listed as crushed that were actually stillborns and stillborns that were actually crushed at farrowing, in comparison to the overall number of feti correctly categorized at farrowing, no changes were made to the gilt performance data before it was analyzed. One-challenge control piglet died subsequently to blood collection. Since this situation only involved one piglet in comparison to the large overall number of piglets in the challenge control group, this piglet was not removed from analyses.
(382) Lung samples were collected from 141, 79, 75 and 4 dead feti/piglets from the challenge control, low titer, high titer, and negative control groups, respectively. A mean qPCR lung value of 4.68, 4.10, 3.55 and 0.00 log.sub.10 GE/mL was determined for the challenge control, low titer, high titer and negative control groups, respectively. No analyses were conducted on these data since piglets alive at 20 days of age were not necropsied, but these results highlight that gilts vaccinated with PRRS 94881 MLV resulted in lower viral load in the lungs of piglets when gilts were challenged with a virulent PRRSv.
(383) In conclusion, results from this study demonstrated significantly higher percentages of live piglets per litter at farrowing (P0.0455) and higher percentages and numbers of piglets per litter at weaning (P0.0203) for both vaccine groups in comparison to the challenge control group. Thus, the study objective was met and data from this study establishes the MID of PRRS 94881 MLV in gilts as 110.sup.2.43 TCID.sub.50/2 mL. These results were achieved 118 days after vaccination, which in addition establishes duration of immunity (DOI) in gilts of approximately 4 months.
(384) When supportive data was examined, the high dose of PRRS 94881 MLV (110.sup.3.90 TCID.sub.50/2 mL) was associated with a higher percentage and number of healthy piglets per gilt at farrowing (P0.0211), a lower percentage and number of weak and mummified feti (P0.0090), a lower percentage of qPCR positive gilts and lower viral load in gilts post-challenge on D125, DOF 0 and DOF+13 (P0.0155), a lower percentage of piglets per gilt qPCR positive and lower piglet viral load on DOF 0 (P0.0030), a lower percentage of piglets per gilt with clinical disease (P<0.0001), and higher piglet body weights on DOF+20 and ADWG (P<0.0013).
(385) The low dose group was associated with a higher percentage of healthy piglets per gilt at farrowing (P=0.0138), a lower percentage and number of mummified feti (P0.0190), a lower percentage of qPCR positive gilts and lower viral load in gilts post-challenge on D125, D132, DOF 0 and DOF+13 (P0.0290), a lower percentage of piglets per gilt qPCR positive on DOF 0 (P=0.0381), a lower percentage of piglets per gilt with clinical disease (P<0.0001), and higher piglet body weight on DOF+20 and ADWG (P<0.0028).
Example 7
Evaluation of the Onset of Immunity PRRS 94881 MLV in Susceptible Piglets Following Challenge with a Heterologous European Isolate of PRRS at Two Weeks Post-Vaccination
(386) The objective of this vaccination-challenge study was to assess the onset of immunity (OOI) two weeks after the administration of the vaccine candidate Porcine Reproductive and Respiratory Syndrome, European-derived Isolate 94881, Modified Live Virus (PRRS 94881 MLV) to 143 days of age susceptible piglets. The primary efficacy criterion to satisfy an OOI of 2 weeks post vaccination was if the vaccinate group (Group 1) demonstrated a significant difference (p0.05) for lung lesions post-challenge compared to the unvaccinated challenge control group (Group 2). Secondary parameters included clinical assessments after vaccination, clinical observations after challenge, rectal temperatures, average daily weight gain, assessment of PRRS antibodies and viremia in serum samples and quantitation of PRRS virus in lung samples collected at necropsy.
(387) Piglets were randomly assigned to either Group 1 (PRRS 94881 MLV-vaccine containing 110.sup.3.82 TCID.sub.50/mL and challenged; n=20), Group 2 (placebo vaccine and challenged; n=20) or Group 3 (placebo vaccine and not challenged; n=10). Piglets were housed in plastic pens with raised floors (n=5/pen). Each treatment group was housed in a different room to avoid transmission of PRRSv through mechanical routes, including aerosolization.
(388) All animals assigned to this study completed the study. No adverse events were reported during this study. The mean lung lesion scores on D24 were 27.4% and 54.8% for the PRRS 94881 MLV-vaccinated pigs and the challenge controls, respectively. The mean lung lesion score for the PRRS 94881 MLV-vaccinated pigs was significantly lower than the challenge controls (p=0.0002), and therefore the primary efficacy variable was met and the OOI was established at 2 weeks following a single vaccination. A significantly higher proportion of PRRS 94881 MLV-vaccinated pigs had positive PRRS-antibody titers on D14, D17 and D21 compared to challenge controls (p0.0012). The mean AUC for viremia was significantly lower for PRRS 94881 MLV-vaccinated pigs compared to challenge controls for D17-D24 (50.72 and 54.61 log.sub.10 GE/mL, respectively; p=0.0039) post challenge. PRRS 94881 MLV-vaccinated pigs exhibited no signs of lethargy (0%) after challenge compared with 45% of the challenge control pigs (p=0.0012). PRRS 94881 MLV-vaccinated pigs had higher weight gains during the post-challenge phase (SD14-SD24) of the study compared to challenge controls (0.3 and 0.1 kg, respectively; p=0.0003).
(389) The significant (p0.05) reduction of the lung lesions, clinical signs, replication of the virus in the blood and lungs post-challenge as well as the improvement of the growth performances in vaccinated animals demonstrate vaccine efficacy against virulent PRRSv when the challenge is performed 2 weeks post vaccination. It therefore supports the demonstration of an onset of immunity of at least 2 weeks post-vaccination with PRRS 94881 MLV.
(390) Objectives/Purpose of Study
(391) The objective of this vaccination-challenge study was to assess the onset of immunity (OOI) two weeks after the administration of the vaccine candidate Porcine Reproductive and Respiratory Syndrome, European-derived Isolate 94881, Modified Live Virus (PRRS 94881 MLV) to 143 days of age susceptible piglets. The primary efficacy criterion to satisfy an OOI of 2 weeks post vaccination was if the vaccinate group (Group 1) demonstrated a significant difference (p0.05) for decreased lung lesions post-challenge compared to the unvaccinated, challenge control group (Group 2).
(392) The secondary efficacy parameters analyzed between the vaccine group and the challenge control group included clinical assessments post-vaccination, PRRS serology, PRRS viremia post-challenge, clinical observations post-challenge, average daily weight gain (ADWG), rectal temperatures and lung PRRSv quantitation.
(393) A negative control group (Group 3), which was not vaccinated or challenged, was included in the study to demonstrate the source herd was free of PRRSv infection throughout the trial period and that biosecurity was not breached during this trial.
(394) Schedule of Events
(395) TABLE-US-00034 TABLE 7.1 Schedule of Events Study Day Dates Key Study Event 8 14 Dec. 2009 Screen for negative PRRS ELISA status 1 21 Dec. 2009 Arrival at VRI; Health Exam 1 to 12 21 Dec. 2009 to Clinical Assessments 03 Jan. 2010 0 22 Dec. 2009 Collect body weights Vaccinate Group 1 with IVP, Vaccinate Groups 2 & 3 with CP 7 29 Dec. 2009 Blood sample 13 to 24 04 Jan. 2010 to Clinical Observations and Rectal 15 Jan. 2010 Temperatures 14 05 Jan. 2010 Collect body weights and blood sample; Challenge Groups 1 & 2 with heterologous European PRRS isolate 17 and 21 08 Jan. 2010 and Blood sample 12 Jan. 2010 24 15 Jan. 2010 Euthanize and necropsy pigs after data and sample collection; Score lungs for pathology; collect lung tissues
(396) Study Design
(397) TABLE-US-00035 TABLE 7.2 Study Design Challenge on Number D 14 with 1 mL/ Euthanize of nostril and 1 mL and Piglets Treatment on D 0 IM of PRRSv Necropsy Group on D 0 (14 3 days of age) 205817 on D 24 1 20 1.0 mL IM of IVP Yes Yes (1 10.sup.3.82 TCID.sub.50/mL) 2 20 1.0 mL IM of Control Yes Yes Product (CP; Placebo matched product without PRRS 94881 MLV) 3 10 1.0 mL IM of CP No Yes
(398) Blinding Criteria
(399) The Study Investigator and designees were blinded to the assigned treatment groups throughout the in-life phase of the study. To maintain this blinding, an individual who did not participate in assessments of the pigs (i.e., clinical assessments, clinical observations or necropsies) performed the randomization and administered the assigned IVP and CP treatments on D0. BIVI laboratory personnel were blinded to the treatment each pig received while conducting their respective tasks.
(400) Materials
(401) Investigational Veterinary Product (IVP) and Control Product (CP)
(402) TABLE-US-00036 TABLE 7.3 IVP Generic Product Porcine Reproductive and Respiratory Syndrome, Name: Modified Live Virus Strain: 94881 Production and BIVI-Production produced PRRS 94881 MLV, Lot 390- Formulation: 005 (Appendix 4) in accordance with Outline of Production, Code 19S1.U_ and EU Dossier Part 2b. On D 0, BIVI-Ames reconstituted/diluted PRRS 94881 MLV vaccine Lot 390-005 (Appendix 4) with Phosphate buffered saline (PBS; Lot 809-003, Appendix 5) to formulate the IVP, Lot No. 257-086. Transcribed formulation records for the IVP are presented in Appendix 7 (original records available upon request). Manufacturer: Boehringer Ingelheim Vetmedica, Inc. 2621 North Belt Highway St. Joseph, MO 64506, USA Lot No.: N257-086 Expiry Date: An expiration date of 22 Dec. 2009 was assigned to the IVP for study purposes only. Storage Lyophilized vaccine: 2-8 C. Conditions: Rehydrated/diluted IVP: 2-8 C. or on ice Testing: Batch 390-005 was tested by BIVI-QC in accordance with draft Outline of Production and EU dossier Part 2F. At the start and end of the vaccination procedure, BIVI- Ames personnel were contacted. BIVI-Ames laboratory personnel tested pre- and post-vaccination aliquots for the IVP for virus titer in accordance with the PRRSv Titer Procedure (Appendix 1, Attachment 6). Test Results: Serial 390-005: Results were satisfactory (Appendix 4). IVP Lot N257-086: Mean titer of 1 10.sup.3.82 TCID.sub.50/mL (Appendix 7). IVP IVP was formulated for this study only and was not Retention: retained.
(403) TABLE-US-00037 TABLE 7.4 CP Generic Product Placebo Name: Formulation: BIVI-Production produced lyophilized placebo product containing inert material comprised in the vaccine serial without PRRS 94881 MLV (Lot N240-191-062409, Appendix 6). On D 0, BIVI-Ames reconstituted Lot N240-191-062409 with Phosphate buffered saline (PBS; Lot 809-003, Appendix 5) to formulate the CP, Lot No. 257-085. Transcribed formulation records for the CP are presented in Appendix 7 (original records available upon request). Manufacturer: Boehringer Ingelheim Vetmedica, Inc. 2621 North Belt Highway St. Joseph, MO 64506, USA Lot Number: N257-085 Expiry Date: An expiration date of 22 Dec. 2009 was assigned to the CP for study purposes only. Storage Lyophilized vaccine: 2-8 C. Conditions: Rehydrated CP: 2-8 C. or on ice Testing: CP was tested by BIVI-QC for EP sterility in accordance with Special Outline No. 96 (Appendix 1, Attachment 5). Test Results: CP was determined to be sterile (Appendix 7). CP Retention: CP was formulated for this study only and was not retained.
(404) Challenge Material
(405) TABLE-US-00038 TABLE 7.5 Challenge Material Name/number of PRRS isolate 205817 isolate Location and date The European PRRS virus isolate 205817 was derived of isolation incl. from isolate 190136 originally obtained from lung clinical symptoms tissue of a newborn piglet from a farm showing typical reproductive signs of PRRS (abortions in sows and weakness in newborn piglets) during an outbreak in Lower Saxony, Germany, in April 2004. The attending veterinarians submitted the lung samples to bioScreen (sample arrived on 21 Apr., 2004) for diagnostic testing. Isolate #190136 was directly propagated on MA 104 cells and a pure culture challenge stock was prepared for use in future BIVI clinical trials. A pure culture of isolate 190136 was used to inoculate pigs for evaluation of its ability to reproduce PRRS-specific respiratory disease in a controlled, laboratory trial. Challenged animals exhibited respiratory distress and revealed evidence of interstitial pneumonia upon histopathological examination. PRRS virus was successfully re-isolated from lung lesions was given the isolate designation 205817. Isolate 205817 was directly propagated on MA104 cells and a pure culture challenge stock was prepared for use in future BIVI clinical trials. Formulation: Challenge virus was thawed and diluted with MEM (Minimum Essential Medium) to a targeted titer of approximately 1 10.sup.6 TCID.sub.50/3 mL on D 14. An adequate volume of challenge material was prepared. Two aliquots were removed from challenge material. Lot Number: N257-093 Manufacture: Boehringer Ingelheim Vetmedica, Inc.-USA Storage conditions Bulk challenge material was stored at 70 10 C. Once prepared, diluted challenge material was maintained on ice until it was administered. Testing: At the start and end of the challenge procedure, BIVI- Ames was contacted. BIVI-Ames laboratory personnel tested pre- and post-challenge aliquots for virus titer in accordance with the PRRSv Titer Procedure Test Results: The challenge material had a mean titer of 1 10.sup.4.71 TCID.sub.50/3 mL dose Administration 1.0 mL/nostril and 1.0 mL IM in the left neck route (administered to all pigs in Groups 1 and 2 on D 14). Challenge material Challenge material was formulated for this study only retention: and was not retained.
(406) Treatments
(407) Dosing Justification
(408) The IVP was administered as a 1.0 mL dose to assigned pigs to evaluate OOI of PRRS 94881 MLV at 2 weeks post-vaccination. The CP was administered as a 1.0 mL dose to Groups 2 and 3 as a placebo vaccine.
(409) Dosing Regimen
(410) IVP or CP was administered to an assigned pig in the right neck region IM on D0 using a sterile 3.0 mL Luer-lock syringe and a sterile 20 g1 inch (2.54 cm) or 18 g inch (1.91 cm) needle by a person not collecting study data. The dosing regimen is shown below in Table 7.6.
(411) TABLE-US-00039 TABLE 7.6 Dosing Regimen Group Number Treatment Dose/Route Study Day 1 20 IVP 1.0 mL IM D 0 2 20 CP 1.0 mL IM D 0 3 10 CP 1.0 mL IM D 0
(412) Animal Information
(413) Details of Study Animals
(414) TABLE-US-00040 TABLE 7.7 Animal Information Source: Wilson Prairie View Farm N5627 Highway DD Burlington, WI 53105 USA Number of 50 piglets: Arrival date: Pigs arrived at the Veterinary Resources, Inc. (VRI) Cambridge facility on 21 Dec. 2009 (D-1). Arrival The 50 pigs assigned to the study were administered treatment: EXCEDE at label dose IM in the right ham after arrival. Identification: Individually ear tagged with unique number Species: Porcine Breed: Commercial crossbred Gender: Mixed (females and castrated males) Age range: 11 to 17 days of age on D 0 Weight range: 3.2 to 5.5 to kg on D 0 Ownership of Boehringer Ingelheim Vetmedica, Inc. test animals: Physiological On D-1, pigs selected for assignment to the study were status: observed by the Study Investigator and determined to be in good health and nutritional status. Observations were recorded on the Animal Health Examination Record form. Group-Pig Group 1 (n = 20): Group 2 (n = 20): Group 3 (n = 10): Assignments 55, 56, 60, 72, 75, 57, 61, 62, 68, 78, 51, 69, 80, 85, 76, 77, 83, 87, 91, 81, 86, 89, 97, 110, 104, 105, 128, 99, 102, 116, 117, 129, 132, 135, 150, 131, 133 and 155 124, 141, 142, 152, 154, 160, 165, 144, 156 and 162 167 and 168
(415) Inclusion/Exclusion Criteria
(416) All piglets enrolled in this study were PRRS ELISA negative and were healthy at the time of vaccination as determined by observation.
(417) Post-Inclusion Removal Criteria
(418) No pigs were removed from the study.
(419) Animal Management and Housing
(420) Animal Housing
(421) Piglets were housed at Veterinary Resources, Inc. (VRI) in Cambridge, Iowa for the duration of the study. Groups 1, 2 and 3 were housed in uniform but separate rooms to ensure biosecurity. Piglets were housed in multiple pens (5 piglets/pen) within each room. Group 1 was housed in 4 pens in Room 5, Group 2 was housed in 4 pens in Room 6 and Group 3 was housed in 2 pens in Room 4. Pens consisted of plastic tubs on raised stands with plastic slatted flooring. Each pen contained a plastic 6-hole feeder and a nipple waterer. Each isolation room was constructed identical to the others and all are biohazard level 2 (BL2) compliant, hepafiltered, mechanically ventilated with thermostat regulated temperature control.
(422) Treatment group isolation was necessary in this study as it is well known within the scientific community that PRRSv readily spreads from pig to pig via various mechanisms including aerosolization. This includes avirulent live PRRS vaccines as these biological products include attenuated virus particles that mimic the characteristics of virulent wild-type PRRS without the capability to cause disease. Proper methods were in place to ensure that biosecurity was maintained and that vaccinated animals did not accidentally cross-contaminate non-vaccinated, PRRSv nave negative control animals. Appropriate measures were taken by test facility staff to adequately clean and disinfect each room prior to its usage for this study.
(423) Each room in the facility has fans and heaters to aid in sufficient air circulation and heating. The ventilation system is separate yet identical for each room, so air is not shared between rooms.
(424) Solid feed was stored in bags, free from vermin. Water was ad libitum. Piglets were fed a commercial ration (Lean Metrics Infant, Purina Mills, St. Louis, Mo.) medicated with tiamulin (35 gm/ton) and chlortetracycline (400 gm/ton) ad libitum appropriate for their size, age, and condition; according to acceptable animal husbandry practices for the region.
(425) The pigs were in good health and nutritional status before initiation of the study as determined by the Study Investigator.
(426) During the study, select animals were observed with mild loss of body condition, rough haired appearance, swollen joints and varying degrees of lameness. The Study Investigator considered all of these to be non-specific conditions that commonly occur in groups of pigs housed in confinement. Coughing, sneezing, rapid respiration, dyspnea and mild to moderate lethargy were also noted in select pigs after challenge and were considered typical clinical signs associated with pneumonia, although non-specific for etiology. The Study Investigator determined that concomitant treatments were not required for any animals during this study.
(427) All pigs assigned to this study were disposed of by commercial incineration after euthanasia and necropsy on D24. No food products from animals enrolled in this study entered the human food chain.
(428) Assessment of Efficacy
(429) To assess the OOI of PRRS 94881 MLV at 2 weeks post-vaccination, Groups 1 & 2 were challenged on D14 and lung lesions post-challenge were evaluated. An OOI of 2 weeks post-vaccination was achieved if Group 1 (minimum immunizing dose of PRRS 94881 MLV) demonstrated significantly decreased (p0.05) lung pathology post-challenge compared with the challenge control group (Group 2).
(430) The secondary efficacy parameters analyzed between the vaccine group and the challenge control group included clinical assessments after vaccination, clinical observations after challenge, rectal temperatures, body weight and average daily weight gain (ADWG), assessment of PRRS antibodies and viremia in serum samples and quantitation of PRRS virus in lung samples collected at necropsy.
(431) A negative control group (Group 3), which was not challenged, was included in the study to demonstrate the source herd was free of PRRS infection and that biosecurity was maintained throughout the study.
(432) Criteria for a Valid Test
(433) Pre-purchase and D0 serum samples were all required to be negative for PRRS antibodies.
(434) Serum samples collected from Groups 2 and 3 up to the day of challenge and from Group 3 until study completion had to be free of PRRS antibodies for the study to be valid.
(435) Primary Outcome Parameter
(436) The primary efficacy variable for statistical evaluation was total lung lesion scores at D24 of the study.
(437) Total Lung Lesion Scores
(438) On Day 24 after data and samples were collected and recorded, all study pigs were euthanized following VRI SOP PRC1027 (Appendix 1, Attachment 8). Each pig was necropsied in accordance with VRI SOP PRC 1028 The thoracic cavity was exposed by a designee and the heart and lungs were removed. The Study Investigator examined each set of lungs, described any gross pathology noted and determined the % pathology for each lung lobe. Observations and data were recorded on the Necropsy Report Record form. A total lung lesion score was determined for each pig by using the EP formula.
(439) Supportive Parameters
(440) Other parameters to be analyzed between Group 1 and Group 2 included clinical assessments post-vaccination, PRRS serology, viremia post-vaccination, clinical observations post-challenge, ADWG, rectal temperatures and lung virus quantitation post challenge. These parameters were analyzed as supportive parameters and did not serve as primary parameters to satisfy the study objective.
(441) Clinical Assessment
(442) All pigs were observed on the days outlined in Table 7.1 for clinical assessments post-vaccination by the Study Investigator or designees. Observations were recorded on the Clinical Assessment Record form.
(443) PRRS Serology
(444) Venous whole blood was collected on the days outlined in Table 3. Briefly, approximately 2-5 mL of blood was collected from each piglet into an appropriate sized serum separator tube (SST). Sample collections were recorded on the Sample Collection Record form. Blood in SSTs was allowed to clot at room temperature. Blood samples were delivered to BIVI-Ames on the day of collection and Specimen Delivery Record form was completed. Blood samples were spun down by BIVI-Ames and serum was harvested, split and transferred to appropriate tubes. Each tube was labeled with the piglet's ID number, the study number, the date of collection, the study day and the sample type. At BIVI-Ames, one set of serum samples was held at 2-8 C. and the other set of serum samples was held at 7010 C.
(445) The serum samples collected days 0, 7, 14, 17, 21 and 24 and held at 2-8 C. were tested by BIVI-Ames for PRRS antibodies. Results were reported as negative (ELISA S/P ratio of <0.4) or positive (ELISA S/P ratio of 0.4).
(446) PRRS Viremia
(447) The other set of serum samples collected on days 0, 7, 14, 17, 21 and 24 and held at 7010 C. at BIVI-Ames until the in-life phase of the study was completed.
(448) A completed Specimen Delivery Record form was included with the shipment. bioScreen tested serum samples for PRRSv RNA by qPCR. Results were reported as genome equivalent/mL (log GE/mL).
(449) Clinical Observations Post-Challenge
(450) Piglets were observed for clinical signs of disease on the days outlined in Table 7.1. Observations were conducted by the Study Investigator or designees and were recorded on the Clinical Observation Record form. Piglets were observed each day for respiration, behavior and cough based on the clinical observation scoring system outlined below in Table 7.8.
(451) TABLE-US-00041 TABLE 7.8 Clinical Observation Scoring System Respiration Behavior Cough 0 = normal respiration 0 = normal 0 = none 1 = panting/rapid 1 = mild to moderate 1 = soft or intermittent respiration lethargy cough 2 = dyspnea 2 = severely lethargic 2 = harsh or severe, 3 = dead or recumbent repetitive cough 3 = dead 3 = dead
(452) Average Daily Weight Gain (ADWG)
(453) Individual body weights were collected on the days outlined in Table 3. Each pig was weighed on a calibrated scale by the Study Investigator or designees. Results were reported in kg on the Body Weight Record form. Average daily weight gain was determined from the D0 to D14 and from D14 to D24.
(454) Rectal Temperatures
(455) Rectal temperatures were collected by the Study Investigator or designees on the days outlined in Table 6.1. Rectal temperatures were recorded in C. on the Clinical Observation Record form.
(456) PRRS Virus Quantitation in Lung Tissue
(457) For each set of lungs, two samples from the Left and Right Apical lobes, the Left and Right Cardiac lobes, the Left and Right Diaphragmatic lobes and the Intermediate lobe, were retained. Each lung sample was approximately 1 inch (2.54 cm)1 inch (2.54 cm). For one set of lung samples, all three samples from the left side were combined into one container; while all three samples from the right side and the Intermediate lung lobe sample were combined into another container. Each container was filled with a sufficient amount of 10% formalin solution. For the other set of lung samples, all three lung samples from the left side were combined into one WHIRLPAK; while all three samples from the right side and the Intermediate lung lobe sample were combined into another WHIRLPAK. All containers and WHIRLPAKS were appropriately labeled with animal number, study number, date of collection, study day, sample type and whether the samples are from the left or right side. Lung samples in WHIRLPAKS were stored on dry ice until transported to BIVI-Ames while samples in formalin were stored at room temperature. Sample collections were recorded on the Necropsy Report Record form. Formalin fixed lung tissue samples and WHIRLPAK lung samples were transferred to BIVI-Ames. A completed Specimen Delivery Record form was included with each shipment.
(458) A completed Specimen Delivery Record form was included with the shipment. bioScreen tested lung samples for PRRSv RNA by qPCR (Appendix 1, Attachment 7). Left lung tissues were homogenized and tested. Right lung tissues and intermediate lung lobe samples were homogenized and tested. Results were reported as genome equivalent (log GE/mL) for left and right lung samples.
(459) Adverse Events
(460) No adverse events were reported during this study.
(461) Statistical Methods
(462) Experimental Unit
(463) Treatment groups had to be housed in separate rooms in this study to avoid transmission of PRRSv to non-vaccinated groups. Therefore, room was the experimental unit. However, for the purposes of this analysis, possible bias due to confounding room and treatment effects were ignored, and piglet was used as the experimental unit.
(464) Randomization
(465) Fifty (50) piglets were blocked by weight (n=5 piglets/block). Each pig was assigned a random number using the random number function in Excel. Within each weight block, pigs were ranked in ascending numerical order of the assigned random number. The treatment groups were then assigned to pigs in this numerical order: the 2 lowest random numbers were assigned to Group 1, the next 2 numbers were assigned to Group 2 and the highest number was assigned to Group 3. Groups 1 & 2 each contained 20 pigs and Group 3 contained 10 pigs.
(466) Analysis
(467) The statistical analyses and data summaries were conducted by Dr. rer. hort. Martin Vanselow, Biometrie & Statistik, Zum Siemenshop 21, 30539 Hannover, Germany, +49(0) 511 606 777 650, m.vanselow@t-online.de.
(468) Data were analyzed assuming a completely random design structure. The statistical analyses were performed using SAS software release 8.2 (SAS, Cary, USA/North Carolina, SAS Institute Inc. All tests on differences were designed as two-sided tests at =5%.
(469) Total Lung Lesion Scores
(470) The total lung lesion score on the day of necropsy (D24) was measured as the percentage of lung involvement calculated according to the weighting formula recommended in the draft monograph Porcine Enzootic Pneumonia Vaccine (inactivated). This formula takes into account the relative weight of each of the seven lung lobes. The assessed percentage of lung lobe area with typical lesions was multiplied by the respective factor per lung lobe giving the total weighted lung lesions score. The factors for the respective lung lobes are presented in Table 7.9.
(471) TABLE-US-00042 TABLE 7.9 Factors for Calculating Lung Lesion Scores Lung lobe Factor Left apical 0.05 Left cardiac 0.06 Left diaphragmatic 0.29 Right apical 0.11 Cardiac 0.10 Right diaphragmatic 0.34 Right accessory/intermediate 0.05
(472) The treatment groups were compared on differences using the Wilcoxon Mann-Whitney test.
(473) Clinical Assessment Post-Vaccination
(474) Frequency tables of animals with at least one positive finding between D1 and D12 were generated. Differences between treatment groups were tested by Fisher's exact test.
(475) PRRS Serology
(476) Frequency tables of positive ELISA results were generated. Differences between treatment groups were tested by Fisher's exact test.
(477) PRRS Viremia
(478) The viremia data were evaluated separately for each day of investigation. Additionally, for viral load the areas under the individual response curves between D14 and D24 (AUC D14-D24) and between D17 and D24 (AUC D17-D24) were analyzed.
(479) The quantitative PCR data (PRRS viral load [log.sub.10 GE/mL]) were used for comparisons between the treatment groups by the Wilcoxon Mann-Whitney test. Prior to the calculations the analytical result not detected was replaced by a log.sub.10 GE/mL value of 0.0 and positive was replaced by 3.0. The treatment groups were tested on differences using the Wilcoxon Mann-Whitney test.
(480) Clinical Observations Post-challenge
(481) Frequency tables of animals with at least one positive finding between D15 and D24 were generated. Differences between treatment groups were tested by Fisher's exact test.
(482) The maximum scores and the mean scores per animal from D15 to D24 for respiration, behavior, coughing and for all three added together (total) were used for the statistical evaluation. Differences between treatment groups were tested by the Wilcoxon Mann-Whitney test.
(483) Body Weight and Average Daily Weight Gain
(484) Individual daily weight gains were calculated for the time periods between D0 and D14 and between D14 and D24. For each day of investigation and for each time period descriptive statistics were calculated. Differences between treatment groups were tested using analysis of variance and subsequent t-tests. Least squares means of the groups and differences between least squares means with 95% confidence intervals were calculated from the analysis of variance.
(485) Rectal Temperatures
(486) Differences between treatment groups with respect to the original temperature data were tested using analysis of variance and subsequent t-tests. Least squares means of the groups and differences between least squares means with 95% confidence intervals were calculated from the analysis of variance.
(487) PRRS Virus Quantitation in Lung Tissues
(488) The quantitative PCR data (PRRS viral load [log.sub.10 GE/mL]) from lungs collected on D24 were used for comparisons between the treatment groups by the Wilcoxon Mann-Whitney test. The average (log.sub.10 GE/mL) of the left and right lung qPCR results were used for the evaluation. Prior to the calculations the analytical result not detected was replaced by log.sub.10 GE/mL of 0.0 and positive was replaced by 3.0.
(489) Frequency tables of positive qPCR results were generated. Differences between treatment groups were tested by Fisher's exact test.
(490) Results
(491) Total Lung Lesion Scores
(492) A summary of the group total lung lesion scores and the associated p-value is shown below in Table 7.10.
(493) TABLE-US-00043 TABLE 7.10 Total Lung Lesion Scores (%) Group.sup.1 N Min. Max. Median 95% CI QRange Mean p value 1 20 0.06 59.30 27.550 12.270 40.600 29.515 27.368 0.0002 2 20 13.86 91.60 55.200 47.300 66.500 21.850 54.841 3 10 0.00 0.06 0.000 0.000 0.000 0.000 0.006 NI .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged. NI = Not included in statistical analysis.
(494) Mean piglet D24 total lung lesion scores were 27.368% and 54.841% for the PRRS 94881 MLV-vaccinated group and challenge controls, respectively. The lesion score for the PRRS-vaccinated pigs was significantly lower than the mean lesion score for the challenge controls (p=0.0002).
(495) PRRS Viremia
(496) A summary of the PRRSv RNA detected in serum by qPCR data is shown below in Table 7.11.
(497) TABLE-US-00044 TABLE 7.11 PRRSv RNA Detected by qPCR in Serum (log.sub.10 GE/mL) by Day Day Group.sup.1 N Min. Max. Median 95% CI QRange Mean p value 7 1 20 0.00 5.34 3.00 3.00 3.79 0.82 3.17 <0.0001 2 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 10 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 14 1 20 0.00 4.29 3.32 3.00 3.77 0.84 3.30 <0.0001 2 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 10 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 17 1 20 5.54 8.07 6.72 6.47 7.08 0.80 6.78 <0.0001 2 20 6.44 9.02 8.18 7.47 8.47 1.09 8.00 3 10 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 21 1 20 6.18 8.73 7.38 7.13 8.08 0.98 7.51 0.0565 2 20 7.22 8.86 7.87 7.62 8.11 0.57 7.88 3 10 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 24 1 20 5.82 8.54 7.15 6.73 7.84 1.16 7.26 0.6251 2 20 6.53 8.29 7.27 6.97 7.60 0.67 7.34 3 10 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI AUC 1 20 56.95 78.02 65.10 60.39 70.05 9.76 65.84 0.4945 14-24 2 20 58.74 74.30 67.02 64.38 68.24 4.83 66.61 3 10 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI AUC 1 20 42.98 59.51 49.52 47.46 54.30 7.14 50.72 0.0039 17-24 2 20 49.08 60.99 54.35 52.93 55.38 3.63 54.61 3 10 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged. NI = Not included in statistical analysis. AUC = Area under the curve; GE/ml per day
(498) PRRSv RNA was not detected in the serum of any piglets on D0. PRRS 94881 MLV-vaccinated pigs had mean values of 3.17 and 3.30 log.sub.10 GE/mL on D7 and D14, respectively. The values were significantly higher than challenge controls on both of these days (p<0.0001), as challenge controls did not have any PRRSv RNA detected until D17. On that day, mean values were 6.78 and 8.00 log.sub.10 GE/mL for PRRS 94881 MLV-vaccinated piglets and challenge controls, respectively. The D17 value for challenge controls was significantly higher than the PRRS 94881 MLV-vaccinated piglets (p<0.0001). Mean values for PRRS 94881 MLV-vaccinated pigs on D21 and D24 were 7.51 and 7.26 log.sub.10 GE/mL on D21 and D24 respectively, compared to 7.88 and 7.34 log.sub.10 GE/mL for challenge controls on the same days. There were no significant differences between PRRS 94881 MLV-vaccinated pigs on D21 or 24 (p0.0565). No PRRSv RNA was detected in serum from any negative control pig during this study.
(499) There were no differences between the AUC 14-24 for PRRS 94881 MLV-vaccinated pigs and challenge controls pigs (65.84 and 66.61, respectively; p=0.4945). PRRS 94881 MLV-vaccinated pigs had a significantly lower AUC for D17-D24 compared to challenge controls (50.72 and 54.61, respectively; p=0.0039).
(500) PRRS Virus Quantitation in Lung Tissues
(501) Individual PRRSv qPCR results from lung tissues collected at necropsy on D24 are presented in Addendum 1, Table 30. A summary of the PRRSv RNA detected in lung tissues by qPCR data is shown below presented in Table 7.12 and a summary of the frequency of animals with positive qPCR at necropsy is shown below in Table 7.13.
(502) TABLE-US-00045 TABLE 7.12 Lung Viruse Isolation, qPCR (mean log10 GE/mL) at Necropsy (D 24) Group.sup.1 N Min. Max. Median 95% CI QRange Mean p value 1 20 6.63 8.26 7.46 7.07 7.86 0.84 7.47 0.0101 2 20 6.55 8.67 7.99 7.69 8.14 0.54 7.88 3 10 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged. NA = Not applicable because of lack of variability. NI = Not included in statistical analysis.
(503) TABLE-US-00046 TABLE 7.13 Frequency of Animals with Possible PRRSv RNA aPCR from Lung Tissues Collected at Necropsy (D 24) Day Group N % 95% CI Total P 24 1 20 100 83.2 100.0 20 NA 2 20 100 83.2 100.0 20 3 0 0 0.0 30.8 10 NI .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged. NA = Not applicable because of lack of variability. NI = Not included in statistical analysis.
(504) PRRSv RNA was detected in the lung tissues of all piglets in both the PRRS 94881 MLV-vaccinated group and all piglets in the challenge control group. There was no difference between these groups. PRRSv RNA was not detected in the lung samples of any negative control piglets.
(505) Clinical Observations Post-challenge
(506) The frequency of piglets with at least one positive clinical assessment score in the post-challenge period (D15-D24) is shown below in Table 7.14.
(507) TABLE-US-00047 TABLE 7.14 Frequency of Piglets with a Positive Clinical Observation Post Challenge (D 15-D 24) N % Parameter Group.sup.1 positive positive 95% CI Total p value Respiration 1 2 10 1.2 31.7 20 0.2351 2 6 30 11.9 54.3 20 3 0 0 0.0 30.8 10 NI Behavior 1 0 0 0.0 16.8 20 0.0012 2 9 45 23.1 68.5 20 3 0 0 0.0 30.8 10 NI Coughing 1 6 30 11.9 54.3 20 0.2003 2 11 55 31.5 76.9 20 3 0 0 0.0 30.8 10 NI Total 1 6 30 11.9 54.3 20 0.0562 2 13 65 40.8 84.6 20 3 0 0 0.0 30.8 10 NI .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged. NI = Not included in statistical analysis.
(508) Abnormal respiration was observed in both the PRRS 94881 MLV-vaccinated group (10%) and in the challenge control group (30%), however, these values were not significantly different (p=0.2351).
(509) Abnormal behavior was only observed in the challenge control group (45%), and not in the PRRS 94881 MLV-vaccinated group (0%). The PRRS 94881 MLV-vaccinated group had a significantly lower incidence of abnormal behavior than the challenge controls (p=0.0012).
(510) Coughing was observed in both the PRRS 94881 MLV-vaccinated group (30%) and in the challenge control group (55%). These values were not significantly different (p=0.2003).
(511) The percentages of piglets with total clinical scores>0 were 30% and 65% for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. These values were not significantly different (p=0.0562).
(512) No clinical signs were observed in the negative control group at any time after challenge.
(513) A summary of the group maximum clinical observation scores for the post-challenge period (D15 through D24) is shown below in Table 7.15.
(514) TABLE-US-00048 TABLE 7.15 Post-Challenge Maximum Clinical Scores, D 15 through D 24 Parameter Group.sup.1 N Min. Max. Median 95% CI QRange Mean p value Respiration 1 20 0 1 0 0 0 0 0.1 0.1872 2 20 0 2 0 0 1 1 0.4 3 10 0 0 0 0 0 0 0.0 NI Behavior 1 20 0 0 0 0 0 0 0.0 0.0012 2 20 0 1 0 0 1 1 0.5 3 10 0 0 0 0 0 0 0.0 NI Coughing 1 20 0 1 0 0 1 1 0.3 0.1129 2 20 0 2 1 0 1 1 0.7 3 10 0 0 0 0 0 0 0.0 NI Total 1 20 0 1 0 0 1 1 0.3 0.0072 2 20 0 4 1 0 2 2 1.2 3 10 0 0 0 0 0 0 0.0 NI .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged. NI = Not included in statistical analysis.
(515) Abnormal respiration was observed in both the PRRS 94881 MLV-vaccinated group and the challenge controls after challenge administration, with maximum scores of 1 (panting/rapid respiration) and 2 (dyspnea), respectively. There was no significant difference between these respiration scores (p=0.1872). The median maximum respiration score was 0 for both groups.
(516) No abnormal behavior was observed in the PRRS 94881 MLV-vaccinated group in the post-challenge period (maximum score=0). In contrast, the challenge control group had a maximum behavior score of 1 (mild to moderate lethargy; p=0.0012) although the median score for this group was 0. The maximum score for the PRRS 94881 MLV-vaccinated group was significantly lower than the score for the challenge control group (p=0.0012). Median maximum behavior scores were 0 for both groups.
(517) Coughing was observed in both the PRRS 94881 MLV-vaccinated group and in the challenge control group after challenge. Maximum scores were 1 (soft or intermittent cough) and 2 (harsh or severe, repetitive cough), and median scores were 0 and 1, for PRRS 94881 MLV-vaccinated and challenge controls, respectively. There were no significant differences between these groups (p=0.1129). Median maximum coughing scores were 0 and 1 for the PRRS 94881 MLV-vaccinated group and challenge control group, respectively.
(518) Maximum total scores were 1 and 4 and median total scores were 0 and 1 for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. The maximum score for the PRRS 94881 MLV-vaccinated group was significantly lower than the score for the challenge control group (p=0.0072). Median total scores were 0 and 1 for the PRRS 94881 MLV-vaccinated group and challenge control group, respectively.
(519) No clinical signs were observed from D15 through D24 in the non-challenged negative control group during this study. This group had a maximum score of 0 for each parameter.
(520) A summary of the group mean clinical observation scores for the post-challenge period (D15 through D24) is shown below in Table 7.16.
(521) TABLE-US-00049 TABLE 7.16 Post-Challenge Mean Clinical Scores, D 15 through D 24 Parameter Group.sup.1 N Min. Max. Median 95% CI QRange Mean p value Respiration 1 20 0.0 0.2 0.00 0.00 0.00 0.00 0.02 0.1394 2 20 0.0 0.6 0.00 0.00 0.10 0.10 0.07 3 10 0.0 0.0 0.00 0.00 0.00 0.00 0.00 NI Behavior 1 20 0.0 0.0 0.00 0.00 0.00 0.00 0.00 0.0012 2 20 0.0 0.8 0.00 0.00 0.10 0.10 0.12 3 10 0.0 0.0 0.00 0.00 0.00 0.00 0.00 NI Coughing 1 20 0.0 0.4 0.00 0.00 0.10 0.10 0.07 0.0835 2 20 0.0 0.7 0.10 0.00 0.30 0.35 0.17 3 10 0.0 0.0 0.00 0.00 0.00 0.00 0.00 NI Total 1 20 0.0 0.4 0.00 0.00 0.10 0.15 0.08 0.0103 2 20 0.0 1.4 0.25 0.00 0.40 0.50 0.35 3 10 0.0 0.0 0.00 0.00 0.00 0.00 0.00 NI .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged. NI = Not included in statistical analysis
(522) Mean clinical observation scores followed a pattern similar to maximum clinical scores with significant differences only observed between the PRRS 94881 MLV-vaccinated group and the challenge control group for mean behavior score (p=0.0012) and mean total score (p=0.0103).
(523) Mean respiration scores were 0.02 and 0.07 for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. Mean behavior scores were 0.00 and 0.12 for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. Mean coughing scores were 0.07 and 0.17 for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. Mean total scores were 0.08 and 0.35 for the PRRS 94881 MLV-vaccinated group and challenge control group, respectively.
(524) No clinical signs were observed from D15 through D24 in the non-challenged negative controls during this study. This group had a mean score of 0 for each parameter.
(525) Body Weight and Average Daily Weight Gain
(526) A summary of the body weights on D0, D14 and D24 and ADWG for D0 to D14 and D14 to D24 are shown below in Table 7.17.
(527) TABLE-US-00050 TABLE 7.17 Body Weight and Average Daily Weight Gain (kg and kg/d) Day(s) Group.sup.1 N Min. Max. Median Mean SD 0 1 20 3.3 5.5 3.95 4.14 0.589 2 20 3.2 5.2 4.05 4.17 0.603 3 10 3.4 5.1 4.00 4.07 0.556 14 1 20 5.6 9.4 7.60 7.64 1.029 2 20 6.0 8.9 7.30 7.39 0.909 3 10 5.5 9.3 6.95 7.22 1.187 24 1 20 7.0 13.9 10.40 10.26 1.693 2 20 6.4 10.9 8.80 8.87 1.328 3 10 6.8 12.9 10.90 10.64 1.807 ADWG 1 20 0.164 0.343 0.2571 0.2500 0.05254 0-14 2 20 0.179 0.307 0.2357 0.2304 0.03939 3 10 0.150 0.307 0.2071 0.2250 0.04906 ADWG 1 20 0.090 0.460 0.2600 0.2620 0.08907 14-24 2 20 0.060 0.290 0.1600 0.1475 0.09060 3 10 0.130 0.440 0.3700 0.3420 0.10130 .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged.
(528) Mean body weights on D0 were 4.1 and 4.2 kg for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. By D14, mean body weights were 7.6 and 7.4 kg for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. On D24, mean body weights were 10.3 and 8.9 kg for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. Average daily weight gains (ADWG) for the vaccination period (D0 to D14) were 0.25 and 0.23 kg/d for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. ADWGs for the challenge period (D14 to D24) were 0.26 and 0.15 kg/d for the PRRS 94881 MLV-vaccinated group and challenge control group, respectively. ADWGs for the negative controls were 0.23 and 0.34 kg/d for D0-D14 and D14-D24, respectively.
(529) Negative control piglets had mean body weights of 4.1, 7.2 and 10.6 kg on D0, D14 and D28, respectively.
(530) A summary of the LS Mean and statistical analysis of body weights and ADWG for the PRRS 94881 MLV-vaccinated group and the challenge control group is shown below in Table 7.18.
(531) TABLE-US-00051 TABLE 7.18 LS Mean Body Weight and Daily Gain (kg) Day(s) Group.sup.1 LS Mean 95% confidence interval p value 0 1 4.14 3.865 4.405 0.8743 2 4.17 3.895 4.435 Diff. 1 2 0.03 0.411 0.351 14 1 7.64 7.196 8.074 0.4297 2 7.39 6.951 7.829 Diff. 1 2 0.25 0.376 0.866 24 1 10.26 9.566 10.944 0.0063 2 8.87 8.176 9.554 Diff. 1 2 1.39 0.416 2.364 ADWG 1 0.2500 0.22898 0.27102 0.1889 0-14 2 0.2304 0.20934 0.25138 Diff. 1 2 0.0196 0.01008 0.04937 ADWG 1 0.2620 0.22133 0.30267 0.0003 14-24 2 0.1475 0.10683 0.18817 Diff. 1 2 0.1145 0.05699 0.17201 .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged.
(532) Day 0 LS Mean body weights were 4.14 and 4.17 kg for the PRRS 94881 MLV-vaccinated piglets and the challenge control group, respectively. The difference was 0.03 kg, which was not significantly different (p=0.8743). On D14, LS Mean body weights were 7.64 and 7.39 kg for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. The difference was 0.25 kg, which was also not significantly different (p=0.4297). On D24, the LS Mean body weights were 10.26 and 8.87 for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. The difference on this day was 1.39 kg, and the vaccinated group weight was significantly higher than the challenge control group (p=0.0063).
(533) LS Mean ADWGs for the vaccination period (D0-D14) were 0.25 and 0.23 kg/d for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. These values were not significantly different (p=0.1889). LS Mean ADWGs during the post-challenge period (D14-D24) were 0.26 and 0.15 for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. The ADWG for the PRRS 94881 MLV-vaccinated group was significantly higher than the ADWG for the challenge control group (p=0.0003).
(534) Rectal Temperatures
(535) A summary of rectal temperatures is shown below in Tables 7.19 and 7.20. A summary of the LS Mean and statistical analysis of rectal temperature for the PRRS 94881 MLV-vaccinated group and the challenge control group is shown below in Tables 7.21 and 7.22.
(536) TABLE-US-00052 TABLE 7.19 Rectal Temperature ( C.) Day 13-22 Day Group.sup.1 N Min. Max. Median Mean SD 13 1 20 39.3 40.3 39.80 39.77 0.247 2 20 38.9 40.0 39.35 39.39 0.292 3 10 39.0 39.7 39.15 39.26 0.267 14 1 20 39.4 40.2 39.75 39.76 0.226 2 20 39.0 39.8 39.40 39.37 0.220 3 10 39.1 40.3 39.40 39.51 0.375 15 1 20 39.3 40.4 39.65 39.69 0.258 2 20 39.4 41.1 39.70 39.90 0.538 3 10 39.1 40.3 39.40 39.52 0.371 16 1 20 39.9 41.3 40.80 40.68 0.417 2 20 39.3 40.3 39.75 39.77 0.279 3 10 39.1 39.9 39.45 39.46 0.263 17 1 20 39.2 40.6 39.80 39.89 0.363 2 20 39.4 40.6 39.85 39.90 0.285 3 10 39.2 40.0 39.50 39.53 0.226 18 1 20 39.3 41.0 39.95 39.99 0.492 2 20 39.5 41.2 40.20 40.29 0.472 3 10 38.9 39.7 39.30 39.30 0.211 19 1 20 39.7 41.6 40.35 40.40 0.464 2 20 39.5 41.1 40.65 40.55 0.451 3 10 39.0 39.6 39.20 39.22 0.199 20 1 20 39.7 41.5 40.50 40.52 0.449 2 20 39.5 41.5 40.65 40.61 0.531 3 10 39.1 40.1 39.40 39.49 0.281 21 1 20 39.6 41.1 40.30 40.22 0.413 2 20 39.4 41.0 40.10 40.12 0.371 3 10 39.2 40.2 39.45 39.59 0.351 22 1 20 39.8 41.0 40.20 40.34 0.391 2 20 39.6 41.2 40.30 40.41 0.437 3 10 39.0 40.0 39.40 39.45 0.276 .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged.
(537) TABLE-US-00053 TABLE 7.20 Rectal Temperature ( C.) Day 23-24 Day Group.sup.1 N Min. Max. Median Mean SD 23 1 20 39.6 41.2 40.25 40.36 0.454 2 20 39.5 41.6 40.60 40.60 0.482 3 10 39.3 40.1 39.70 39.68 0.290 24 1 20 39.8 41.3 40.30 40.39 0.421 2 20 39.7 41.6 40.30 40.50 0.531 3 10 39.1 40.2 39.60 39.66 0.389 .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged
(538) TABLE-US-00054 TABLE 7.21 LS Mean Rectal Temperature ( C.) Day 13-20 Day Group.sup.1 LSMean 95 % confidence interval p value 13 1 39.77 39.648 39.892 <0.0001 2 39.39 39.268 39.512 Diff. 1 2 0.38 0.207 0.553 14 1 39.76 39.654 39.856 <0.0001 2 39.37 39.269 39.471 Diff. 1 2 0.39 0.242 0.528 15 1 39.69 39.494 39.876 0.1241 2 39.90 39.704 40.086 Diff. 1 2 0.21 0.480 0.060 16 1 40.68 40.514 40.836 <0.0001 2 39.77 39.609 39.931 Diff. 1 2 0.91 0.678 1.132 17 1 39.89 39.737 40.033 0.8852 2 39.90 39.752 40.048 Diff. 1 2 0.02 0.224 0.194 18 1 39.99 39.767 40.203 0.0528 2 40.29 40.072 40.508 Diff. 1 2 0.31 0.614 0.004 19 1 40.40 40.188 40.602 0.3065 2 40.55 40.338 40.752 Diff. 1 2 0.15 0.443 0.143 20 1 40.52 40.293 40.737 0.5659 2 40.61 40.383 40.827 Diff. 1 2 0.09 0.405 0.225 .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged
(539) TABLE-US-00055 TABLE 7.22 LS Mean Rectal Temperature ( C.) Day 21-24 Day Group.sup.1 LSMean 95% confidence interval p value 21 1 40.22 40.037 40.393 0.4489 2 40.12 39.942 40.298 Diff. 1 2 0.10 0.156 0.346 22 1 40.34 40.152 40.528 0.6231 2 40.41 40.217 40.593 Diff. 1 2 0.07 0.331 0.201 23 1 40.36 40.143 40.567 0.1062 2 40.60 40.388 40.812 Diff. 1 2 0.25 0.545 0.055 24 1 40.39 40.168 40.602 0.4526 2 40.50 40.283 40.717 Diff. 1 2 0.12 0.422 0.192 .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged
(540) Mean and LS Mean rectal temperature for the PRRS 94881 MLV-vaccinated piglets were 39.77 C. on the day before challenge, and ranged from 39.69 C. (D15) to 40.68 C. (D16) after challenge. Mean and LS Mean rectal temperature for the challenge controls were 39.39 C. on the day before challenge and ranged from 39.77 C. (D16) to 40.61 C. (D20) after challenge. Least square Means rectal temperatures were significantly lower for challenge controls compared to PPRS 94881 MLV-vaccinated piglets before challenge administration (D13 and D14) and on D16 after challenge (p<0.0001). There were no other significant differences in rectal temperatures between PRRS 94881 MLV-vaccinated pigs and challenge controls in this study (p0.0528). Mean and LS Mean rectal temperatures for the negative controls remained 39.68 C. throughout the study.
(541) Clinical Assessment Post-Vaccination
(542) A summary of the percentage of piglet with at least one positive assessment from D1 through D12 is shown below in Table 7.23.
(543) TABLE-US-00056 TABLE 7.23 Percentage of Piglets With at Least One Positive Clinical Assessments from D 1-D 12 Group.sup.1 N positive % positive 95% CI Total p value 1 0 0 0.0 16.8 20 1.0000 2 1 5 0.1 24.9 20 3 0 0 0.0 30.8 10 NI .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged. NI = Not included in statistical analysis.
(544) No piglets in either the PRRS 94881 MLV-vaccinated group or the negative controls had any clinical assessment findings during the vaccination period D1 through D12. Piglet 110 in challenge control group was observed with a sore behind the right front leg beginning on D9. There was no significant difference between PRRS 94881 MLV-vaccinated piglets and challenge controls for this parameter (p=1.0000).
(545) PRRS Serology
(546) A summary of the frequency of piglets with positive PRRS-antibody titers is shown below in Table 7.24.
(547) TABLE-US-00057 TABLE 7.24 Frequency of Piglets with Positive PRRS-Antibody Titer by Dav Day Group.sup.1 N positive % positive 95% CI Total p value 7 1 0 0 0.0 16.8 20 NA 2 0 0 0.0 16.8 20 3 0 0 0.0 30.8 10 NI 14 1 17 85 62.1 96.8 20 <0.0001 2 0 0 0.0 16.8 20 3 0 0 0.0 30.8 10 NI 17 1 19 95 75.1 99.9 20 <0.0001 2 0 0 0.0 16.8 20 3 0 0 0.0 30.8 10 NI 21 1 20 100 83.2 100.0 20 0.0012 2 11 55 31.5 76.9 20 3 0 0 0.0 30.8 10 NI 24 1 20 100 83.2 100.0 20 1.0000 2 19 95 75.1 99.9 20 3 0 0 0.0 30.8 10 NI .sup.1Group 1 = PRRS 94881 MLV vaccine at MID, challenged; Group 2 = placebo-treated, challenged; Group 3 = placebo-treated, not challenged. NA = Not applicable, no analysis conducted. NI = Not included in statistical analysis.
(548) All piglets in all treatment groups were PRRS-antibody negative on D0 and D7. By D14, 85% of the PRRS 94881 MLV-vaccinated pigs had positive PRRS antibody titers. This number increased to 95% on D17 and was 100% on both D21 and D24. No pigs in the challenge control group developed positive PRRS-antibody titers until D21 (7 days after challenge administration) when 55% of the pigs had positive titers. This value increased to 95% by D24. On D14, D17 and D21, the PRRS 94881 MLV-vaccinated pigs had a significantly higher proportion of pigs with positive PRRS antibody titers compared to the challenge control group (p0.0012). No pigs in the negative control group developed PRRS antibody titers during this study.
(549) Discussion/Conclusion
(550) To achieve the study objective, three groups were included in the study design on D0: a vaccine group that received 110.sup.3.82 TCID.sub.50 of PRRS 94881 MLV (Group 1); a challenge control group that received control product (Group 2) and a negative control group (Group 3) that also received control product.
(551) Twenty (20) healthy, PRRS susceptible and seronegative piglets were inoculated IM with 1 ml of PRRS 94881 MLV at approximately 14 days of age. Thirty (20 pigletschallenge control group and 10 pigletsnegative control group) PRRS susceptible and seronegative piglets were inoculated IM with 1 ml of control product at approximately 14 days of age.
(552) To determine if an onset of immunity of 2 weeks for PRRS 94881 MLV was achieved, the vaccine group and the challenge control group were challenged 14 days post-vaccination with a heterologous European isolate of PRRSv (isolate 205817) and evaluated post-challenge for relevant reduction in lung lesions.
(553) Validation of the Study (Negative Control Group 3)
(554) To ensure that source piglets were free of PRRSv and that no extraneous PRRSv exposure or cross-contamination among treatment and control groups occurred during the study, a negative control group (Group 3) was included in the study design. Piglets in the negative control group were negative for PRRSv (viremia; qPCR) as well as for PRRS antibodies throughout the study, thus validating this trial.
(555) Validation of the Challenge Model (Challenge Control Group 2)
(556) A challenge model that induces sufficient PRRS clinical disease is necessary to adequately evaluate PRRS vaccine onset of immunity in a laboratory setting. Following inoculation with European PRRS isolate 205817 by the method described earlier, the challenge control group exhibited a mean rectal temperature of 40.50 C. on D19, D20 D23 and D24 (39.68 C. on same days, negative control group), a mean ADWG of 0.15 kg/day compared with a mean ADWG of 0.34 kg/day for the negative control group from D14 to D24, abnormal behavior, coughing, and a median lung lesion score of 55.2% (0.00%; negative control group). These results highlight that severe PRRS-specific clinical disease was induced in the challenge control group even though the challenge virus titer was slightly lower than the targeted dose, thus validating this challenge model as an adequate clinical laboratory tool to evaluate PRRS vaccine efficacy and more specifically, the OOI of PRRS 94881 MLV.
(557) Determination of Two Week Onset of Immunity of PRRS 94881 MLV (Group 1)
(558) Determination of an onset of immunity (OOI) for PRRS 94881 MLV of 2 weeks post-vaccination was based upon the vaccine group exhibiting a significant (p0.05) reduction in post-challenge lung lesions compared with the challenge control group.
(559) Lung lesions were selected as the primary parameter for determination of 2 week OOI because this parameter provides the most clinically relevant and convincing evidence of efficacy when evaluating a new vaccine within the PRRS respiratory challenge model in pigs. Lung lesion development is one of the hallmarks of PRRS respiratory disease in pigs. Lung lesions are often accompanied by subsequent manifestations of secondary PRRSv disease characteristics such as clinical signs, pyrexia, decreased ADWG, etc.
(560) The PRRS 94881 MLV-vaccinated group exhibited a significant reduction in gross lung pathology post-challenge, as evidenced by median total lung lesion score of 27.6% in comparison to the challenge control group, which exhibited a median total lung lesion score of 55.2% (p=0.0002). Thus, an OOI of 2 weeks for PRRS 94881 MLV at dosage of 110.sup.3.82 TCID.sub.50 was established based upon the primary parameter of a significant reduction for lung lesions post-challenge. This result was achieved with a vaccine dose slightly lower than the minimum immunizing dose of 110.sup.4.5 TCID.sub.50/dose.
(561) Viremia post-challenge was selected as the most important secondary parameter because it represents the level of viral replication and persistence occurring within the host animal upon exposure. A significant (p0.05) reduction in viremia would correspond with a PRRS vaccine that induces adequate immunity to limit PRRS pathogenesis within the host. At 3 days post-challenge (D17), PRRS 94881 MLV-vaccinated group was associated with a significant reduction in median viremia (qPCR) compared with the challenge control group (6.72 GE/mL vs. 8.18 GE/mL; p0.0001). To further evaluate viremia post-challenge between groups, the quantity of the viral load over a specific duration of time post challenge was calculated, as represented as area under curve or AUC. The PRRS 94881 MLV-vaccinated group had a median AUC value from D17 to D24 of 49.52 GE/mL/day; while the challenge control group had a median AUC value of 54.35 GE/ml/day. The median AUC value was significantly lower for the vaccine group compared with the challenge control group from D17 to D24 (p=0.0039). Whether viremia was examined 3 days post-challenge or over the course of the post-challenge period, PRRS 94881 MLV administered 2 weeks prior to challenge with a virulent heterologous European strain of PRRS significantly (p0.05) reduced viremia after challenge inoculation.
(562) In association with a reduction of PRRS viremia post-challenge, a significant (p0.05) reduction in the viral load in lung tissue would also be of great importance from the standpoint of PRRS vaccine immunity. A reduction of viral load in the lung tissue maybe associated with reduced viral stability, replication and persistence within the host and may secondarily lead to reduced shedding of PRRSv to other pigs. In this study, lung tissues from PRRS 94881 MLV-vaccinated group had a median lung qPCR result of 7.46 log.sub.10 GE/mL 10 days post challenge (D24) while the challenge control group had a median lung qPCR result of 7.88 log.sub.10 GE/mL. The difference between the vaccine group and the challenge control group was significant (p=0.0101), thus further supporting an OOI of 2 weeks.
(563) A marked reduction in severity and frequency of clinical signs post-challenge in piglets would also be supportive of PRRS vaccine efficacy and establishment of an OOI of 2 weeks for PRRS 94881 MLV. Abnormal respiration of sufficient severity and frequency was not noted in either group post-challenge and no differences were detected (p0.1394). Conversely, the severity and frequency of coughing was about equal between groups and no differences were detected (p0.0835). Differences were detected between groups for severity and frequency of abnormal behavior (lethargy) post-challenge. Zero of 20 (0%) and 9 of 20 (45%), PRRS 94881 MLV-vaccinated and challenge control piglets, respectively, exhibited abnormal behavior for at least one day post-challenge (p=0.0012). Likewise, the PRRS 94881 MLV-vaccinated group exhibited lower maximum abnormal clinical scores and mean abnormal clinical post-challenge compared with the challenge control group (p=0.0012). Total clinical scores (summation of respiration, behavior and coughing scores) were significantly different between groups when maximum scores and mean scores from D15 to D24 were analyzed. Due to the influence of abnormal behavior scores on total scores, the PRRS 94881 MLV-vaccinated group had a significantly lower maximum total score and lower mean total score compared with the challenge control group (p0.0103). The differences between groups for severity and frequency of abnormal behavior further support an OOI of 2 weeks post-vaccination.
(564) Pre-challenge, the PRRS 94881 MLV-vaccinated group had slightly higher mean rectal temperatures compared with the challenge control group on D13 (39.77 C. vs. 39.39 C., respectively; p<0.0001) and on D14 (39.76 C. vs. 39.37 C., respectively; p<0.0001). Although significant (p0.05) differences were detected between groups pre-challenge, these differences were not biologically relevant. Post-challenge, the only day in which a significant (p0.05) difference was detected between groups for mean rectal temperature was on D16 (2 days post-challenge). On D16, vaccinated and challenge control groups had mean rectal temperatures of 40.68 C. and 39.77 C., respectively, and difference between groups was significant (p<0.0001). The mean rectal temperature 4-5 days post challenge elevated above 40 C. and remained above 40 C. until the end of the study for both groups.
(565) The presence of significant abnormal behavior, viremia, lung pathology and viral load in lung tissues due to PRRS in the challenge control group resulted in significant (p0.05) differences between groups for ADWG post-challenge. In this study, the vaccinated and challenge control groups had mean ADWG from D14 to D24 of 0.3 kg/day and 0.1 kg/day, respectively, and the difference between groups was significant (p=0.0003). A significant (p0.05) difference between groups for ADWG post-challenge further supports the establishment of an OOI of 2 weeks post-vaccination.
(566) Post-Vaccination Parameters Examined in this Study
(567) No abnormal clinical assessments related to PRRS 94881 MLV vaccination or control product were observed in piglets following inoculation on D0. One-challenge control piglet exhibited a sore behind the right front leg beginning on D9 which appeared not to be associated with administration of the control product.
(568) All piglets were PRRS ELISA serology negative on D0, thus confirming that all piglets met the inclusion criterion of being PRRS negative upon entry into the study. The majority of piglets receiving PRRS 94881 MLV PRRS sero-converted by D14 and all PRRS-vaccinated piglets were seropositive by 7 days post-challenge (D21). Conversely, the challenge control remained seronegative until 7 days post-challenge, when this group began to demonstrate PRRS seroconversion. The negative control group remained PRRS seronegative throughout the entire study.
(569) At 7 and 14 days post-vaccination, the PRRS 94881 MLV-vaccinated group exhibited mean qPCR results of 3.17 and 3.30, log.sub.10 GE/mL, respectively. These results highlight that within 2 weeks post-vaccination, a dosage of 110.sup.3.82 TCID.sub.50 of PRRS 94881 MLV induced sufficient replication of the MLV that is often required to build protective immunity already at 2 weeks after vaccination. Conversely, the challenge control group and the negative control group were negative for PRRSv viremia from D0 to D14.
(570) Conclusion
(571) The significant (p0.05) reduction of the lung lesions, clinical signs, replication of the virus in the blood and lungs post-challenge as well as the improvement of the growth performances support the establishment of a 2 week OOI following vaccination with a single dose of PRRS 94881 MLV at 110.sup.3.82 TCID.sub.50/mL in piglets at approximately 14 days of age.
Example 8
Evaluation of Duration of Immunity of PRRS 94881 MLV in Susceptible Two Week Old Pigs Following Challenge with a Heterologous European Isolate of PRRS at 26 Weeks Post-Vaccination
(572) The objective of this vaccination-challenge study was to evaluate the duration of immunity (DOI) 26 weeks after the administration of the vaccine candidate Porcine Reproductive and Respiratory Syndrome, European-derived Isolate 94881, Modified Live Virus (PRRS 94881 MLV) to 143 days of age PRRS seronegative pigs. The primary efficacy criterion to satisfy a DOI of 26 weeks post-vaccination was a significant reduction in (p0.05) lung lesions scores (gross or histological) post-challenge in the PRRS 94881 MLV vaccinate group (Group 1) compared to the challenge control group (Group 2).
(573) On Day 0 (D0), 22 pigs assigned to the vaccinate group received 1.0 mL IM of PRRS 94881 MLV (110.sup.4.27 TCID.sub.50) IM (Group 1), 22 pigs assigned to the challenge control group received 1.0 mL IM of control product (product-matched placebo without PRRS 94881 MLV, Group 2) and 12 pigs assigned to the negative control group also received 1.0 mL IM of control product (Group 3). Groups 1 and 2 were challenged on D179 (Day post-challenge {DPC} 0) with a virulent strain of European PRRSv and pigs were monitored 10 days post-challenge for clinical signs, average daily weight gain, and viremia. Pigs were necropsied on D189 (DPC 10) and gross and histological lung lesions, and lung viral load were determined.
(574) Median gross lung lesion scores on D189 (DPC 10) were 0.1% and 13.8% for PRRS 94881 MLV-vaccinated pigs and challenge controls, respectively (p<0.0001). Median histological lung lesion scores on DPC 10 were 6.0 and 19.5 for PRRS 94881 MLV-vaccinated pigs and challenge controls, respectively (p<0.0001). PRRS 94881 MLV-vaccinated pigs had significantly less serum viral load at 3, 7 and 10 days post-challenge compared to challenge controls (p0.0001). The post-challenge area under the curve (AUC) analysis for viremia from DPC 0 to DPC 10 and DPC 3 to DPC 10 were also significantly lower for PRRS 94881 MLV-vaccinated pigs (15.54 and 8.88 log.sub.10 GE/mL per day, respectively) compared with the challenge control group (44.77 and 36.43 log.sub.10 GE/mL per day, respectively, p<0.0001). The median qPCR values for lung tissues collected at necropsy were 3.69 and 6.25 log.sub.10 GE/mL for PRRS 94881 MLV-vaccinated pigs and challenge controls, respectively (p<0.0001). There were no significant differences in clinical signs post-challenge (p0.4878).
(575) A significant reduction (p0.05) of gross and histological lung lesions, viral load in lung tissues collected at necropsy and post-challenge viremia for PRRS 94881 MLV-vaccinated pigs compared to challenge controls supported vaccine efficacy against virulent PRRSv when challenged 26 weeks post-vaccination. The results of this study establish a 26 week duration of immunity post-vaccination in pigs vaccinated with PRRS 94881 MLV at 2 weeks of age. These results were achieved with a vaccine dose of 110.sup.4.27 TCID.sub.50/mL, which was slightly below the minimum immunizing dose (110.sup.4.5TCID.sub.50/mL) for this investigational veterinary product.
(576) Objective(s)/Purpose of the Study
(577) The objective of this vaccination-challenge study was to evaluate the duration of immunity (DOI) of Porcine Reproductive and Respiratory Syndrome, European-derived Isolate 94881, Modified Live Virus, Code 19S1.U (PRRS 94881 MLV) administered to PRRS seronegative pigs, 143 days of age against a virulent challenge with a heterologous European isolate of PRRS at 26 weeks post-vaccination. The primary efficacy criterion to satisfy a DOI of 26 weeks post-vaccination was a significant reduction (p0.05) in lung lesions scores (gross or histological) post-challenge in the PRRS 94881 MLV vaccinate group (Group 1) compared to the challenge control group (Group 2)
(578) Secondary efficacy parameters included post-vaccination and post-challenge viremia, clinical assessments after vaccination, PRRS serology, post-challenge clinical observations, average daily weight gain (ADWG), rectal temperatures and lung PRRSv quantitation. Viremia post-challenge was considered to be the most important secondary parameter since it is an objective and quantifiable parameter. Rectal temperature and clinical observations were then considered supportive in the DOI definition process. Lastly, growth performance, serology and virus detection in lungs were used as supportive parameters towards the primary parameters in satisfying the study objective.
(579) Schedule of Events
(580) TABLE-US-00058 TABLE 8.1 Schedule of Events Study Day Dates Key Study Event 7 4 Feb. 2010 Blood samples collected to screen for negative PRRS ELISA status 2 9 Feb. 2010 Health Exam performed 1 to 21 10 Feb. 2010- Clinical Assessments performed daily 4 Mar. 2010 0 11 Feb. 2010 Body weights recorded; Blood samples collected for serology and viremia; Group 1 vaccinated with IVP, Groups 2 & 3 vaccinated with CP 7 18 Feb. 2010 Blood samples collected for serology and viremia 13 24 Feb. 2010 Pigs vaccinated with 1.0 mL CIRCOFLEX vaccine Microchip inserted SC in the left neck of each study pig 14 25 Feb. 2010 Blood samples collected for serology and viremia 21 4 Mar. 2010 Blood samples collected for serology and viremia 22 to 5 Mar. 2010- Clinical Assessments at least 3 times/week 177 7 Aug. 2010 28 11 Mar. 2010 Blood samples collected for serology and viremia 56 8 Apr. 2010 Blood samples collected for serology and viremia 84 6 May 2010 Blood samples collected for serology and viremia 112 3 Jun. 2010 Blood samples collected for serology and viremia 140 1 Jul. 2010 Blood samples collected for serology and viremia 168 29 Jul. 2010 Blood samples collected for serology and viremia D 178 8 Aug. 2010- Daily Clinical Observations and Rectal (DPC-1) 19 Aug. 2010 Temperatures to D 189 (DPC 10) D 179 9 Aug. 2010 Body weights collected; Blood samples (DPC 0) collected for serology and viremia; Groups 1 and 2 challenged with heterologous European PRRS isolate D 182 12 Aug. 2010 Blood samples collected for serology and (DPC 3) viremia D 186 16 Aug. 2010 Blood samples collected for serology (DPC 7) and viremia D 188 18 Aug. 2010 Body weights collected (DPC 9) D 189 19 Aug. 2010 Blood samples collected for (DPC 10) serology and viremia Pigs euthanized and necropsied Lung lesions scored for pathology Lung tissues collected for virus isolation and histopathology
(581) Study Design
(582) This was a blinded vaccination-challenge efficacy study conducted in 56 weaned, PRRS seronegative pigs, 143 days of age on Day 0 (D0). A summary of the study is provided in Table 8.2.
(583) TABLE-US-00059 TABLE 8.2 Study Design Challenged on D 179 (DPC 0) with 1.0 mL/nostril Euthanized and 1.0 mL IM of and Number PRRSv 205817 Necropsied of Pigs Treatment on D 0 (mean 1 10.sup.6.27 on D 189 Group on D 0 (14 3 days of age) TCID.sub.50/3 mL) (DPC 10) 1 22 1.0 mL IM of IVP Yes Yes (PRRS 94881 MLV) 2 22 1.0 mL IM of Yes Yes Control Product (CP; Placebo matched product without PRRS 94881 MLV) 3 12 1.0 mL IM of CP No Yes
(584) Blinding Criteria
(585) The Study Investigator and designees were blinded to the assigned treatment groups throughout the in-life phase of the study. To maintain this blinding, the BIVI monitor performed the randomization and an individual who did not participate in assessments of the pigs (i.e., clinical assessments, clinical observations or necropsies) administered the assigned IVP and CP treatments on D0. BIVI laboratory personnel were blinded to the treatment each pig received while conducting their respective tasks.
(586) Materials
(587) Investigational Veterinary Product (IVP) and Control Product
(588) TABLE-US-00060 TABLE 8.3 IVP Generic Porcine Reproductive and Respiratory Syndrome, Product Name: Modified Live Virus Strain: 94881 Production and BIVI-St. Joseph Production produced PRRS 94881 MLV, Formulation: Lot 390-005 (Section 15.4) in accordance with Outline of Production, Code 19S1.U_ and EU Dossier Part 2b. On D 0, BIVI-Ames reconstituted/diluted PRRS 94881 MLV vaccine Lot 390-005 with Phosphate buffered saline (PBS; Lot 809-002, Section 15.5) to formulate the IVP, Lot No. N257-137 at a target dosage of approximately 1 10.sup.4.5 TCID.sub.50/mL. Manufacturer: Boehringer Ingelheim Vetmedica, Inc. 2621 North Belt Highway St. Joseph, MO 64506, USA Lot No.: 390-005, reconstituted to Lot N257-137 Expiry Date: An expiration date of 11 Feb. 2010 was assigned to the IVP for study purposes only. Storage Lyophilized vaccine: 2-8 C. Conditions: Rehydrated/diluted IVP: on ice Testing: PRRS 94881 MLV, Lot 390-005 and PBS, Lot 809-002 were tested by BIVI-QC in accordance with draft Outline of Production (Section 15.1) and as further specified in the EU dossier Part 2.F. BIVI-Ames laboratory personnel tested pre- and post-vaccination aliquots of the WP for virus titer in accordance with the PRRSv Titer Procedure (Section 15.1). Test Results: Lot 390-005: Results were satisfactory (Section 15.4). Lot 809-002: Results were satisfactory (Section 15.5). IVP Lot N257-137: Mean titer of 1 10.sup.4.27 TCID.sub.50/mL (Section 15.7). IVP IVP was reconstituted/diluted for immediate use in this Retention: study only and was not retained beyond the vaccination event.
(589) TABLE-US-00061 TABLE 8.4 CP Generic Product Placebo Name: Formulation: BIVI-Production produced lyophilized placebo product containing inert material comprised in the vaccine serial without PRRS 94881 MLV (Lot N240-191-062409, Section 15.6). On D 0, BIVI-Ames reconstituted Lot N240-191-062409 with Phosphate buffered saline (PBS; Lot 809-002, Section 15.5) to formulate the CP, Lot No. N257-134 Manufacturer: Boehringer Ingelheim Vetmedica, Inc. 2621 North Belt Highway St. Joseph, MO 64506, USA Lot Number: Lot N240-191-062409, reconstituted to Lot N257-134 Expiry Date: An expiration date of 11 Feb. 2010 was assigned to the CP for study purposes only. Storage Lyophilized vaccine: 2-8 C. Conditions: Rehydrated CP: 2-8 C. or on ice Testing: Lot N240-191-062409 and Lot N257-134 were tested by BIVI-QC for EP sterility Test Results: Lot N240-191-062409: Results were satisfactory for sterility (Section 15.6). Lot 809-002: Results were satisfactory for sterility CP was determined to be sterile (Section 15.7). CP Retention: CP was reconstituted for use in this study only and was not retained beyond the vaccination event.
(590) Challenge Material
(591) TABLE-US-00062 TABLE 8.5 Challenge Material Name/number of PRRS isolate 205817 isolate Location and date The European PRRS virus isolate 205817 was derived of isolation incl. from isolate 190136 originally obtained from lung clinical symptoms tissue of a newborn pig from a farm with typical reproductive signs of PRRS (abortions in sows and weakness in newborn pigs) during an outbreak in Lower Saxony, Germany, in April 2004. The attending veterinarians submitted the lung samples to bioScreen (sample arrived on 21 Apr. 2004) for diagnostic testing. Isolate 190136 was directly propagated on MA 104 cells and a pure culture challenge stock was prepared. A pure culture of isolate 190136 was used to inoculate pigs for evaluation of its ability to reproduce PRRS-specific respiratory disease in a controlled, laboratory trial. Challenged animals exhibited respiratory distress and revealed evidence of interstitial pneumonia upon histopathological examination. PRRS virus successfully re-isolated from lung lesions was given the isolate designation of 205817. Isolate 205817 was directly propagated on MA104 cells and a pure culture challenge stock was prepared for use in future BIVI clinical trials. Formulation: Challenge virus was propagated in AK-MA104 cells and formulated to a targeted titer of approximately 1 10.sup.6 TCID.sub.50/3 mL dose on D 179. An adequate volume of challenge material was prepared. Two 5 mL aliquots were removed from challenge material for assay purposes before the challenge material was transported to VRI. Lot Number: N270-179 Manufacture: Boehringer Ingelheim Vetmedica, Inc.-USA Storage conditions Bulk challenge material was stored at 70 10 C. Once prepared, diluted challenge material was maintained on ice until it was administered. Testing: BIVI-Ames laboratory personnel tested pre- and post- challenge aliquots for virus titer in accordance with the PRRSv Titer Procedure Test Results: The challenge material had a mean titer of 1 10.sup.6.27 TCID.sub.50/3 mL dose Administration 1.0 mL/nostril and 1.0 mL IM in the right neck route Challenge material Challenge material was thawed/diluted for this study retention: only and was not retained beyond the challenge event.
(592) Treatments
(593) Dosing Justification
(594) The IVP was administered as a 1.0 mL dose to assigned pigs to evaluate DOI of PRRS 94881 MLV at 26 weeks post-vaccination. The CP was administered as a 1.0 mL dose to Groups 2 and 3 as a placebo vaccine.
(595) Dosing Regimen
(596) IVP or CP IVP or CP was administered was administered to an assigned pig in the right neck region IM on D0 using a sterile 3.0 mL Luer-lock syringe and a sterile 20 g1 inch (2.54 cm) needle by a person not collecting study data. The dosing regimen is shown below in Table 8.6
(597) TABLE-US-00063 TABLE 8.6 Dosing Regimen Group Number Treatment Dose/Route Study Day 1 22 IVP 1.0 mL IM D 0 2 22 CP 1.0 mL IM D 0 3 12 CP 1.0 mL IM D 0
(598) Concomitant Treatments
(599) Due to the fact that several pigs were found dead early in the study subsequent to bacterial infections, the Investigator and Study Monitor agreed upon the administration of the following additional concomitant treatments to all study animals (Section 15.10):
(600) Day 20: Mu-Se (Vitamin E/Selenium, Intervet/Schering Plough Animal Health, USA), 0.1 mL IM in the right ham
(601) Day 21: EXCEDE (Ceftiofur, Pfizer Animal Health, USA), 0.5 mL in the left ham
(602) Day 35: EXCEDE (Ceftiofur, Pfizer Animal Health, USA), 1.0 mL in the right ham.
(603) Day 42: EXCEDE (Ceftiofur, Pfizer Animal Health, USA), 1.0 mL in the left ham.
(604) Day 47: BAYTRIL 100 (Enrofloxacin, Bayer Animal Health, USA), 1.5 mL SC in the left neck
(605) Vitamin E/Selenium was administered for the prevention of mulberry heart disease and the antibiotic treatments were administered for the treatment/prevention of bacterial infections.
(606) Animal Information
(607) Details of Animal Studies
(608) TABLE-US-00064 TABLE 8.7 Animal Information Source: Prairie View Farms, N5627 Hwy DD, Burlington, WI 53105 Number of 56 pigs: Arrival day: Pigs arrived at the Veterinary Resources, Inc. (VRI) Cambridge facility on D-2 (9 Feb. 2010). Identification: Each animal was identified with individual double ear tags at arrival on D-2. Each animal also had an electronic microchip inserted SC in the left neck on D 13. Species: Porcine Breed: Commercial crossbred Gender: Females or castrated males. Age range: 13 to 17 days of age on D 0 Weight 2.4 to 5.4 kg on D 0 range: Ownership of Boehringer Ingelheim Vetmedica, Inc. test animals: Physiological On D-2, pigs selected for assignment to the study were status: observed by the Study Investigator and determined to be in good health and nutritional status. Observations were recorded on the Animal Health Examination Record form. Group-Pig Group 1 (n = 22): Group 2 (n = 22): Group 3 (n = 12): Assignments 117, 118, 119, 123, 124, 125, 130, 116, 120, 126, 121, 127, 128, 134, 137, 138, 148, 132, 135, 145, 129, 131, 133, 149, 150, 156, 157, 151, 152, 155, 136, 139, 141, 158, 160, 161, 165, 159, 166 and 171 142, 144, 146, 167, 169, 170, 172, 147, 153, 154, 177 and 178 162, 163, 164 and 179
(609) Inclusion/Exclusion Criteria
(610) All pigs enrolled in this study were PRRS ELISA negative (ELISA S/P ratio of <0.4) and were healthy at the time of vaccination (D0) as determined by observation.
(611) Post-Inclusion Removal Criteria
(612) No pigs were removed from the study. Three pigs were found dead before challenge administration. Further results on these three pigs are presented in Section 12.8.
(613) Animal Management and Housing
(614) Pigs were housed at Veterinary Resources, Inc. (VRI) in Cambridge, Iowa for the duration of the study. Pigs were housed in multiple pens (11 or 12 pigs/pen) within each room, with vaccinated (Group 1) and control animals (Groups 2 and 3) housed in uniform but separate rooms to ensure biosecurity. PRRS 94881 MLV pigs were housed in Room CB8 until D78, then in CC1 until D105, and then CC3 for the remainder of the study. Challenge control pigs were housed in Room CC2 throughout the study. Negative control pigs were housed in Room CB6 until D73 and then in CB7 for the remainder of the study. Animal pens were elevated with plastic slatted flooring, with age appropriate feeders and nipple cup drinkers. Each isolation room was constructed identical to the others and all were biohazard level 2 (BL2) compliant, hepafiltered, mechanically ventilated with thermostat regulated temperature control.
(615) Treatment group isolation was necessary in this study as it is well known within the scientific community that PRRSv readily spreads from pig to pig via various mechanisms including aerosolization. This includes avirulent live PRRS vaccines as these biological products include attenuated virus particles that mimic the characteristics of virulent wild-type PRRS without the capability to cause disease. Proper methods were in place to ensure that biosecurity was maintained and that vaccinated animals did not accidentally cross-contaminate non-vaccinated, PRRSv nave negative control animals.
(616) Appropriate measures were taken by test facility staff to adequately clean and disinfect each room prior to its usage for this study.
(617) Each room in the facility had fans and heaters to aid in sufficient air circulation and heating. The ventilation system was separate yet identical for each room, so air was not shared between rooms.
(618) Feed was stored in bags, free from vermin. Feed and water were available ad libitum. Pigs were fed Lean Metrics Infant Medicated feed (Purina Mills LLC, St. Louis, Mo.) from arrival to D5, when they were switched to Lean Metrics Senior Medicated feed (Purina Mills LLC, St. Louis, Mo.). On D64 the pigs were switched to Lean Metrics Complete 85 feed (Purina Mills LLC, St. Louis, Mo.), and on D82 they were switched to Lean Metrics Complete CE85, T40 (Purina Mills LLC, St. Louis, Mo.), which they were fed for the remainder of the study. Throughout the study, the feeds provided were appropriate for the size, age, and condition of the pigs according to acceptable animal husbandry practices for the region.
(619) The pigs were in good health and nutritional status before initiation of the study as determined by the Study Investigator. During the study, select animals were observed with other conditions, including thinness, coughing, swellings, rough hair coat, depression, abscesses, and poor body condition. The Study Investigator considered all of these conditions to be typical of group housed growing/maturing pigs. These conditions were considered transient or inconsequential and were not treated.
(620) Assessment of Effectiveness
(621) To assess the DOI of PRRS 94881 MLV at 26 weeks post-vaccination, the PRRS 94881 MLV and challenge control groups were challenged on D179 (DPC 0) and lung lesions post-challenge were evaluated 10 days later (DPC 10). A DOI of 26 weeks post-vaccination was achieved if PRRS 94881 MLV group had significantly decreased (p0.05) lung pathology (gross or histological) post-challenge compared with the challenge control group.
(622) The secondary efficacy parameters analyzed between the vaccine group and the challenge control group included post-vaccination and post-challenge viremia, post-challenge clinical observations, post-challenge rectal temperatures, post-vaccination clinical assessments, average daily weight gain (ADWG) and PRRS serology. Viremia post-challenge was considered to be the most important secondary parameter since it is an objective and quantifiable parameter. Rectal temperature and clinical observations were then considered supportive in the DOI definition process. Lastly, growth performance, serology and virus detection in lungs were used as supportive parameters towards the primary parameters in satisfying the study objective.
(623) Criteria for a Valid Test
(624) All pigs were required to be PRRS ELISA negative (ELISA S/P ratio of <0.4) at pre-purchase screening and on D0. Challenge control pigs were required to be negative for PRRS antibodies up to challenge and the negative control group was required to be negative for PRRS antibodies throughout the study.
(625) Primary Outcome Parameter
(626) The primary efficacy outcome variable was lung pathology (gross and histological lesions) at D189 (DPC 10) of the study.
(627) Gross Lung Lesion Scores
(628) On D189, after samples and data were collected and recorded, all remaining study pigs were euthanized following VRI SOP PRC1027 (Section 15.1). Each pig was necropsied in accordance with VRI SOP PRC 1028 (Section 15.1). The thoracic cavity of each pig was exposed by a designee and the heart and lungs were removed. The Study Investigator examined each set of lungs, described any gross pathology and determined the percentage of pathology for each lung lobe. Observations and data were recorded on the Necropsy Report Record form.
(629) Histological Lung Lesion Scores
(630) For each set of lungs, two samples from the Left and Right Apical lobes, the Left and Right Cardiac lobes, the Left and Right Diaphragmatic lobes and the Intermediate lobe were retained. Each lung sample was approximately 1 inch (2.54 cm)1 inch (2.54 cm). For one set of lung samples, all three samples from the left side were combined into one container; while all three samples from the right side and the Intermediate lung lobe sample were combined into another container. Each container was filled with a sufficient amount of 10% formalin solution. For the other set of lung samples, all three lung samples from the left side were combined into one WHIRLPAK; while all three samples from the right side and the Intermediate lung lobe sample were combined into another WHIRLPAK. All containers and WHIRLPAKS were appropriately labeled with animal number, study number, date of collection, study day, sample type and whether the samples were from the left or right side. Lung samples in formalin were stored at room temperature while lung samples in WHIRLPAKS were stored on dry ice until transported to BIVI-Ames. Sample collections were recorded on the Necropsy Report Record form. Formalin fixed lung tissue samples and WHIRLPAK lung samples were transferred to BIVI-Ames. A completed Specimen Delivery Record form was included with each shipment.
(631) Formalin fixed lung tissue samples were held by BIVI-Ames at room temperature until submitted to Iowa State University Veterinary Diagnostic Laboratory (ISU VDL) by BIVI-Ames. Lung samples were handled and processed by ISU VDL personnel according to ISU VDL procedures within one week of necropsy. A single slide was generated for each pig containing seven sections (one each of all seven lung lobes). Each H & E slide was identified with a unique identifier code. ISU VDL provided a computer record containing the study number, identifier codes and associated pig tissues.
(632) Once daily, on the days in which the study slides were read for histopathology, an ISU VDL pathologist (K. Schwartz) first read the EU PRRS positive and negative control slides. Afterwards, the pathologist read the H & E stained lung slides for pneumocytic hypertrophy and hyperplasia, septal infiltration with mononuclear cells, necrotic debris, intra-alveolar accumulation of inflammatory cells and perivascular accumulation of inflammatory cells. Results were recorded in an Excel spreadsheet. The lung histopathology scoring system is shown below in Table 8.8.
(633) TABLE-US-00065 TABLE 8.8 Lung Histopathology Scoring System Pneumocytic hypertrophy and Intra-alveolar accumulation of hyperplasia inflammatory cells 0 = Not present 0 = Not present 1 = Mild 1 = Mild 2 = Moderate 2 = Moderate 3 = Severe 3 = Severe Septal infiltration with Perivascular accumulation of mononuclear cells inflammatory cells 0 = Not present 0 = Not present 1 = Mild 1 = Mild 2 = Moderate 2 = Moderate 3 = Severe 3 = Severe Definitions of scoring system applied to histological parameters (except necrotic Necrotic debris debris): 0 = Not present 0 = not present: no detectable lesions 3 = Yes present present within an area of view 1 = Mild lesions: few positive cells (1-5 cells/area) present within an area of view 2 = Moderate lesions: multiple positive cells (>5 cells/area) at single location or few cells (1-5 cells/area) at multiple locations within an area of view. 3 = Severe lesions: multiple positive cells (>5 cells/area) at multiple locations within an area of view.
(634) Upon completion of the reading of all slides, slides were returned to the Sponsor Representative and will be archived at Boehringer Ingelheim Vetmedica, Inc., St. Joseph, Mo. upon completion of the final report.
(635) Secondary Parameters
(636) Secondary variables included post-vaccination and post-challenge viremia, post-challenge clinical observations, post-challenge rectal temperatures, average daily weight gain (ADWG), lung PRRSv quantitation, post-vaccination clinical assessments, and PRRS serology.
(637) Serum PRRS qPCR
(638) Venous whole blood was collected at pre-purchase and on Days 0, 7, 14, 21, 28, 56, 84, 112, 140, 168, 179 (DPC 0), 182 (DPC 3), 186 (DPC 7), and 189 (DPC 10). Briefly, approximately 2-5 mL of blood was collected from each pig into an appropriate sized serum separator tube (SST). Sample collections were recorded on the Sample Collection Record form. Blood in SSTs was allowed to clot at room temperature. Blood samples were delivered to BIVI-Ames on the day of collection and Specimen Delivery Record form was completed. Blood samples were spun down by BIVI-Ames and serum was harvested, split and transferred to appropriate tubes. Each tube was labeled with the pig's ID number, the study number, the date of collection, the study day and the sample type. At BIVI-Ames, one set of serum samples was held at 2-8 C. and the other set of serum samples was held at 7010 C.
(639) Clinical Observations Post-Challenge
(640) Pigs were observed for clinical signs of disease from D178 (DPC1) to D189 (DPC 10). Observations were conducted by the Study Investigator or designees and were recorded on the Clinical Observation Record form. Pigs were observed each day for respiration, behavior and cough based on the clinical observation scoring system outlined below in Table 8.9.
(641) TABLE-US-00066 TABLE 8.9 Clinical Observation Scoring System Respiration Behavior Cough 0 = normal respiration 0 = normal 0 = no coughing 1 = panting/rapid 1 = mild to moderate 1 = soft or intermittent respiration lethargy cough 2 = dyspnea 2 = severely lethargic 2 = harsh or severe, 3 = dead or recumbent repetitive cough 3 = dead 3 = dead
(642) Rectal Temperatures
(643) Rectal temperatures were collected by the Study Investigator or designees from D178 (DPC1) to D189 (DPC 10). Rectal temperatures were recorded in C. units on the Clinical Observation Record form.
(644) Body Weight and Average Daily Weight Gain
(645) Individual body weights were collected on D0, D179 (DPC 0) and D188 (DPC 9). Each pig was weighed on a calibrated scale by the Study Investigator or designees. Results were recorded in kg units on the Body Weight Record form. Average daily weight gain was determined from the D179 (DPC 0) to D188 (DPC 9).
(646) Lung PRRS qPCR
(647) Lung tissue samples in WHIRLPAKS were held at 7010 C. at BIVI-Ames until shipped to address listed in Section 9.3.1. A completed Specimen Delivery Record form was included with the shipment. bioScreen tested lung samples for PRRSv RNA by qPCR (Section 15.1). Left lung tissues were homogenized and tested. Right lung tissues and intermediate lung lobe samples were homogenized and tested. Results were reported as genome equivalent (log.sub.10 GE/mL) for left and right lung samples. A geometric mean titer of right and left GE/mL values will be calculated for each pig by the statistician using SAS program.
(648) Clinical Assessment Post-Vaccination
(649) All pigs were observed for clinical assessments post-vaccination by the Study Investigator or designees. Observations were conducted daily from D1 to D21 and then at least three times a week from D22 to D177. Observations were recorded on the Clinical Assessment Record form.
(650) PRRS Serology
(651) The serum samples collected at pre-purchase and on Days 0, 7, 14, 21, 28, 56, 84, 112, 140, 168, 179 (DPC 0), 182 (DPC 3), 186 (DPC 7), and 189 (DPC 10) and held at 2-8 C. were tested by BIVI-Ames for PRRS antibodies (Section 15.1). Results were reported as negative (ELISA S/P ratio of <0.4) or positive (ELISA S/P ratio of 0.4).
(652) Adverse Events
(653) No adverse events attributed to PRRS 94881 MLV were noted in this study.
(654) Statistical Methods
(655) Experimental Unit
(656) Treatment groups were housed in separate rooms in this study to avoid transmission of PRRSv to non-vaccinated groups. Therefore, room was the experimental unit. However, for the purposes of analyses, possible bias due to confounding room and treatment effects were ignored, and pig was used as the statistical unit.
(657) Randomization
(658) Fifty-six (56) pigs were randomly assigned to one of three groups. Randomization was performed by the BIVI. At the time of shipment Nos. 140 and 143 (challenge control group), as well as No. 168 (PRRS 94881 MLV group), were culled. Number 178 was randomly selected to replace No. 140, No. 177 was randomly selected to replace 143, and No. 179 was randomly selected to replace No. 168 from a pool of five extra pigs that met the inclusion criteria.
(659) Analysis
(660) Statistical analyses and data summaries were conducted by Dr. rer. hort. Martin Vanselow, Biometrie & Statistik, Zum Siemenshop 21, 30539 Hannover, Germany, +49(0) 511 606 777 650, m.vanselow@t-online.de. Data were analyzed assuming a completely random design structure. The statistical analyses were performed using SAS software release 8.2 or higher (SAS, 2001, Cary, USA/North Carolina, SAS Institute Inc.). PRRS 94881 MLV pig 179 and challenge control pigs 124 and 161 died before challenge and were excluded from post-challenge analyses. All tests on differences were designed as two-sided tests at =5%. The statistician's report is presented in Section 15.9.
(661) Gross Lung Lesion Scores
(662) The gross lung lesion score for each pig was calculated using the factors shown below in Table 8.10 multiplied by the % pathology for a specific lung lobe. Calculations were conducted using SAS program.
(663) TABLE-US-00067 TABLE 8.10 Factors for Calculating Gross Lung Lesion Scores Lung lobe Factor Left apical 0.05 Left cardiac 0.06 Left diaphragmatic 0.29 Right apical 0.11 Cardiac 0.10 Right diaphragmatic 0.34 Right accessory/intermediate 0.05
(664) Treatment groups were compared on differences using the Wilcoxon Mann-Whitney test.
(665) Histological Lung Lesion Scores
(666) Individual histological scores of the lung samples were accumulated per lobe and animal. This sum score was divided by the number of lobes examined per animal. The results were used as single values for the comparison between treatment groups. Treatment groups were tested on differences using the Wilcoxon Mann-Whitney test.
(667) Lung PRRS qPCR
(668) The quantitative PCR data (PRRS viral load [log.sub.10 GE/mL]) from lungs collected on D189 were used for comparisons between the treatment groups by the Wilcoxon Mann-Whitney test. The average (log.sub.10 GE/mL) of the left and right lung qPCR results were used for the evaluation. Prior to the calculations the analytical result not detected was replaced by log.sub.10 GE/mL of 0.0 and positive was replaced by 3.0.
(669) Frequency tables of positive qPCR results were generated. Differences between treatment groups were tested by Fisher's exact test.
(670) Serum PRRS qPCR
(671) The viremia data were evaluated separately for each day of investigation. Additionally, for viral load the areas under the individual response curves between D179 and D189 (AUC0-10) and between D182 and D189 (AUC3-10) were analyzed.
(672) The quantitative PCR data (PRRS viral load [log.sub.10 GE/mL]) were used for comparisons between the treatment groups by the Wilcoxon Mann-Whitney test. Prior to the calculations the analytical result not detected was replaced by a log.sub.10 GE/mL value of 0.0 and positive was replaced by 3.0. The treatment groups were tested on differences using the Wilcoxon Mann-Whitney test.
(673) Frequency tables of positive qPCR results were generated. Differences between treatment groups were tested by Fisher's exact test.
(674) Clinical Observations Post-Challenge
(675) Frequency tables of animals with at least one positive finding between D180 and D189 were generated. Total scores were the summation of respiration score+behavior score+cough score. Calculations were conducted using SAS program. Differences between treatment groups were tested by Fisher's exact test.
(676) The maximum scores and the mean scores per animal from D180 to D189 for respiration, behavior, coughing and for all three added together (total) were used for the statistical evaluation. Differences between treatment groups were tested by the Wilcoxon Mann-Whitney test.
(677) Body Weight and Average Daily Weight Gain
(678) Individual daily weight gains were calculated for the time period between D179 to D188. For each day of investigation and for the time period descriptive statistics were calculated. Differences between treatment groups were tested using analysis of variance and subsequent t-tests. Least squares means of the groups and differences between least squares means with 95% confidence intervals were calculated from the analysis of variance.
(679) Rectal Temperatures
(680) Differences between treatment groups with respect to the original temperature data were tested using analysis of variance and subsequent t-tests. Least squares means of the groups and differences between least squares means with 95% confidence intervals were calculated from the analysis of variance.
(681) Clinical Assessment Post-Vaccination
(682) Frequency tables of animals with at least one positive finding between D1 and D21 were generated. Differences between treatment groups were tested by Fisher's exact test.
(683) PRRS Serology
(684) Frequency tables of positive ELISA results were generated for each time point. Differences between treatment groups were tested by Fisher's exact test.
(685) Results
(686) Gross Lung Lesion Scores
(687) Median gross lung lesion scores on D189 (DPC 10) were 0.1% and 13.8% for the PRRS 94881 MLV-vaccinated group and challenge controls, respectively. The median gross lung lesion score for PRRS-vaccinated pigs was significantly lower than the median gross lung lesion score for the challenge controls (p<0.0001). The median gross lung lesion score for the negative control group was 0.0%.
(688) Number 123 (challenge control group) could not be scored for lung lesions on D189 due to diffuse pleuritis and adhesions. Moraxella osloensis, Staphylococcus warneri, Staphyloccous hyicus and Pseudomonas species were isolated from this pig's lung tissues post necropsy.
(689) A summary of group gross lung lesion scores and the associated p-value is shown below in Table 8.11.
(690) TABLE-US-00068 TABLE 8.11 Summary of Group Gross Lung Lesion Scores (%) on D 189 Group.sup.1 N.sup.3 Min. Max. Median 95% CI Q Range Mean p value 1 21 0.00 12.40 0.060 0.050 0.550 0.400 1.099 <0.0001 2 19.sup.2 0.06 69.20 13.800 2.690 22.650 20.850 15.842 3 12 0.00 0.59 0.000 0.000 0.110 0.085 0.093 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. .sup.2No. 123 was not scored due to diffuse pleuritis and adhesions due to bacterial infections. .sup.3One PRRS 94881 MLV pig and two challenge control pigs died pre-challenge and were not included in analysis. NI = Not included in statistical analysis
(691) Histological Lung Lesion Scores
(692) Median histological lung lesion scores were 6.0 and 19.5 for the PRRS 94881 MLV-vaccinated group and challenge controls, respectively. The median histological lung lesion score for the PRRS-vaccinated group was significantly lower than the median histological lung lesion score for challenge controls (p<0.0001). The median histological lung lesion score for the negative control group was 9.0.
(693) A summary of the group histological lung lesion scores and the associated p-value is shown below in Table 8.12.
(694) TABLE-US-00069 TABLE 8.12 Summary of Group Histological Lung Lesion Scores Group.sup.1 N.sup.2 Min. Max. Median 95% CI Q Range Mean p value 1 21 2 20 6.0 3.0 8.0 5.0 6.6 <0.0001 2 20 8 47 19.5 15.0 23.0 10.0 20.2 3 12 0 15 9.0 7.0 14.0 6.5 9.1 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. .sup.2One PRRS 94881 MLV pig and two challenge control pigs died pre-challenge and were not included in analysis. NI = Not included in statistical analysis
(695) Lung PRRS qPCR
(696) Median qPCR lung values from lung tissues were 3.69 and 6.25 log.sub.10 GE/mL for PRRS 94881 MLV-vaccinated pigs and challenge controls, respectively. The median qPCR value for PRRS 94881 MLV-vaccinated pigs was significantly lower than the median qPCR value for challenge controls (p<0.0001). No PRRSv RNA was detected in lung samples of any negative control pigs.
(697) A summary of group lung qPCR values and test result (p value) is below in Table 8.13.
(698) TABLE-US-00070 TABLE 8.13 Summary of Group Lung qPCR (mean log.sub.10 GE/mL) Values Group.sup.1 N.sup.2 Min. Max. Median 95% CI Q Range Mean p value 1 21 0.00 6.83 3.69 1.50 5.21 3.18 3.36 <0.0001 2 20 4.80 7.40 6.25 5.62 6.68 1.26 6.22 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. .sup.2One PRRS 94881 MLV pig and two challenge control pigs died pre-challenge and were not included in analysis. NI = Not included in statistical analysis
(699) PRRSv RNA was detected in lung tissues of 90% and 100% of PRRS 94881 MLV-vaccinated pigs and challenge control pigs, respectively. There was no statistical difference between the vaccinated group and challenge controls (p=0.4878).
(700) A summary of group frequency of PRRS qPCR positive lung tissues from pigs at necropsy is shown below in Table 8.14.
(701) TABLE-US-00071 TABLE 8.14 Group Frequency of PRRSv qPCR Positive Lung Tissues N % Pos- Total Group.sup.1 Positive itive 95% CI Number.sup.2 p value 1 19 90 69.6 98.8 21 0.4878 2 20 100 83.2 100.0 20 3 0 0 0.0 26.5 12 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. .sup.2One PRRS 94881 MLV pig and two challenge control pigs died pre-challenge and were not included in analysis. NI = Not included in statistical analysis
(702) Serum PRRS qPCR
(703) PRRSv RNA was not detected in the serum of any pigs on D0. Post-vaccination, PRRS 94881 MLV-vaccinated pigs had median values of 3.00, 0, 0, 3.00, 0, 0, 0, 0 and 0 log.sub.10 GE/mL on D7, D14, D21, D28, D56, D84, D112, D140 and D168 respectively. The values were significantly higher than challenge controls on D7, D14, D21 and D28 (p0.0013), as challenge controls did not have any PRRSv RNA detected until D182 (DPC 3).
(704) PRRSv RNA was not detected in the serum of any pigs on D179 (DPC 0). Post-challenge, PRRS 94881 MLV-vaccinated pigs had median values of 4.44, 0 and 0 log.sub.10 GE/mL on D182 (DPC 3), D186 (DPC 7), and D189 (DPC 10), respectively, compared with 5.88, 5.30 and 4.24 log.sub.10 GE/mL for challenge controls on the same days. Median values for the challenge controls were higher than the PRRS 94881 MLV group on all post-challenge days (p0.0001).
(705) No PRRSv RNA was detected in serum from any negative control pig during this study.
(706) The median AUC values for PRRS 94881 MLV-vaccinated pigs were 15.54 and 8.88 log.sub.10 GE/mL per day from DPC 0 to DPC 10 and from DPC 3 to DPC 10, respectively. In contrast, the median AUC values for challenge controls were 44.77 and 36.43 log.sub.10 GE/mL per day from DPC 0 to DPC 10 and from DPC 3 to DPC 10, respectively. Median values for the PRRS MLV group were significantly lower than median values for the challenge controls for both periods (p<0.0001).
(707) Summaries of serum PRRS qPCR data are shown below in Tables 8.15 and 8.16.
(708) TABLE-US-00072 TABLE 8.15 Summary of Serum PRRS qPCR Results (log.sub.10 GE/mL) from D 0 to D 168 Day Group.sup.1 N Min. Max. Median 95% CI QRange Mean p value 0 1 22 0.00 0.00 0.00 0.00 0.00 0.00 0.00 1.0000 2 22 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 7 1 21 3.00 4.63 3.00 3.00 3.00 0.00 3.23 <0.0001 2 22 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 14 1 21 0.00 3.00 0.00 0.00 3.00 3.00 1.43 0.0005 2 21 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 21 1 21 0.00 3.00 0.00 0.00 3.00 3.00 1.29 0.0013 2 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 28 1 21 0.00 3.88 3.00 0.00 3.00 3.00 1.93 <0.0001 2 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 56 1 21 0.00 3.00 0.00 0.00 0.00 0.00 0.57 0.1069 2 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 84 1 21 0.00 0.00 0.00 0.00 0.00 0.00 0.00 1.0000 2 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 112 1 21 0.00 0.00 0.00 0.00 0.00 0.00 0.00 1.0000 2 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 140 1 21 0.00 0.00 0.00 0.00 0.00 0.00 0.00 1.0000 2 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 168 1 21 0.00 0.00 0.00 0.00 0.00 0.00 0.00 1.0000 2 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. NI = Not included in statistical analysis
(709) TABLE-US-00073 TABLE 8.16 Summary of Serum PRRS qPCR Results (log.sub.10 GE/mL) from D 179 to D 189 Day Group.sup.1 N Min. Max. Median 95% CI QRange Mean p value 179 1 21 0.00 0.00 0.00 0.00 0.00 0.00 0.00 1.0000 (DPC 0) 2 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 182 1 21 3.00 5.58 4.44 3.93 5.28 1.51 4.42 <0.0001 (DPC 3) 2 20 5.09 6.33 5.88 5.75 6.00 0.32 5.81 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 186 1 21 0.00 3.74 0.00 0.00 0.00 0.00 0.61 <0.0001 (DPC 7) 2 20 3.66 6.57 5.30 4.86 5.69 1.08 5.30 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI 189 1 21 0.00 0.00 0.00 0.00 0.00 0.00 0.00 <0.0001 (DPC 10) 2 20 0.00 5.88 4.24 3.71 4.42 1.18 3.97 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI AUC 1 21 10.50 31.22 15.54 13.76 19.53 5.95 17.61 <0.0001 DPC 2 20 36.86 52.16 44.77 43.23 48.03 6.24 44.84 0-10 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI AUC 1 21 6.00 23.45 8.88 7.86 11.16 3.40 10.97 <0.0001 DPC 3- 2 20 27.77 43.02 36.43 34.60 38.53 5.23 36.12 DPC 10 3 12 0.00 0.00 0.00 0.00 0.00 0.00 0.00 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. NI = Not included in statistical analysis. AUC = Area under the curve; log.sub.10 GE/mL per day
(710) Post-vaccination, the PRRS 94881 MLV group had significantly higher proportions of qPCR positive pigs on D7, D14, D21 and D28 compared with the challenge control group. (p0.0013). No significant difference was detected between groups on D56 for the proportion of qPCR positive pigs (p=0.1069).
(711) On D182 (DPC 3), 100% of pigs in the PRRS 94881 MLV and challenge control groups were qPCR positive (no test conducted). On D186 (DPC 7) and D189 (DPC 10), the PRRS MLV group had significantly lower proportion of qPCR positive pigs compared with the challenge control group (<0.0001).
(712) Summaries of group proportions of qPCR positive data are shown below in Tables 8.17 and 8.18.
(713) TABLE-US-00074 TABLE 8.17 Summary of Group Proportion of Serum qPCR Positive Results Post-Vaccination N % Pos- Total Day Group .sup.1 Positive itive 95% CI Number p value 0 1 0 0 0.0 15.4 22 n.a. 2 0 0 0.0 15.4 22 3 0 0 0.0 26.5 12 NI 7 1 21 100 83.9 100.0 21 <0.0001 2 0 0 0.0 15.4 22 3 0 0 0.0 26.5 12 NI 14 1 10 48 25.7 70.2 21 0.0005 2 0 0 0.0 16.1 21 3 0 0 0.0 26.5 12 NI 21 1 9 43 21.8 66.0 21 0.0013 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 28 1 13 62 38.4 81.9 21 <0.0001 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 56 1 4 19 5.4 41.9 21 0.1069 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 84 1 0 0 0.0 16.1 21 n.a. 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 112 1 0 0 0.0 16.1 21 n.a. 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 140 1 0 0 0.0 16.1 21 n.a. 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 168 1 0 0 0.0 16.1 21 n.a. 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI .sup.1 Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group, n.a. = no test conducted; NI = Not included in statistical analysis
(714) TABLE-US-00075 TABLE 8.18 Summary of Group Proportion of Serum qPCR Positive Results Post-Challenge N % Pos- Total Day Group .sup.1 Positive itive 95% CI Number p value 179 1 0 0 0.0 16.1 21 n.a. (DPC 0) 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 182 1 21 100 83.9 100.0 21 n.a. (DPC 3) 2 20 100 83.2 100.0 20 3 0 0 0.0 26.5 12 NI 186 1 4 19 5.4 41.9 21 <0.0001 (DPC 7) 2 20 100 83.2 100.0 20 3 0 0 0.0 26.5 12 NI 189 1 0 0 0.0 16.1 21 <0.0001 (DPC 10) 2 19 95 75.1 99.9 20 3 0 0 0.0 26.5 12 NI .sup.1 Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group, n.a. = no test conducted; NI = Not included in statistical analysis
(715) Clinical Observations Post-Challenge
(716) Abnormal respiration was not observed in any PRRS 94881 MLV-vaccinated pigs after challenge, compared with onechallenge control pig (No. 149) which demonstrated a score of 1 on D185 (DPC 6). No difference was detected between groups for the percentage of pigs that demonstrated abnormal respiration for at least one day post-challenge (p=0.4878).
(717) Abnormal behavior and coughing were not observed post-challenge in any PRRS 94881 MLV-vaccinated pigs or in challenge control pigs.
(718) The percentages of pigs with total clinical scores>0 for at least one day post-challenge were 0% and 5% for the PRRS 94881 MLV-vaccinated group and the challenge control group, respectively. These values were not significantly different (p=0.4878).
(719) No clinical signs were observed in the negative control group from D179 to D189.
(720) A summary of group frequencies of pigs with at least one positive clinical observation score during the post-challenge period is shown below in Table 8.19.
(721) TABLE-US-00076 TABLE 8.19 Summary of Group Frequencies of Pigs with at least One Positive Clinical Observation Score Post-challenge N % Pos- Total Parameter Group.sup.1 Positive itive 95% CI Number.sup.2 p value Respira- 1 0 0 0.0 16.1 21 0.4878 tion 2 1 5 0.1 24.9 20 3 0 0 0.0 26.5 12 NI Behav- 1 0 0 0.0 16.1 21 NA ior 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI Cough- 1 0 0 0.0 16.1 21 NA ing 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI Total 1 0 0 0.0 16.1 21 0.4878 2 1 5 0.1 24.9 20 3 0 0 0.0 26.5 12 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. .sup.2One PRRS 94881 MLV pig and two challenge control pigs died pre-challenge and were not included in analysis. NI = Not included in statistical analysis; NA = test not applicable due to lack of variability
(722) There was no difference between groups for maximum respiration scores or maximum total scores post-challenge (p=0.4878).
(723) A summary of the group maximum clinical observation scores for the post-challenge period (DPC 1 through DPC 10) is shown below in Table 8.20.
(724) TABLE-US-00077 TABLE 8.20 Summary of Group Post-Challenge Maximum Clinical Scores Parameter Group.sup.1 N.sup.2 Min. Max. Median 95% CI QRange Mean p value Respira- 1 21 0 0 0 0 0 0 0.0 0.4878 tion 2 20 0 1 0 0 0 0 0.1 3 12 0 0 0 0 0 0 0.0 NI Behav- 1 21 0 0 0 0 0 0 0.0 1.0000 ior 2 20 0 0 0 0 0 0 0.0 3 12 0 0 0 0 0 0 0.0 NI Cough- 1 21 0 0 0 0 0 0 0.0 1.0000 ing 2 20 0 0 0 0 0 0 0.0 3 12 0 0 0 0 0 0 0.0 NI Total 1 21 0 0 0 0 0 0 0.0 0.4878 2 20 0 1 0 0 0 0 0.1 3 12 0 0 0 0 0 0 0.0 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. .sup.2One PRRS 94881 MLV pig and two challenge control pigs died pre-challenge and were not included in analysis. NI = Not included in statistical analysis
(725) Mean clinical observation scores followed a pattern similar to the percentage of pigs with positive clinical scores. There were no significant differences between the PRRS 94881 MLV-vaccinated group and the challenge control group (p0.4878).
(726) A summary of the group mean clinical observation scores for the post-challenge period (DPC 1 through DPC 10) is shown below in Table 8.21.
(727) TABLE-US-00078 TABLE 8.21 Summary of Group Post-Challenge Mean Clinical Scores Parameter Group.sup.1 N.sup.2 Min. Max. Median 95% CI QRange Mean p value Respira- 1 21 0.0 0.0 0.00 0.00 0.00 0.00 0.00 0.4878 tion 2 20 0.0 0.1 0.00 0.00 0.00 0.00 0.01 3 12 0.0 0.0 0.00 0.00 0.00 0.00 0.00 NI Behav- 1 21 0.0 0.0 0.00 0.00 0.00 0.00 0.00 1.0000 ior 2 20 0.0 0.0 0.00 0.00 0.00 0.00 0.00 3 12 0.0 0.0 0.00 0.00 0.00 0.00 0.00 NI Cough- 1 21 0.0 0.0 0.00 0.00 0.00 0.00 0.00 1.0000 ing 2 20 0.0 0.0 0.00 0.00 0.00 0.00 0.00 3 12 0.0 0.0 0.00 0.00 0.00 0.00 0.00 NI Total 1 21 0.0 0.0 0.00 0.00 0.00 0.00 0.00 0.4878 2 20 0.0 0.1 0.00 0.00 0.00 0.00 0.01 3 12 0.0 0.0 0.00 0.00 0.00 0.00 0.00 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. .sup.2One PRRS 94881 MLV pig and two challenge control pigs died pre-challenge and were not included in analysis. NI = Not included in statistical analysis
(728) Body Weight and Average Daily Weight Gain
(729) The difference between groups was not significant (p=0.2389). On D179 (DPC 0), mean and LS Mean body weights were 134.6 and 128.2 kg for the PRRS 94881 MLV group and the challenge control group, respectively. The difference was not significantly different (p=0.1090). On D188 (DPC 9), the mean and LS Mean body weights were 138.3 and 130.3 kg for the PRRS 94881 MLV group and the challenge control group, respectively. The body weight for the vaccinated group was significantly higher than the challenge control group on D188 (p=0.0455).
(730) LS Mean ADWGs for the challenge period (DPC 0 through DPC 9) were 0.4 and 0.2 kg/d for the PRRS 94881 MLV group and the challenge control group, respectively. These values were not significantly different (p=0.1041).
(731) Negative control pigs had mean body weights of 2.7, 117.2 and 120.0 kg on D0, D179 and D188, respectively. The ADWG for the negative control group from D179 to D188 was 0.5 kg/d.
(732) A summary of the group mean body weights on D0, D179 (DPC 0) and
(733) D188 (DPC 9) and ADWG from DPC 0 to DPC 9 are shown below in Table 8.22. A summary of LS Mean and statistical analysis of body weights and ADWG for the PRRS 94881 MLV group and the challenge control group is shown below in Table 8.23.
(734) TABLE-US-00079 TABLE 8.22 Summary of Group Body Weight and Average Daily Weight Gain (kg and kg/d) Day(s) Group.sup.1 N Min. Max. Median Mean SD 0 Body 1 22 2.8 5.4 4.00 3.96 0.730 Weights 2 22 2.4 4.8 3.75 3.72 0.547 3 12 2.7 4.5 3.60 3.71 0.552 D 179 1 21 108.5 155.0 136.60 134.57 12.737 Body 2 20 103.3 152.6 130.10 128.15 12.288 Weights 3 12 117.2 156.5 133.05 134.61 10.900 (DPC 0) D 188 1 21 112.2 157.8 141.50 138.28 12.879 Body 2 20 109.4 150.9 131.90 130.27 11.896 Weights 3 12 120.0 162.5 136.60 139.11 11.922 (DPC 9) ADWG 1 21 0.422 0.956 0.4111 0.4124 0.31653 DPC 0 to 2 20 0.589 0.844 0.2889 0.2350 0.36530 DPC 9 3 12 1.600 2.656 0.5111 0.5000 0.92391 .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group
(735) TABLE-US-00080 TABLE 8.23 Summary of Group LS Mean Body Weight and Daily Gain (kg and kg/d) Day(s) Group.sup.1 LS Mean 95% confidence interval p value 0 Body 1 3.96 3.674 4.241 0.2389 Weights 2 3.72 3.446 4.000 Diff. 1 2 0.23 0.162 0.631 D 179 1 134.57 129.040 140.093 0.1090 Body 2 128.15 122.487 133.813 Weights Diff. 1 2 6.42 1.496 14.329 (DPC 0) D 188 1 138.28 132.800 143.756 0.0455 Body 2 130.27 124.652 135.878 Weights Diff. 1 2 8.01 0.170 15.856 (DPC 9) ADWG 1 0.4124 0.26180 0.56297 0.1041 DPC 0 to 2 0.2350 0.08070 0.38930 DPC 9 Diff. 1 2 0.1774 0.03822 0.39299 .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group
(736) Rectal Temperatures
(737) Mean rectal temperature for the PRRS 94881 MLV group was 39.3 C. on the day of challenge (D179), and means ranged from 39.1 C. (D189, DPC 10) to 39.8 C. (D181, DPC 2) after challenge. Mean rectal temperature for the challenge control group was 39.1 C. on the day of challenge, and means ranged from 39.1 C. (D183, DPC 4) to 39.9 C. (D182, DPC 3) after challenge. Mean rectal temperatures for negative control group remained 39.3 C. throughout the same time period.
(738) A summary of group rectal temperatures is shown below in Table 8.24.
(739) TABLE-US-00081 TABLE 8.24 Summary of Group Rectal Temperature ( C.) Days D 179 (DPC 0) through D 189 (DPC 10) Day Group.sup.1 N.sup.2 Min. Max. Median Mean SD D 179 1 21 38.5 40.0 39.40 39.33 0.360 (DPC 0) 2 20 38.6 40.0 39.00 39.07 0.380 3 12 38.8 39.7 39.30 39.27 0.257 D 180 1 21 38.7 40.4 39.40 39.46 0.370 (DPC 1) 2 20 38.9 40.9 39.60 39.61 0.527 3 12 38.8 39.5 39.00 39.09 0.227 D 181 1 21 39.0 41.0 39.80 39.82 0.473 (DPC 2) 2 20 38.6 40.5 39.35 39.42 0.487 3 12 38.8 39.2 38.80 38.90 0.141 D 182 1 21 38.5 40.6 39.50 39.52 0.542 (DPC 3) 2 20 39.0 41.1 40.05 39.86 0.588 3 12 38.7 39.4 39.00 39.05 0.254 D 183 1 21 38.9 40.8 39.50 39.52 0.411 (DPC 4) 2 20 38.4 40.3 39.00 39.08 0.508 3 11 38.8 39.4 39.10 39.08 0.209 D 184 1 21 39.0 40.3 39.70 39.72 0.360 (DPC 5) 2 20 38.7 39.7 39.10 39.15 0.302 3 12 38.8 39.5 39.10 39.10 0.191 D 185 1 21 39.1 40.5 39.60 39.66 0.376 (DPC 6) 2 20 38.9 40.9 39.25 39.48 0.546 3 12 38.4 39.4 38.85 38.88 0.313 D 186 1 21 38.1 40.4 39.20 39.22 0.413 (DPC 7) 2 20 38.6 40.4 39.35 39.39 0.479 3 12 38.5 39.6 38.90 38.98 0.328 D 187 1 21 38.8 39.9 39.20 39.23 0.290 (DPC 8) 2 20 38.8 40.8 39.45 39.58 0.573 3 12 38.5 39.5 38.85 38.93 0.296 D 188 1 21 38.8 39.9 39.10 39.17 0.288 (DPC 9) 2 20 38.3 40.5 39.00 39.20 0.598 3 12 38.4 39.1 38.85 38.85 0.173 D 189 1 21 38.7 39.7 39.00 39.06 0.256 (DPC 10) 2 20 39.0 40.8 39.50 39.51 0.408 3 12 38.6 39.3 39.05 39.00 0.226 .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. .sup.2One PRRS 94881 MLV pig and two challenge control pigs died pre-challenge and were not included in analysis
(740) Least square Mean rectal temperatures were significantly higher for PRRS 94881 MLV-vaccinated pigs compared to challenge controls on DPC 0 (p=0.0281), DPC 2 (p=0.0095), DPC 4 (p=0.0034) and DPC 5 (p<0.0001). Least square Mean rectal temperatures were significantly lower for PRRS 94881 MLV-vaccinated pigs compared to challenge controls on DPC 8 (p=0.0183) and on DPC 10 (p=0.0001). No significant differences were detected between groups for the remaining days post-challenge (p0.0642). A summary of group LS Mean and statistical analysis of rectal temperature is shown below in Table 8.25.
(741) TABLE-US-00082 TABLE 8.25 Summary of Group LS Mean Rectal Temperature ( C.) D 179 (DPC 0) through D 189 (DPC 10) Day Group.sup.1 LSMean 95 % confidence interval p value D 179 1 39.33 39.170 39.496 0.0281 (DPC 0) 2 39.07 38.903 39.237 Diff. 1 2 0.26 0.030 0.497 D 180 1 39.46 39.257 39.657 0.3025 (DPC 1) 2 39.61 39.400 39.810 Diff. 1 2 0.15 0.434 0.138 D 181 1 39.82 39.612 40.036 0.0095 (DPC 2) 2 39.42 39.198 39.632 Diff. 1 2 0.41 0.105 0.712 D 182 1 39.52 39.274 39.773 0.0642 (DPC 3) 2 39.86 39.604 40.116 Diff. 1 2 0.34 0.693 0.021 D 183 1 39.52 39.320 39.727 0.0034 (DPC 4) 2 39.08 38.867 39.283 Diff. 1 2 0.45 0.158 0.740 D 184 1 39.72 39.572 39.866 <0.0001 (DPC 5) 2 39.15 38.999 39.301 Diff. 1 2 0.57 0.359 0.779 D 185 1 39.66 39.457 39.869 0.2164 (DPC 6) 2 39.48 39.269 39.691 Diff. 1 2 0.18 0.112 0.478 D 186 1 39.22 39.027 39.421 0.2408 (DPC 7) 2 39.39 39.188 39.592 Diff. 1 2 0.17 0.448 0.116 D 187 1 39.23 39.034 39.432 0.0183 (DPC 8) 2 39.58 39.376 39.784 Diff. 1 2 0.35 0.631 0.062 D 188 1 39.17 38.966 39.377 0.8454 (DPC 9) 2 39.20 38.989 39.411 Diff. 1 2 0.03 0.323 0.266 D 189 1 39.06 38.908 39.207 0.0001 (DPC 2 39.51 39.352 39.658 10) Diff. 1 2 0.45 0.662 0.234 .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group
(742) Three of 21 (14%) PRRS 94881 MLV vaccinated pigs and 5 of 20 (25%) challenge controls had a rectal temperature40.5 C. for at least one day post-challenge. No difference was detected between groups for the proportion of pigs that exhibited a rectal temperature40.5 C. for at least one day post-challenge (p=0.4537). A summary of group proportion of pigs with pyrexia 40.5 C.) for at least one day post-challenge is shown below in Table 8.26.
(743) TABLE-US-00083 TABLE 8.26 Summary of Group Proportion of Pyrexia (40.5 C.) for at Least One Day Post-Challenge N % Pos- Total Day Group.sup.1 Positive itive 95% CI Number.sup.2 p value D 180 1 3 14 3.0 36.3 21 0.4537 (DPC 1) 2 5 25 8.7 49.1 20 to D 189 3 0 0 0.0 26.5 12 NI (DPC 10) .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. .sup.2One PRRS 94881 MLV pig and two challenge control pigs died pre-challenge and were not included in analysis. NI = Not included in statistical analysis
(744) Clinical Assessment Post-Vaccination
(745) Four of 22 (18%) PRRS 94881 MLV pigs, 8 of 22 (36%) challenge control pigs and 2 of 12 (17%) negative control pigs exhibited an abnormal clinical assessment for at least one day from D1 to D21. There was no significant difference between groups for this parameter (p=0.3102).
(746) A summary of group percentage of pigs with at least one abnormal clinical assessment from D1 through D21 is shown below in Table 8.27.
(747) TABLE-US-00084 TABLE 8.27 Summary of Group Percentage of Pigs with At Least One Abnormal Clinical Assessments from D 1-D 21 Total Group.sup.1 N Positive % Positive 95% CI Number p value 1 4 18 5.2 40.3 22 0.3102 2 8 36 17.2 59.3 22 3 2 17 2.1 48.4 12 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. NI = Not included in statistical analysis
(748) Overall, 7 PRRS 94881 MLV pigs exhibited an abnormal clinical assessment for at least one day between D1 to D177:
(749) Pig 121 exhibited belly swelling from D61 to D146, a swollen sheath from D147 to D167, belly swelling on D168, a swollen sheath from D169-172 and belly swelling from 173 to 177. Pig 141 was thin from D4-D10, was depressed from D4-D6 and rough hair coat on D5. Pig 144 exhibited coughing on D26. Pig 146 exhibited swelling on the sternum on D82. Pig 147 was weak on legs from D84-D86 and was shaking on D84. Pig 154 was thin from D4-D6. Pig 179 was thin from D2-D5, exhibited rough hair coat on D5 and was found dead on D6. Thirteen pigs in the challenge control group exhibited an abnormal clinical assessment for at least one day from D1 to D177: Pig 124 exhibited shaking and tremors on D20 and was found dead on D21. Pig 134 exhibited a swollen sheath from D46-D68, belly swelling from D69-D143, an umbilical hernia on D144, and belly swelling from D145 to D177. Pig 137 exhibited a swollen sheath from D108-D143. Pig 138 exhibited a swollen sheath from D115-D143. Pig 148 exhibited lameness or a swollen leg from D16-20 and coughing on D35. Pig 149 was thin from D5-D9 and on D12, and exhibited rough hair coat from D12-D15. Pig 150 was thin from D4-D9 and on D13, exhibited poor body condition from D10-D12, and was depressed on D11. Pig 161 was thin from D4-D9, exhibited rough hair coat and central nervous system signs on D9 and was found dead on D10. Pig 167 exhibited a swollen sheath from D117-D143. Pig 170 was thin from D4-D7 and exhibited depression on D7. Pig 172 exhibited a sore or a swollen dew claw from D120-D143. Pig 177 exhibited depression on D19 and swelling on the neck from D156-D159. Pig 178 exhibited depression on D5, from D17-20, and from D28-D36, was lame and/or swollen leg from D15-D47, was thin from D16-D18, and was stiff on legs from D39-D47. Six pigs in the negative control exhibited an abnormal clinical assessment for at least one day from D1 to D177. Pig 120 exhibited coughing from D5-7 and on D12. Pig 126 was thin from D2-18, exhibited depression from D4-D5, on D10, and from D17-D19, rough hair coat on D5, and labored respiration from D18-D22. Pig 132 exhibited an abscess from D49-D56. Pig 145 exhibited a swollen sheath from D37-D43 and from D46 to D74, and a sore on the sheath from D75-D83 and from D85 to D87. Pig 151 exhibited lameness and/or a swollen leg from D78-D83 and on D85. Pig 155 exhibited an abscess on D69-D77.
(750) Three mortalities occurred prior to challenge. Pig 179 (PRRS 94881 MLV, D6): Necropsy revealed minimal lesions (thin, poor body condition). Laboratory testing showed mild macrophagic interstitial pneumonia. Immunohistochemistry was negative for PRRS. Intestinal samples were autolyzed but did not show evidence of severe necrosis or severe inflammation. Smooth Escherichia coli and Enterococcus spp were isolated (Section 15.9). Pig 124 (Challenge control, D21): No gross lesions were identified at necropsy. Laboratory testing revealed severe suppurative to pyogranulomatous meningoencephalitis with suppurative perivasculitis. Marked pulmonary and hepatic congestion were also evident. The diagnosis was Streptococcus suis associated meningoencephalitis. Pig 161 (Challenge control, D10): Necropsy revealed minimal lesions (thin, poor body condition). Bordetella bronchiseptica, Streptococcus alpha hemolytic and Staphylococcus auricularis were isolated from lung tissues.
(751) PRRS Serology
(752) All pigs were PRRS ELISA negative on D0 and D7. By D14, 90% of PRRS 94881 MLV-vaccinated pigs had positive PRRS ELISA titers. This number increased to 95% on D21 and was 100%, 100%, 100%, 90%, 100% and 95% on D28, D56, D84, D112, D140 and D168, respectively. None of the challenge control pigs developed PRRS antibody titers during the vaccination phase of this study, and from D14 through D168, a significantly higher percentage of PRRS 94881 MLV-vaccinated pigs had positive PRRS antibody titers compared to challenge controls (p<0.0001).
(753) During the challenge phase of the study, the percentages of PRRS 94881 MLV-vaccinated pigs with positive PRRS ELISA titers were 95%, 95%, 100% and 100% on DPC 0, DPC 3, DPC 7 and DPC10, respectively. In contrast, challenge control pigs did not develop PRRS antibody titers until DPC 7, when 30% had titers. This increased to 80% on DPC 10. The PRRS 94881 MLV-vaccinated pigs had higher percentages of animals with positive PRRS antibody titers throughout the challenge phase of the study (p0.0478).
(754) Pigs in the negative control group were PRRS ELISA seronegative throughout the study with the exception of two pigs on D112. Numbers 116 and 120 were PRRS ELISA seropositive on D112.
(755) A summary of group percentages of pigs with positive PRRS-antibody titers before challenge is shown below in Table 8.28. Data from the challenge portion of the study are shown below in Table 8.29.
(756) TABLE-US-00085 TABLE 8.27 Summary of Group Frequency of Pigs with Positive PRRS-Antibody Titer by Day, Days 0-168 N % Pos- Total Day Group.sup.1 Positive itive 95% CI Number p value 0 1 0 0 0.0 15.4 22 NA 2 0 0 0.0 15.4 22 3 0 0 0.0 26.5 12 NI 7 1 0 0 0.0 16.1 21 NA 2 0 0 0.0 15.4 22 3 0 0 0.0 26.5 12 NI 14 1 19 90 69.6 98.8 21 <0.0001 2 0 0 0.0 16.1 21 3 0 0 0.0 26.5 12 NI 21 1 20 95 76.2 99.9 21 <0.0001 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 28 1 21 100 83.9 100.0 21 <0.0001 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 56 1 21 100 83.9 100.0 21 <0.0001 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 84 1 21 100 83.9 100.0 21 <0.0001 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 112 1 19 90 69.6 98.8 21 <0.0001 2 0 0 0.0 16.8 20 3 2 17 2.1 48.4 12 NI 140 1 21 100 83.9 100.0 21 <0.0001 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI 168 1 20 95 76.2 99.9 21 <0.0001 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. NI = Not included in statistical analysis. NA = Not applicable, no analysis conducted
(757) TABLE-US-00086 TABLE 8.29 Summary of Group Frequency of Pigs with Positive PRRS-Antibody Titer by Day, DPC 0 through DPC 10 N % Pos- Total Day Group.sup.1 Positive itive 95% CI Number p value D 179 1 20 95 76.2 99.9 21 <0.0001 (DPC 0) 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI D 182 1 20 95 76.2 99.9 21 <0.0001 (DPC 3) 2 0 0 0.0 16.8 20 3 0 0 0.0 26.5 12 NI D 186 1 21 100 83.9 100.0 21 <0.0001 (DPC 7) 2 6 30 11.9 54.3 20 3 0 0 0.0 26.5 12 NI D 189 1 21 100 83.9 100.0 21 0.0478 (DPC 10) 2 16 80 56.3 94.3 20 3 0 0 0.0 26.5 12 NI .sup.1Group 1 = PRRS 94881 MLV vaccine; Group 2 = Challenge control group; Group 3 = Negative control group. NI = Not included in statistical analysis.
(758) Discussion/Conclusion
(759) To achieve the study objective, twenty-two (22) healthy, PRRS susceptible and seronegative pigs were inoculated IM with 1 mL of PRRS 94881 MLV at approximately 14 days of age. Thirty-four (22 pigschallenge control group and 12 pigsnegative control group) PRRS susceptible and seronegative pigs were inoculated IM with 1 mL of control product at approximately 14 days of age.
(760) Validation of the Study and Challenge Model
(761) Pigs in the negative control group remained negative for PRRSv (viremia; qPCR) throughout the study. Two pigs (Nos. 116 and 120) in the negative control group had positive ELISA titers on D112, while all other ELISA results for this group were negative. Considering that no viremia was detected in these pigs or in the group as whole; likewise, all other serum samples were ELISA negative, the results for these two pigs on D112 were considered false positives possibly due to an unassignable lab error. Thus, this was a valid study. Unrelated to the establishment of a valid study, the negative control group had a median histological lung lesion score of 9.0 on D189 in contrast to a median gross lesion score of 0.0%. These data highlight that pigs housed under normal swine husbandry conditions for an extended period of time develop minor lung lesions that are inconsequential and not related to specific pathogens.
(762) Following inoculation with European PRRS isolate 205817 by the method described earlier, the challenge control group exhibited a mean ADWG from DPC 0 to DPC 9 of 0.2 kg/day (a mean ADWG of 0.5 kg/day for the negative control group), a median gross lung lesion score of 13.8% (0.0% for the negative control group), a median histological lung lesion score of 19.5 (9.0 for the negative control group) and a median value of 6.25 log.sub.10 GE/mL for the detection of PRRSv RNA in lung tissue (median of 0.0 log.sub.10 GE/mL for negative control group). These results highlight that PRRS-specific clinical disease was induced in the challenge control group, thus validating this challenge model as an adequate clinical laboratory tool to evaluate PRRS vaccine efficacy and more specifically, 26 week duration of immunity of PRRS 94881 MLV.
(763) Determination of 26 Week Duration of Immunity of PRRS 94881 MLV
(764) Determination of DOI for PRRS 94881 MLV of 26 weeks post-vaccination was based upon the vaccine group exhibiting a significant reduction (p0.05) in post-challenge lung lesions (gross or histological) compared with the challenge control group.
(765) Gross and histological lung lesions were selected as the primary parameter for determination of 26 week DOI because this parameter provides the most clinically relevant and convincing evidence of efficacy when evaluating a new vaccine within the PRRS respiratory challenge model in pigs. Lung lesion development is one of the hallmarks of PRRS respiratory disease in pigs and can be considered the source for all subsequent manifestations of secondary PRRSv disease characteristics such as clinical signs, pyrexia, decreased ADWG, etc.
(766) The PRRS 94881 MLV group exhibited a significant reduction in gross lung pathology post-challenge, as evidenced by a median gross lung lesion score of 0.1% in comparison to the challenge control group, which exhibited a median gross lung lesion score of 13.8% (p<0.0001). In addition, the PRRS 94881 MLV group exhibited a significant reduction in histological lung lesion scores, as evidenced by a median histology lung lesion score of 6.0 for the PRRS 94881 MLV group compared with a median histology lung lesion score of 19.5 for the challenge control group (p<0.0001). Thus, DOI of 26 weeks for PRRS 94881 MLV at dosage of 110.sup.4.27 TCID.sub.50 was established based upon the primary parameter of a significant reduction for lung lesions post-challenge. This result was achieved with a vaccine dose slightly lower than the targeted minimum immunizing dose of 110.sup.4.5 TCID.sub.50/mL. One challenge control pig (No. 123) could not be scored for gross lung lesions because of pleuritis and adhesions due to bacterial infections, but was scored for histological lung lesions. The omission of this pig from the challenge control group's gross lung lesion score analysis did not affect the outcome of this study.
(767) Viremia post-challenge was selected as the most important secondary parameter because it represents the level of viral replication and persistence occurring within the host animal upon exposure. A significant reduction (p0.05) in viremia would correspond with a PRRS vaccine that induces adequate immunity to limit PRRS pathogenesis within the host. At 3, 7 and 10 days post-challenge, the PRRS 94881 MLV-vaccinated group demonstrated a significant reduction in viremia (qPCR) compared with the challenge control group (p<0.0001). To further evaluate post-challenge viremia between groups, the quantity of the viral load over a specific duration of time post-challenge was calculated, as represented as area under curve or AUC. The PRRS 94881 MLV-vaccinated group had a median AUC value from DPC 0 to DPC 10 of 15.54 log.sub.10 GE/mL/day; while the challenge control group had a median AUC value of 44.77 log.sub.10 GE/mL/day (p<0.0001). In addition, the PRRS 94881 MLV-vaccinated group had a median AUC value from DPC 3 to DPC 10 of 8.88 log.sub.10 GE/mL/day; while the challenge control group had a median AUC value for this period of 36.43 log.sub.10 GE/mL/day (p<0.0001). Whether viremia was examined at specific time points post-challenge or over the course of the post-challenge period, PRRS 94881 MLV administered 26 weeks prior to challenge with a virulent heterologous European strain of PRRS significantly (p0.05) reduced viremia after challenge inoculation.
(768) In association with a reduction of PRRS viremia post-challenge, a significant (p0.05) reduction in the viral load in lung tissue would also be of great importance from the standpoint of PRRS vaccine immunity. A reduction of viral load in the lung tissue may be associated with reduced viral stability, replication and persistence within the host and may secondarily lead to reduced shedding of PRRSv to other pigs. In this study, lung tissues from the PRRS 94881 MLV group had a median lung qPCR result of 3.69 log.sub.10 GE/mL 10 days post challenge (DPC 10) while the challenge control group had a median lung qPCR result of 6.25 log.sub.10 GE/mL. The difference between the vaccine group and the challenge control group was significant (p<0.0001), thus further supporting duration of immunity of 26 weeks.
(769) A marked reduction in severity and frequency of clinical signs post-challenge in pigs would also be supportive of PRRS vaccine efficacy and establishment of DOI of 26 weeks for PRRS 94881 MLV. Only one pig exhibited clinical signs following challenge: pig 149 (challenge control) had a respiratory score of 1 (panting/rapid respiration) on D185. No pigs in the PRRS 94881 MLV-vaccinated group exhibited clinical signs during the post-challenge phase of this study and there were no statistical differences between the vaccinated and challenge control groups (p=0.4878 or no test conducted). Clinical signs post-challenge were not strong enough in this study to assess the DOI.
(770) Pyrexia between groups varied post-challenge. PRRS 94881 MLV-vaccinated pigs exhibited significantly lower LS Mean rectal temperatures on two days (DPC 8 and DPC 10; (p0.0183) and higher LS Mean rectal temperatures on four days (DPC 0, DPC 2, DPC 4 and DPC 5; p0.0281) compared with challenge control pigs. Otherwise, no significant differences were detected between groups post-challenge (p0.0642). Although statistical differences between groups were detected post-challenge, these differences were not biologically meaningful, considering that mean rectal temperatures remained 39.9 C. (challenge control group, D182) for all groups. No difference was detected between groups with respect to the proportion of pigs with pyrexia for at least one day post-challenge (p=0.4537).
(771) The presence of significant viremia, lung pathology and viral load in lung tissues due to PRRS in the challenge control group resulted in a significant (p0.05) difference between groups for body weight on DPC 9. In this study, the vaccinated and challenge control groups had LS mean body weights on DPC 9 of 138.3 kg and 130.3 kg, respectively (p=0.0455). The LS mean ADWG from DPC 0 to DPC 9 were 0.4 kg/day and 0.2 kg/day, for vaccinated and challenge groups, respectively. This difference was not statistically significant (p=0.1041).
(772) Post-Vaccination Parameters Examined in this Study
(773) Three pigs were found dead during the vaccination phase of this study. Pig 179 (PRRS 94881 MLV-vaccinated) was found dead on D6 associated with smooth Escherichia coli and Enterococcus spp. infections. Pig 161 (challenge control group) was found dead on D10 associated with Bordetella bronchiseptica, Streptococcus alpha hemolytic and Staphylococcus auricularis infections. Pig 124 (challenge control group) was found dead on D21 associated with a Streptococcus suis infection that lead to meningoencephalitis. To control and prevent any more deaths, pigs were mass treated with injectable vitamins and antibiotics. Following treatments, no more deaths occurred. Since deaths occurred in both treatment groups it can be assumed that the IVP itself was not associated with infections. More likely, pigs arrived at the research facility harboring these infections. Data for these pigs were included when available. Gross and histological lung lesion scores from these pigs were omitted from lung lesion analyses since these pigs died before challenge administration. The loss of onePRRS 94881 MLV pig and twochallenge control pig during the extended time period from vaccination to challenge did not affect the outcome of the study.
(774) No abnormal clinical assessments related to PRRS 94881 MLV vaccination or control product were observed in pigs following inoculation on D0. Seven pigs in the PRRS 94881 MLV-vaccinated group had abnormal assessments post-vaccination; while thirteen challenge control pigs had abnormal assessments. Excluding the three pigs that died due to bacterial infections, these abnormal assessments included thinness, coughing, swellings, rough hair coat, depression, abscesses and poor body condition at various time points, none of which lasted an extended period of time. In the author's opinion, these findings were not related to the administration of either experimental product, but rather are typical findings in growing/maturing pigs, under group housing situations, over an extended period of time.
(775) All pigs were PRRS ELISA serology negative on D0, thus confirming that all pigs met the inclusion criterion of being PRRS sero-negative upon entry into the study. The majority of pigs (90%) receiving PRRS 94881 MLV sero-converted to PRRS by D14 and all PRRS-vaccinated pigs were seropositive by D28. Conversely, the challenge control pigs remained seronegative until 7 days post-challenge, when this group began to demonstrate PRRS seroconversion. As covered earlier, twonegative control pigs were PRRS ELISA seropositive on D112, which was considered an incidental finding, possible due to an unassignable lab error.
(776) At 7, 14, 21 and 28 days post-vaccination, the PRRS 94881 MLV-vaccinated group exhibited median qPCR results of 3.00, 0, 0 and 3.00 log.sub.10 GE/mL, respectively. These results highlight that within 4 weeks post-vaccination, a dosage of 110.sup.4.27 TCID.sub.50 of PRRS 94881 MLV induced sufficient replication of the MLV that is often required to build protective immunity already at 4 weeks after vaccination. Conversely, the challenge control group was negative for PRRS viremia until three days post-challenge.
CONCLUSION
(777) A significant reduction (p0.05) of gross and histological lung lesions at necropsy, viral load in lung tissues at necropsy and viremia post-challenge for the PRRS 94881 MLV group compared to challenge control group demonstrated vaccine efficacy against virulent PRRSv when vaccinated at 2 weeks of age and challenged 26 weeks post-vaccination. The results of this study therefore support the demonstration of duration of immunity of 26 weeks post-vaccination with PRRS 94881 MLV. These results were achieved with a vaccine dose of 110.sup.4.27 TCID.sub.50/mL, which was slightly lower than the minimum immunizing dose (110.sup.4.5 TCID.sub.50/mL).
(778) The sequences of the PRRSV 94881 attenuated strain and the parental strain are as follow:
(779) TABLE-US-00087 SEQIDNO:1:FULLLENGTHNUCLEOTIDESEQUENCEOFPRRSMasterSeed Virusof94881 1 TTTGTGTACCTTGGAGGCGTGGGTACAGCCCTGCCCCACCCTTTGGTCCCTGTTCTAGCC 61 CGACAAGTACCCTTCTCTCTCGGGGCGAGCGCGCCGCCTGCTGCTCCCTTGCGGCGGGAA 121 GGACCTCCCGAGTATTTCCGGAGAGCACCTGCTTTACGGGATCTCCGCCCTTTAACCATG 181 TCTGGGATGTTCTCCCGGTGCATGTGCACCCCGGCTGCCCGGGTATTTTGGAACGCCGGC 241 CAAGTCTATTGCACACGGTGTCTCAGTGCACGGTCTCTTCTCTCTCCAGAACTTCAGGAC 301 ACGGACCTCGGTGCAGTTGGCTTGTTTCACAAGCCTAAAGACAAGCTCCATTGGAAAGTT 361 CCCATTGGTATCCCCCAGGTGGAATGTTCTCCATCTGGGTGTTGCTGGCTGTCAACCATT 421 TTTCCTTTAGCGCGCATGACCTCCGGCAATCACAACTTCCTTCAACGACTCGTGAAGGTT 481 GCTGATGTATTGTACCGTGACGGTTGCTTAACCCCTAGACACCTCCGTGAACTCCAAGTT 541 TACGAGCGTGGTTGCAATTGGTATCCGATTACGGGGCCTGTGCCTGGGATGGCTGTGTAC 601 GCGAACTCCATGCACGTGTCCGACCAACCGTTCCCTGGTGCCACTCATGTGTTAACAAAT 661 TCCCCTTTGCCTCAACGGGCTTGTCGGCAGCCGTTCTGTCCGTTCGAAGAGGCCCATTCT 721 AGCATATACAGGTGGGAAAAATTTGTAATTTTTATGGATTCCTCCTCCGACGGTCGATCT 781 CGCATGATGTGGACTCCGGAATCCGATGACTCCACGGCTTTGGAAGTTCTGCCGCCCGAG 841 CTAGAACACCAGGTCAAGGTCCTTGTTCGGAGCTTTCCCGCCCATCACCTTGTCGACCTT 901 GCCGATTGGGAGCTCACTGAGTCCCCTGATAACGGTTTTTCCTTCAGCACGTCACATCCT 961 TGCGGCTACCTTGTTCGGGACCCGGCTGTATCCGAAGGCAAGTGTTGGCTTTCCTGCTTT 1021 TTGAGCCAGTCAGCCGAAGTGCTCAGTCGCGAGGCGCATCTGGCTACCGCCTATGGTTAC 1081 CAAACCAAGTGGGGTGTGCCTGGCAAGTACATCCAGCGCAGACTTCAAGTTCACGGTCTC 1141 CGTGCTGTGGTCGACCCTGATGGTCCCATTCACGTTGAAGCATTGTCTTGCCCCCAGTCT 1201 TGGATCAGGCACTTGACCCTGAATGATGATGTCACCCCGGGATTCGTTCGCCTAATGTCT 1261 CTTCGCATTGTGCCGAACACAGAGCCTACCACACACCGGATCTTTCGTTTTGGAGTGCAC 1321 AAGTGGTATGGTGCCGCCGGCAAACGGGCCCGTGGCAAGCGTGCCGCCAAAAGTGAGAAA 1381 GACTCGGCTTCCACCCTCAAGGTTGCCCGACCGACTTCCACCAGTGGAATCGTCACCTAC 1441 TCCCCACCTGCGGACGGGTCTTGTGGTTGGCATGCCCTTGCCGCCATACTGAACCGGATG 1501 ATTAATAATGACTTCACGTCCCCTCTGCCTCGGTACAACAGGCCGGAGGACGATTGGGCT 1561 TCTGATGGTGACCTTGCTCAGGCCATTCAATGTTTGCAACTACCTGCCGCCATAGCTCGG 1621 AACCGCGCCTGCCCTAACGCCAAATACCTCATAAAACTCAACGGAGTTCATTGGGAGGTA 1681 GAGGTGAGGCCTGGAATGGCTCCTCGCTCCCTCTCTCGTGAGTGCGTTGTTGGCGTCTGC 1741 TCTGAAGGCTGTGTCGCGTCGCCTTACCCGGAGGACGGGTTGCCTAAACGTGCACTTGAG 1801 GCCCTGGCGTCTGCTTATAGACTGCCTTCAGACTGTGTTTGTGATGGTATTATTGACTTC 1861 CTTGCCAATCCACCTCCCCAGGAGTTCTGGACTCTTGACAAAATGTTGACTTCCCCGTCA 1921 CCGGAGCAGTCCGGCTTCTCTAGTCTGTATAAATTGTTGTTAGAGATCTTGCCGCAGAAA 1981 TGCGGATCCACAGAAGGGGAATTCATCTATACTGTTGAGAGGATGTTGAAGGATTGTCCG 2041 AGCTCCAAACAGGCCATGGCCCTCCTTGCAAAAATTAAGGTCCCATCCTCAAAGGCCCCA 2101 TCCGTGACTCTGAACGAGTGCTTCCCCACGGATGTTCCAGTCAACTCTGAGTTAATATCT 2161 TGGGAAGAGCCCAAAGACCCTGGCGCTGCTGTTGTCCTATGTCCATCGGATGCAAAAGAA 2221 TCTAAGGAAACAGCCCCTGAAGAAGCTCAAGCGAGAAACCGTAAGGTCCTTCACCCTGTG 2281 GTCCTTACCGAGGAACTTAGCGAGCAACAGGTGCAGGTGGTTGAGGGTGATCAGGATATG 2341 CCACTGGATTTGACTTGGCCAACCTTAACCGCTACGGCGACCCCTGTTAGAGGGCCGGTA 2401 CCGGACAATTTGAGCTCTGGCATTGGTGCCCAGCCCGCTACCGTTCAAGAACTCATTCTG 2461 GCGAGGCCTGCACCCCGTCTTGTTGAGCGCTGTGGCACGGAGTCGAACGGCAGCAGTTCA 2521 TTTCTGGATTTGCCTGACGTGCAGACCTCGGACCAGCCTTTAGACCTGTCCCTGGCCGCG 2581 TGGCCTGTAAGGGCTACCGCGTCTGACCCCGGTTGGATCCACGGTAGGCGTGAGCCTGTC 2641 TTTGTGAAGCCTCGAGGTGTTTTCTCTGATGGCGAGTCGGCCCTTCAGTTCGGAGAGCTT 2701 TCCGAAGCCAGTTCTGTCGTCGATGACCGGACAAAAGAAGCTCCGGTGGTTGACGCCCCC 2761 ATCGATTTGACAACTTCGAACGAGACGCTCTCTGGGTCTGACCCCTTTGAATTCGCCAAA 2821 TTCAGGCGCCCGCGTTTCTCCGCGCAAGCTTTAATCGACCGAGGTGGTCCGCTTGCCGAT 2881 GTTCATGCAAAGATAAAGAGTCGGGTATATGAACAATGCCTTCAAGCTTGTGAACCTGGT 2941 AGTCGTGCGACCCCAGCCACCAAGAAGTGGCTCGACAAAATGTGGGACAGGGTGGACATG 3001 AAAACTTGGCGCTGCACCTCGCAGTTCCAAGCTGGTCACATTCTTGAGTCCCTCAAATTC 3061 CTCCCTGACATGATTCAAGACACACCGCCTCCTGTTCCCAGGAAGAACCGAGCTGGTGAC 3121 AGTGCCGGCCTGAAGCAACTGGTGGCGCAGTGGGATAGGAAATCGAGTGTGACACCCCCC 3181 ACAAAACCGGTTGGACCGGTGCTTGACCAGGCCGTCCCTCTGCCTATGGACATCCAGCAA 3241 GGAGATGCCATCTCCGCTGACAAGCCACCCCATTCGCAAAACCCTTCTAGTCAAGTAGAT 3301 GTGGGTGGAGGTTGGAAAAGTTTTATGCTCTCCGGCACCCGTTTCGCGGGGTCCGTTAGT 3361 CAGCGCCTTACGACATGGGTTTTTGAGGTTCTCTCCCATCTCCCAGCTTTTATGCTCACA 3421 CTTTTCTCGCCACGGGGCTCTATGGCTCCAGGTGATTGGCTGTTTGCAGGTGCTGTTCTA 3481 CTTGCTCTCCTGCTCTGCCGTTCTTACCCAATACTCGGATGCCTTCCCTTATTGGGTGTC 3541 TTTTCTGGTTCTGTGCGGTGTGTTCGTTTGGGTGTTTTTGGTTCTTGGATGGCTTTTGCT 3601 GTATTTTTATTCTCGACTCCACCCGACCCAGTCGGTTCTTCTTGTGACCACGATTCGCCG 3661 GAGTGTCATGCTGAGCTTTTGGCTCTTGAGCAGCGCCAACTTTGGGAACCTGTGCGCAGC 3721 CTTGTGGTCGGGCCATCGGGCCTCTTATGCGTCATTCTTGGCAAGTTACTCGGTGGGTCA 3781 CGTTGTCTCTGGTTTGTTCTCCTACGTATATGCATGCTCGCAGATTTGGCAATTTCTCTT 3841 ATTTATGTGGTGTCCCAAGGGCGTTGTCACAAGTGTTGGGGAAAGTGTATAAGGACGGCT 3901 CCTGCAGAAGTGGCCCTTAATGTGTTTCCTTTTTCGCGCGCCACCCGCTCATCTCTTGTG 3961 TCCTTGTGTGATCGGTTCCAAGCGCCAAAAGGAGTTGACCCCGTGCACTTGGCGACAGGC 4021 TGGCGCGGGTGCTGGTGTGGTGAGAGCCCTATTCATCAATCACACCAAAAACCGATAGCT 4081 TATGCCAACTTGGATGAAAAGAAGATATCCGCCCAGACGGTGATTGCTGTCCCGTATGAT 4141 CCTAGTCAGGCCATTAAATGCCTGAAAGTTTTGCAGGCAGGAGGGGCTATTGTGGACCAG 4201 CCTACGCCCGAGGTCGTCCGTGTGTCTGAGATTCCCTTCTCGGCCCCATTTTTTCCGAAG 4261 GTCCCAGTCAACCCAGACTGCAGGGTTGTGGTAGATTCGGACACTTTTGTGGCTGCGGTC 4321 CGCTGCGGTTATTCGACAGCACAACTGGTCCTTGGTCGGGGCAACTTTGCCAAGCTAAAT 4381 CAGACCCCCCTCAGGAACTCTGTCCCCACCAAAACAACTGGTGGGGCCTCATACACCCTT 4441 GCCGTGGCCCAGGTATCTGTGTGGACTCTTGTTCATTTCATCCTCGGCCTTTGGTTAACG 4501 TCACCTCAAGTGTGTGGTCGAGGGACCTCTGACCCGTGGTGTTCGAACCCTTTTTCGTAT 4561 CCTACTTATGGCCCCGGAGTTGTGTGTTCCTCTCGACTCTGCGTGTCTGCCGACGGAGTT 4621 ACCCTGCCATTGTTCTCAGCCGTTGCCCATCTTTCCGGTAGAGAGGTGGGGATTTTTATT 4681 TTGGTGCTTGCCTCCTTGGGCGCTTTAGCCCACCGCTTGGCTCTTAAGGCAGACATGTCA 4741 ATGGTCTTTTTGGCGTTTTGTGCTTACGCCTGGCCCATGAGCTCCTGGTTAATTTGCTTC 4801 TTTCCTATGCTCTTGAGGTGGGTAACCCTTCATCCTCTCACTATGCTTTGGGTGCACTCA 4861 TTTTTGGTGTTTTGCCTACCAGCTGCCGGCGTTCTCTCGCTGGGAATAACCGGTCTTCTT 4921 TGGGCAGTTGGCCGTTTCACCCAGGTTGCCGGAATTATCACACCTTATGACATCCACCAG 4981 TATACCTCCGGACCACGTGGTGCAGCTGCTGTAGCAACGGCTCCAGAAGGTACTTACATG 5041 GCGGCCGTTCGGAGAGCCGCTTTGACTGGACGGACTTTGATCTTCACACCATCTGCAGTC 5101 GGATCCCTTCTTGAAGGTGCTTTCAGAACTCAAAAGCCCTGCCTTAACACCGTGAATGTC 5161 GTAGGCTCTTCCCTTGGTTCTGGAGGAGTTTTCACCATTGATGGCAGAAGAGTCATCGTC 5221 ACTGCCACCCATGTGTTGAATGGTAACACAGCCAGGGTCACTGGTGATTCCTACAACCGC 5281 ATGCACACGTTCAATACTAATGGTGATTATGCCTGGTCCCATGCTGATGACTGGCAAGGC 5341 GTTGCCCCTATGGTTAAGATCGCTAAGGGGTATCGCGGTCGTGCCTACTGGCAAACGTCA 5401 ACCGGAGTCGAACCTGGCATCATGGGGGAAGGATTCGCCTTCTGTTTCACTAACTGTGGC 5461 GACTCAGGGTCACCTGTCATTTCAGAAGCTGGTGACCTTATTGGAGTCCATACCGGTTCA 5521 AACAAACTCGGTTCTGGTCTTGTGACAACCCCTGAAGGGGAGACCTGCTCCATCAAGGAA 5581 ACTAGGCTCTCTGACCTTTCTAGACATTTTGCAGGTCCAAGCGTCCCTCTTGGGGACATT 5641 AAGTTGAGCCCAGCCATCATCCCTGATGTGACAACTATTCCGAGTGACTTGGCATCGCTC 5701 CTTGCTTCTGTCCCCGTGATGGAAGGTGGCCTCTCAACTGTCCAGCTTTTGTGCGTCTTT 5761 TTCCTTCTCTGGCGCATGATGGGCCATGCCTGGACACCCATTGTTGCCGTAGGCTTCTTT 5821 TTGCTGAATGAAATTCTCCCAGCAGTCTTGGTCCGAGCTGTGTTCTCTTTTGCACTCTTT 5881 GTACTTGCATGGGCCACCCCCTGGTCGGCACAAGTGTTGATGATTAGACTCCTCACGGCG 5941 GCTCTCAACCGCAACAGGTTGTCCCTGGCGTTCTACGCATTCGGAGGTGTCGTTGGCCTG 6001 GCCACAGAAATCGGGACTTTTGCTGGTGGATGGCCTGAACTGTCCCAAGCCCTCTCGACA 6061 TACTGCTTCCTGCCCAGGTTCCTTGCTGTGACTAGTTATGTCCCCACCATCATCATCGGT 6121 GGGCTCCATGCCCTCGGCGTAATTTTGTGGTTATTCAAATACCGATGCCTCCACAACATG 6181 CTGGTTGGTGATGGGAGTTTCTCAAGCGCTTTCTTCCTACGGTATTTTGCTGAGGGTAAT 6241 CTTAGGAAAGGCGTGTCGCAGTCCTGTGGCATGAATAACGAATCCCTGACAGCTGCTTTG 6301 GCTTGCAAGTTGTCGCAAGCTGACCTTGATTTTTTGTCCAGTTTAACGAACTTCAAGTGC 6361 TTTGTGTCCGCTTCAAACATGAAAAATGCAGCTGGCCAATACATCGAGGCGGCGTATGCT 6421 AGAGCTCTGCGTCAGGAGCTGGCCTCCTTGGTTCAGGTTGACAAGATGAAAGGAGTATTG 6481 GCCAAGCTCGAGGCTTTCGCTGAGACGGCCACTCCGTCACTTGACACAGGGGACGTGATT 6541 GTTCTGCTTGGGCAACACCCCCATGGATCCATCCTCGACATTAATGTGGGGGGTGAAAGG 6601 AAAACTGTGTCTGTGCAAGAAACACGATGCCTGGGTGGTTCCAAATTCAGTGTCTGCACT 6661 GTCGTGTCCAACACGCCCGTGGATACCTTGACCGGTATCCCACTTCAGACGCCAACCCCA 6721 CTTTTTGAAAATGGCCCGCGCCATCGCAGCGAGGACGACGACCTCAAAGTTGAGAGAATG 6781 AAAAAACACTGTGTATCCCTCGGCTTCCACAAAATCAATGGTAAAGTTTACTGCAAAATT 6841 TGGGACAAGTCTAACGGCGACACCTTTTACACGGATGATTCCCGATACACTCAAGACCAT 6901 GCTTTTCAGGACAGGTCAACCGACTATAGAGACAGGGATTATGAAGGTGTACAGACCGCC 6961 CCCCAACAGGGATTCGATCCAAAGTCCGAAGCCCCTGTTGGCACTGTTGTAATCGGTGGC 7021 ATTACGTATAACAGGCATCTGGTCAAAGGTAAGGAGGTCCTAGTTCCCAAACCTGACAAC 7081 TGCCTTGAAGCTGCCAGACTGTCCCTTGAGCAAGCTCTTGCTGGGATGGGCCAAACTTGT 7141 GACCTTACAGCTACCGAAGTGGAGAAACTAAAGCGCATCATTAGTCAACTCCAAGGTCTG 7201 ACCACTGAACAGGCTTTAAACTGCTAGCCGCCAGCGGCTTGACCCGCTGTGGCCGCGGCG 7261 GCCTAGTTGTAACTGAAACGGCGGTAAAAATCGTAAAATACCACAGCAGAACTTTCACCT 7321 TAGGCTCTTTAGACCTAAAAGTCACCTCCGAGGTGGAGGTGAAGAAATCAACTGAGCAGG 7381 GGCACGCTGTCGTGGCGAACTTATGTTCCGGTGTCGTCTTGATGAGGCCTCACCCACCGT 7441 CCCTTGTTGACGTTCTCCTCAAACCCGGACTTGACACAACACCCGGCATTCAACCAGGGC 7501 ATGGGGCCGGGAATATGGGCGTGAACGGTTCTATTTGGGATTTTGAAACTGCACCCACAA 7561 AGGTAGAACTAGAGTTGTCCAAGCAAATAATCCAAGCATGTGAAGTCAGGCGCGGGGACG 7621 CCCCTAACCTCCAACTCCCCTACAAGCTTTATCCTGTCAGGGGGGACCCCGAGCGGCGTA 7681 AAGGTCGCCTTGTCAACACTAGGTTTGGAGATTTACCTTACAAAACTCCCCAAGACACCA 7741 AGTCCGCAATTCATGCGGCTTGTTGCCTGCATCCCAATGGGGTCCTCGTGTCTGATGGCA 7801 AATCCACGCTGGGTACCACTCTTCAACATGGTTTCGAGCTTTATGTCCCCACTGTACCTT 7861 ATAGTGTCATGGAATACCTTGATTCACGCCCTGACACCCCTTTTATGTGTACTAAACATG 7921 GCACTTCCAAGGCTGCTGCAGAGGACCTCCAAAAATATGACCTATCCACTCAAGGGTTTG 7981 TCTTGCCTGGGGTCCTACGCCTAGTGCGCAGGTTCATCTTTAGCCATGTTGGTAAGGCGC 8041 CACCACTGTTCCTTCCATCAACCTACCCTGCCAAGAACTCCATGGCAGGGGTCAATGGCC 8101 AGAGGTTCCCAACAAAGGATGTCCAGAGCATACCTGAAATTGATGAAATGTGCGCCCGTG 8161 CCGTCAAGGAAAATTGGCAGACTGTGACACCTTGCACCCTCAAAAAACAGTACTGTTCCA 8221 AACCTAAAACTAGAACCATCCTAGGTACCAACAACTTCATAGCCTTGGCTCACAGGTCAG 8281 CACTCAGTGGTGTCACCCAGGCGTTCATGAAGAAGGCCTGGAAGTCCCCAATTGCCTTGG 8341 GGAAAAACAAGTTTAAGGAATTGCATTGCACTGTCGCCGGCAGATGCCTTGAGGCTGACC 8401 TGGCTTCCTGCGATCGCAGCACCCCCGCCATTGTGAGGTGGTTTGTTGCCAACCTCCTGT 8461 ATGAACTTGCAGGATGTGAAGAGTACTTGCCTAGCTACGTGCTCAACTGTTGCCATGACC 8521 TTGTGGCAACGCAGGATGGCGCTTTCACAAAACGCGGTGGCCTGTCGTCCGGGGACCCCG 8581 TCACCAGTGTGTCCAACACCGTCTACTCACTGATAATTTACGCCCAGCACATGGTGCTTT 8641 CGGCCTTGAAGATGGGTCATGAAATTGGTCTCAAGTTCCTTGAGGAACAGCTCAAATTTG 8701 AGGACCTTCTTGAAATCCAGCCCATGTTAGTGTATTCTGATGACCTCGTCTTGTATGCGG 8761 AAAGACCCACTTTTCCCAACTACCATTGGTGGGTCGAGCATCTTGACCTGATGTTGGGCT 8821 TTAAAACGGACCCAAAGAAAACTGTCATAACTGATAAACCCAGTTTTCTCGGCTGCAGAA 8881 TTGAAGCAGGACGGCAGTTAGTCCCCAATCGCGACCGTATTCTGGCTGCTCTTGCATATC 8941 ATATGAAGGCGCAGAACGCCTCAGAGTATTATGCGTCCGCTGCCGCAATTCTGATGGATT 9001 CGTGTGCTTGCATTGACCATGACCCCGAGTGGTATGAGGATCTTATCTGCGGCATCGCCC 9061 GGTGTGCTCGCCAGGACGGTTACCGTTTTCCAGGCCCGGCATTTTTCATGTCCATGTGGG 9121 AGAAGCTGAAAAGTCATAATGAAGGGAAGAAATGCCGTCACTGCGGCATCTGCGACGCCA 9181 AAGCCGACTATGCGTCCGCCTGTGGACTTGATTTGTGTTTGTTCCATTCACACTTTCATC 9241 AACACTGCCCAGTCACTCTGAGCTGTGGCCACCATGCCGGTTCAAAGGAATGTTCGCAGT 9301 GTCAGTCACCTGTCGGGGCTGGCAAATCCCCCCTTGACGCTGTGCTGAAACAAATCCCGT 9361 ACAAACCTCCTCGTACCATTATCATGAAGGTGGACAACAAAACAACGACCCTTGACCCGG 9421 GAAGATATCAGTCCCGTCGAGGTCTTGTTGCAGTCAAAAGAGGTATTGCAGGTAATGAGG 9481 TTGATCTTTCTGATGGAGACTACCAAGTGGTGCCTCTTTTGCCGACTTGCAAAGACATAA 9541 ACATGGTGAAGGTGGCTTGCAACGTACTACTCAGCAAGTTTATAGTAGGGCCGCCAGGTT 9601 CCGGAAAAACCACCTGGCTACTGAACCAAGTCCAGGACGATGATGTCATTTACACACCTA 9661 CTCATCAGACAATGTTTGACATAGTCAGTGCTCTTAAAGTTTGCAGGTATTCCATCCCAG 9721 GAGCCTCAGGACTCCCTTTTCCACCACCTGCCAGGTCCGGGCCGTGGGTTAGGCTCATCG 9781 CCAGCGGACATGTCCCTGGCCGAGTGTCATATCTCGATGAGGCAGGATATTGCAATCATC 9841 TAGACATTCTAAGGCTGCTTTCCAAAACACCCCTTGTGTGTTTGGGTGACCTTCAGCAAC 9901 TTCACCCGGTCGGCTTTGATTCCTATTGTTATGTGTTCGATCAGATGCCTCAGAAGCAGC 9961 TGACCACCATTTATAGATTTGGCCCTAACATCTGTGCAGCCATCCAGCCTTGTTACAGGG 10021 AGAAACTTGAATCCAAGGCCAGGAACACCAGAGTGGTTTTCACCACCCGGCCTGTGGCCT 10081 TTGGTCAGGTCCTGACACCGTACCACAAAGATCGTACCGGCTCTGCAATAACTATAGATT 10141 CATCCCAGGGGGCGACCTTCGACATTGTGACATTGCATCTACCATCGCCAAAGTCCCTAA 10201 ACAAATCCCGAGCACTTGTAGCCATCACTCGGGCAAGACATGGGTTGTTCATTTATGACC 10261 CTCATGACCAACTCCAGGAGTTTTTCAACTTAACCCCCGAGCGCACTGATTGTAACCTTG 10321 CGTTCAGCCGTGGGGATGAGCTGGTTGTTTTGAATGTGGATAATGCGGTCACAACTGTAG 10381 CGAAGGCCCTAGAGACAGGTTCACCCCGATTTCGAGTATCGGACCCGAGGTGCAAGTCTC 10441 TCTTAGCCGCTTGTTCGGCCAGTCTAGAAGGGAGCTGCATGCCACTACCACAAGTAGCAC 10501 ATAACCTGGGGTTTTACTTTTCCCCGGACAGCCCAGCTTTTGCACCCCTGCCAAAAGAGC 10561 TGGCGCCACATTGGCCAGTGGTCACCCACCAGAATAATCGAGCGTGGCCTGATCGACTTG 10621 TCGCTAGTATGCGCCCAATTGATGCCCGCTACAGCAAGCCAATGGTCGGTGCAGGGTATG 10681 TGGTCGGGCCATCCATTTTTCTTGGCACTCCTGGTGTGGTGTCATACTATCTCACATTAT 10741 ACATCGGGGGCGAGCCTCAGGCCCTGCCAGAAACACTCGTTTCAACAGGACGTATAGCCA 10801 CAGATTGTCGGGAATATCTCGACGCGGCTGAGGAAGAGGCAGCGAGAGAACTTCCCCACG 10861 CATTTATTGGCGATGTCAAAGGCACTACGATCGGGGGGTGTCACCACATTACATCGAAAT 10921 ACCTACCTAGGTCCCTGCCTAAAGACTCTGTTGCTGTGGTTGGGGTGAGTTCGCCCGGTA 10981 GGGCTGCTAAAGCCGTGTGCACTCTCACCGATGTGTACCTCCCCGAACTCCGACCATATT 11041 TGCAACCGGAGACGGCATCAAAATGCTGGAAACTTAAACTGGATTTCAGGGATGTTCGAC 11101 TGATGGTCTGGAAAGGCGCCACAGCCTATTTCCAGTTGGAAGGGCTGACATGGTCAGCGC 11161 TGCCCGATTATGCTAGGTTCATTCAGCTACCCAAGGATGCCGTTGTGTACATCGATCCGT 11221 GTATAGGGCCGGCAACAGCCAATCGCAAGGTTGTGCGAACCACAGACTGGCGGGCCGACC 11281 TGGCAGTGACACCGTATGATTACGGTGCTCAGGTCATTTTGACAACAGCCTGGTTCGAGG 11341 ACCTTGGGCCGCAGTGGAAGATTTTGGGGTTGCAGCCTTTCAGACGAACATTTGGCTTTG 11401 AGAACACTGAAGATTGGGCAATTCTCGCACGCCGTATGAATGACGGCAAAGATTACACTG 11461 ACTATAATTGGCATTGTGTACGAGAACGCCCACACGCAATTTACGGGCGCGCCCGTGACC 11521 ATACGTATCATTTTGCCCTTGGCACTGAACTGCAAGTAGAGCTGGGCAGACCCCGGCTGC 11581 CTCCTGAGCAAGTGCCGTGAACGCGGAGTGATGCAATGGGTTTACTGTGGAGTAAAATCA 11641 GTCAGTTGTTCGTGGATGCCTTCACTGAGTTCCTTGTTAGTGTGGTTGACATTGTCATCT 11701 TTCTCGCCATATTGTTTGGGTTCACTGTTGCAGGCTGGTTATTGGTCTTCCTTCTCAGAG 11761 TGGTTTGCTCCGCGTTTCTCCGTTCGCGCTCTGCCATTCACTCTTCCGAACTATCGAAGG 11821 TCCTATGAGGGCTTGCTACCCAACTGCAGACCGGATGTCCCACAATTCGCAGTTAAGCAC 11881 CCGTTGGGTATACTTTGGCATATGCGAGTCTCCCACCTAATTGACGAAATGGTCTCTCGC 11941 CGCATTTACCGGACCATGGAACATTCGGGTCAAGCGGCCTGGAAGCAGGTTGTTAGTGAA 12001 GCCACTCTCACAAAACTGTCAAGGCTTGACGTAGTCACTCATTTCCAACACCTGGCCGCA 12061 GTGGAGGCTGATTCTTGCCGCTTCCTTAGCTCACGACTCGCGATGCTGAAAAACCTTGCC 12121 GTTGGCAATGTGAGCCTGGAGTACAACACTACTTTGGACCGCGTTGAGCTCATCTTTCCC 12181 ACACCAGGTACGAGGCCCAAGTTGACCGATTTTAGGCAATGGCTTATCAGCGTGCACGCT 12241 TCCATCTTCTCCTCTGTGGCTTCGTCTGTTACCTTGTTCACAGTGCTTTGGCTTCGAATT 12301 CCAGCTCTACGCTATGTTTTTGGTTTCCATTGGCCCACGGCAACACATCATTCGAACTAA 12361 CTATCAATTACACTATATGTAAGCCATGCCCTACCAGTCAAGCTGCCCAACAAAGACTCG 12421 AGCCTGGCCGTAACGTGTGGTGCAAAATAGGGCACGACAGGTGTGAGGAACGTGACCATG 12481 ATGAGTTGTCAATGTCCATTCCGTCCGGGTACGACAACCTCAAACTTGAGGGTTATTATG 12541 CTTGGCTGGCTTTTTTGTCCTTTTCCTACGCGGCCCAATTCCATCCGGAGCTGTTCGGAA 12601 TAGGAAACGTGTCGCGCGTCTTTGTGGATAAGCGACACCAGTTCATTTGCGCCGAGCATG 12661 ATGGACAAAATTCAACCATATCTGCCAGACACAACATCTCCGCGTCGTATGCGGTGTATT 12721 ACCATCATCAAATAGACGGGGGCAATTGGTTTCATTTGGAATGGCTGCGACCATTCTTTT 12781 CCTCCTGGCTGGTGCTCAACATCTCATGGTTTCTGAGGCGTTCGCCTGCAAGCCCTGCTT 12841 CTCGACGCATCTATCAGATATTAAGACCAACACGACCGCGGCTGCCGGTTTCATGGTCCT 12901 TCAGAACATCAATTGTTTCCAATCTCACAGGGCCTCAACAGCGCAAGGTACCACTCCCCT 12961 CAGGAGGTCGTCCCAATGTCGTGAAGCCGTCGGCATTCCCCAGTACATCACGATAACGGC 13021 TAATGTGACCGATGAATCGTATTTGTACAACGCGGACTTGCTGATGCTTTCCGCGTGCCT 13081 TTTCTACGCCTCGGAAATGAGCGAGAAAGGCTTCAAAGTCATCTTTGGGAATATTTCTGG 13141 CGTTGTTTCCGCTTGTGTTAATTTCACAGATTATGTGGCCCATGTGACCCAACACACTCA 13201 GCAGCACCATTTGGTAATTGATCACATTCGGTTACTACACTTCTTGACACCGTCTACGAT 13261 GAGGTGGGCTACAACCATTGCTTGTTTGCTTGCCATTCTTTTGGCGGTATGAAATGTTCT 13321 TGCAAGTTGGGGCATTTCTTGACTCCTCACTCTTGCTTCTGGTGGCTTTTTTTGCTGTGT 13381 ACCGGCTTGTCTTGGTCCTTTGTCGATGGCAACGACGACAGCTCGACATCCCAATACATA 13441 TATAATTTGACGATATGCGAGCTGAATGGGACCGAATGGTTGTCCGGTCATTTTGATTGG 13501 GCAGTCGAAACCTTTGTGCTTTACCCAGTTGCCACTCATATCATTTCACTGGGTTTTCTC 13561 ACAACAAGCCATTTCCTTGATGCGCTCGGTCTCGGCGCTGTGTCCGCCACAGGATTCATT 13621 GGCGAGCGGTATGTACTTAGCAGCATGTACGGCGTTTGCGCCTTCGCGGCGTTCGTATGT 13681 TTTGTCATCCGTGCTGCTAAAAATTGCATGGCTTGCCGCTATGCCCGCACCCGGTTTACC 13741 AACTTCATCGTGGACGACCGGGGAAGAATCCATCGATGGAAGTCTTCAATAGTGGTGGAG 13801 AAATTGGGCAAAGCTGAAGTCGGTGGTGACCTTGTCAACATTAAGCATGTTGTCCTCGAA 13861 GGGGTTAAAGCTCAACCTTTGACGAGGACTTCGGCTGAGCAATGGGAAGCCTAGACGACT 13921 TTTGCAACGATCCCACCGCCGCACAAAAACTCGTGCTGGCCTTTAGCATCACATATACAC 13981 CCATAATGATATACGCCCTTAAGGTGTCACGCGGCCGACTCCTGGGGCTGTTGCACATCT 14041 TGATATTTCTGAATTGTTCCTTTACTTTTGGGTACATGACATATGTGCATTTTCAATCCA 14101 CCAACCGTGTCGCATTCACTCTGGGGGCTGTAGTCGCCCTTTTGTGGGGTGTTTACAGCC 14161 TCACAGAGTCATGGAAGTTCATCACTTCCAGATGCAGATTGTGTTGCCTAGGCCGGCGAT 14221 ACATTCTGGCCCCTGCCCATCACGTAGAAAGTGCTGCAGGCCTCCATTCAATCCCAGCGT 14281 CTGGTAACCGAGCATACGCTGTGAGAAAGCCCGGACTAACATCAGTGAACGGCACTCTAG 14341 TACCTGGGCTTCGGAGCCTCGTGCTGGGCGGCAAACGAGCTGTTAAACGAGGAGTGGTTA 14401 ACCTCGTCAAGTATGGCCGGTAAGAACCAGAGCCAGAAGAAAAGAAGAAATGCAGCTCCG 14461 ATGGGGAAAGGCCAGCCAGTCAATCAACTGTGCCAGTTGCTGGGTACAATGATAAAGTCC 14521 CAGCGCCAGCAATCTAGGGGAGGACAGGCCAAAAAGAAGAAGCCTGAGAAGCCACATTTT 14581 CCCCTAGCTGCTGAAGATGACATTCGGCACCATCTCACCCAGGCCGAACGTTCCCTCTGC 14641 TTGCAATCGATCCAGACGGCTTTCAATCAAGGCGCAGGAACTGCGTCGCTTTCATCCAGC 14701 GGGAAGGTCAGTTTCCAGGTTGAGTTCATGCTGCCGGTTGCTCATACAGTGCGCCTGATT 14761 CGCGTGACTTCTACATCCGCCAGTCAGGGTGCAAATTAATTTGACAGTCAGGTGAATGGC 14821 CGCGATTGACGTGTGGCCTCTAA SEQIDNO:2:ORF1aOF94881MSVENCODEDBYSEQUENCEOFSEQIDNO:1 BETWEENNUCLEOTIDES178...7227 MSGMFSRCMCTPAARVFWNAGQVYCTRCLSARSLLSPELQDTDLGAVGLFHKPKDK LHWKVPIGIPQVECSPSGCCWLSTIFPLARMTSGNHNFLQRLVKVADVLYRDGCLTPR HLRELQVYERGCNWYPITGPVPGMAVYANSMHVSDQPFPGATHVLTNSPLPQRACR QPFCPFEEAHSSIYRWEKFVIFMDSSSDGRSRMMWTPESDDSTALEVLPPELEHQVK VLVRSFPAHHLVDLADWELTESPDNGFSFSTSHPCGYLVRDPAVSEGKCWLSCFLSQ SAEVLSREAHLATAYGYQTKWGVPGKYIQRRLQVHGLRAVVDPDGPIHVEALSCPQS WIRHLTLNDDVTPGFVRLMSLRIVPNTEPTTHRIFRFGVHKWYGAAGKRARGKRAAKS EKDSASTLKVARPTSTSGIVTYSPPADGSCGWHALAAILNRMINNDFTSPLPRYNRPED DWASDGDLAQAIQCLQLPAAIARNRACPNAKYLIKLNGVHWEVEVRPGMAPRSLSRE CVVGVCSEGCVASPYPEDGLPKRALEALASAYRLPSDCVCDGIIDFLANPPPQEFWTL DKMLTSPSPEQSGFSSLYKLLLEILPQKCGSTEGEFIYTVERMLKDCPSSKQAMALLAK IKVPSSKAPSVTLNECFPTDVPVNSELISWEEPKDPGAAVVLCPSDAKESKETAPEEAQ ARNRKVLHPVVLTEELSEQQVQVVEGDQDMPLDLTWPTLTATATPVRGPVPDNLSSGI GAQPATVQELILARPAPRLVERCGTESNGSSSFLDLPDVQTSDQPLDLSLAAWPVRAT ASDPGWIHGRREPVFVKPRGVFSDGESALQFGELSEASSVVDDRTKEAPVVDAPIDLT TSNETLSGSDPFEFAKFRRPRFSAQALIDRGGPLADVHAKIKSRVYEQCLQACEPGSR ATPATKKWLDKMWDRVDMKTWRCTSQFQAGHILESLKFLPDMIQDTPPPVPRKNRAG DSAGLKQLVAQWDRKSSVTPPTKPVGPVLDQAVPLPMDIQQGDAISADKPPHSQNPS SQVDVGGGWKSFMLSGTRFAGSVSQRLTTWVFEVLSHLPAFMLTLFSPRGSMAPGD WLFAGAVLLALLLCRSYPILGCLPLLGVFSGSVRCVRLGVFGSWMAFAVFLFSTPPDP VGSSCDHDSPECHAELLALEQRQLWEPVRSLVVGPSGLLCVILGKLLGGSRCLWFVLL RICMLADLAISLIYVVSQGRCHKCWGKCIRTAPAEVALNVFPFSRATRSSLVSLCDRFQ APKGVDPVHLATGWRGCWCGESPIHQSHQKPIAYANLDEKKISAQTVIAVPYDPSQAI KCLKVLQAGGAIVDQPTPEVVRVSEIPFSAPFFPKVPVNPDCRVVVDSDTFVAAVRCG YSTAQLVLGRGNFAKLNQTPLRNSVPTKTTGGASYTLAVAQVSVWTLVHFILGLWLTS PQVCGRGTSDPWCSNPFSYPTYGPGVVCSSRLCVSADGVTLPLFSAVAHLSGREVGI FILVLASLGALAHRLALKADMSMVFLAFCAYAWPMSSWLICFFPMLLRWVTLHPLTML WVHSFLVFCLPAAGVLSLGITGLLWAVGRFTQVAGIITPYDIHQYTSGPRGAAAVATAP EGTYMAAVRRAALTGRTLIFTPSAVGSLLEGAFRTQKPCLNTVNVVGSSLGSGGVFTID GRRVIVTATHVLNGNTARVTGDSYNRMHTFNTNGDYAWSHADDWQGVAPMVKIAKG YRGRAYWQTSTGVEPGIMGEGFAFCFTNCGDSGSPVISEAGDLIGVHTGSNKLGSGL VTTPEGETCSIKETRLSDLSRHFAGPSVPLGDIKLSPAIIPDVTTIPSDLASLLASVPVME GGLSTVQLLCVFFLLWRMMGHAWTPIVAVGFFLLNEILPAVLVRAVFSFALFVLAWATP WSAQVLMIRLLTAALNRNRLSLAFYAFGGVVGLATEIGTFAGGWPELSQALSTYCFLP RFLAVTSYVPTIIIGGLHALGVILWLFKYRCLHNMLVGDGSFSSAFFLRYFAEGNLRKGV SQSCGMNNESLTAALACKLSQADLDFLSSLTNFKCFVSASNMKNAAGQYIEAAYARAL RQELASLVQVDKMKGVLAKLEAFAETATPSLDTGDVIVLLGQHPHGSILDINVGGERKT VSVQETRCLGGSKFSVCTVVSNTPVDTLTGIPLQTPTPLFENGPRHRSEDDDLKVERM KKHCVSLGFHKINGKVYCKIWDKSNGDTFYTDDSRYTQDHAFQDRSTDYRDRDYEGV QTAPQQGFDPKSEAPVGTVVIGGITYNRHLVKGKEVLVPKPDNCLEAARLSLEQALAG MGQTCDLTATEVEKLKRIISQLQGLTTEQALNC SEQIDNO:3ORF1BOF94881MSVENCODEDBYSEQUENCEOFSEQIDNO:1 BETWEENNUCLEOTIDES7209...11600 TGFKLLAASGLTRCGRGGLVVTETAVKIVKYHSRTFTLGSLDLKVTSEVEVKKSTEQGH AVVANLCSGVVLMRPHPPSLVDVLLKPGLDTTPGIQPGHGAGNMGVNGSIWDFETAP TKVELELSKQIIQACEVRRGDAPNLQLPYKLYPVRGDPERRKGRLVNTRFGDLPYKTP QDTKSAIHAACCLHPNGVLVSDGKSTLGTTLQHGFELYVPTVPYSVMEYLDSRPDTPF MCTKHGTSKAAAEDLQKYDLSTQGFVLPGVLRLVRRFIFSHVGKAPPLFLPSTYPAKN SMAGVNGQRFPTKDVQSIPEIDEMCARAVKENWQTVTPCTLKKQYCSKPKTRTILGTN NFIALAHRSALSGVTQAFMKKAWKSPIALGKNKFKELHCTVAGRCLEADLASCDRSTP AIVRWFVANLLYELAGCEEYLPSYVLNCCHDLVATQDGAFTKRGGLSSGDPVTSVSNT VYSLIIYAQHMVLSALKMGHEIGLKFLEEQLKFEDLLEIQPMLVYSDDLVLYAERPTFPN YHWWVEHLDLMLGFKTDPKKTVITDKPSFLGCRIEAGRQLVPNRDRILAALAYHMKAQ NASEYYASAAAILMDSCACIDHDPEWYEDLICGIARCARQDGYRFPGPAFFMSMWEKL KSHNEGKKCRHCGICDAKADYASACGLDLCLFHSHFHQHCPVTLSCGHHAGSKECSQ CQSPVGAGKSPLDAVLKQIPYKPPRTIIMKVDNKTTTLDPGRYQSRRGLVAVKRGIAGN EVDLSDGDYQVVPLLPTCKDINMVKVACNVLLSKFIVGPPGSGKTTWLLNQVQDDDVI YTPTHQTMFDIVSALKVCRYSIPGASGLPFPPPARSGPWVRLIASGHVPGRVSYLDEA GYCNHLDILRLLSKTPLVCLGDLQQLHPVGFDSYCYVFDQMPQKQLTTIYRFGPNICAA IQPCYREKLESKARNTRVVFTTRPVAFGQVLTPYHKDRTGSAITIDSSQGATFDIVTLHL PSPKSLNKSRALVAITRARHGLFIYDPHDQLQEFFNLTPERTDCNLAFSRGDELVVLNV DNAVTTVAKALETGSPRFRVSDPRCKSLLAACSASLEGSCMPLPQVAHNLGFYFSPDS PAFAPLPKELAPHWPVVTHQNNRAWPDRLVASMRPIDARYSKPMVGAGYVVGPSIFL GTPGVVSYYLTLYIGGEPQALPETLVSTGRIATDCREYLDAAEEEAARELPHAFIGDVK GTTIGGCHHITSKYLPRSLPKDSVAVVGVSSPGRAAKAVCTLTDVYLPELRPYLQPETA SKCWKLKLDFRDVRLMVWKGATAYFQLEGLTWSALPDYARFIQLPKDAVVYIDPCIGP ATANRKVVRTTDWRADLAVTPYDYGAQVILTTAWFEDLGPQWKILGLQPFRRTFGFEN TEDWAILARRMNDGKDYTDYNWHCVRERPHAIYGRARDHTYHFALGTELQVELGRPR LPPEQVP SEQIDNO:4ORF2OF94881MSVENCODEDBYSEQUENCEOFSEQIDNO:1 BETWEENNUCLEOTIDES11611...12360 MQWVYCGVKSVSCSWMPSLSSLLVWLTLSSFSPYCLGSLLQAGYWSSFSEWFAPRF SVRALPFTLPNYRRSYEGLLPNCRPDVPQFAVKHPLGILWHMRVSHLIDEMVSRRIYR TMEHSGQAAWKQVVSEATLTKLSRLDVVTHFQHLAAVEADSCRFLSSRLAMLKNLAV GNVSLEYNTTLDRVELIFPTPGTRPKLTDFRQWLISVHASIFSSVASSVTLFTVLWLRIP ALRYVFGFHWPTATHHSN SEQIDNO:5ORF3OF94881MSVENCODEDBYSEQUENCEOFSEQIDNO:1 BETWEENNUCLEOTIDES12219...13016 MAYQRARFHLLLCGFVCYLVHSALASNSSSTLCFWFPLAHGNTSFELTINYTICKPCPT SQAAQQRLEPGRNVWCKIGHDRCEERDHDELSMSIPSGYDNLKLEGYYAWLAFLSFS YAAQFHPELFGIGNVSRVFVDKRHQFICAEHDGQNSTISARHNISASYAVYYHHQIDGG NWFHLEWLRPFFSSWLVLNISWFLRRSPASPASRRIYQILRPTRPRLPVSWSFRTSIVS NLTGPQQRKVPLPSGGRPNVVKPSAFPSTSR SEQIDNO:6ORF4OF94881MSVENCODEDBYSEQUENCEOFSEQIDNO:1 BETWEENNUCLEOTIDES12761...13312 MAATILFLLAGAQHLMVSEAFACKPCFSTHLSDIKTNTTAAAGFMVLQNINCFQSHRAS TAQGTTPLRRSSQCREAVGIPQYITITANVTDESYLYNADLLMLSACLFYASEMSEKGF KVIFGNISGVVSACVNFTDYVAHVTQHTQQHHLVIDHIRLLHFLTPSTMRWATTIACLLAI LLAV SEQIDNO:7ORF5OF94881MSVENCODEDBYSEQUENCEOFSEQIDNO:1 BETWEENNUCLEOTIDES13309...13914 MKCSCKLGHFLTPHSCFWWLFLLCTGLSWSFVDGNDDSSTSQYIYNLTICELNGTEWL SGHFDWAVETFVLYPVATHIISLGFLTTSHFLDALGLGAVSATGFIGERYVLSSMYGVC AFAAFVCFVIRAAKNCMACRYARTRFTNFIVDDRGRIHRWKSSIVVEKLGKAEVGGDLV NIKHVVLEGVKAQPLTRTSAEQWEA SEQIDNO:8ORF6OF94881MSVENCODEDBYSEQUENCEOFSEQIDNO:1 BETWEENNUCLEOTIDES13902...14423 MGSLDDFCNDPTAAQKLVLAFSITYTPIMIYALKVSRGRLLGLLHILIFLNCSFTFGYMTY VHFQSTNRVAFTLGAVVALLWGVYSLTESWKFITSRCRLCCLGRRYILAPAHHVESAA GLHSIPASGNRAYAVRKPGLTSVNGTLVPGLRSLVLGGKRAVKRGVVNLVKYGR SEQIDNO:9ORF7OF94881MSVENCODEDBYSEQUENCEOFSEQIDNO:1 BETWEENNUCLEOTIDES14413...14799 MAGKNQSQKKRRNAAPMGKGQPVNQLCQLLGTMIKSQRQQSRGGQAKKKKPEKPH FPLAAEDDIRHHLTQAERSLCLQSIQTAFNQGAGTASLSSSGKVSFQVEFMLPVAHTV RLIRVTSTSASQGAN SEQIDNO:10FULLLENGTHNUCLEOTIDESEQUENCEOFPARENTPRRS STRAIN94881 1 TTTGTGTACCTTGGAGGCGTGGGTACAGCCCTGCCCCACCCCTTGGCCCCTGTTCTAGCC 61 CGACAGGTACCCTTCTCTCTCGGGGCGAGCGCGCCGCCTGCTGCTCCCTTGCGGCGGGAA 121 GGACCTCCCGAGTATTTCCGGAGAGCACCTGCTTTACGGGATCTCCGCCCTTTAACCATG 181 TCTGGGATGTTCTCCCGGTGCATGTGCACCCCGGCTGCCCGGGTATTTTGGAACGCCGGC 241 CAAGTCTATTGCACACGGTGTCTCAGTGCACGGTCTCTTCTCTCTCCAGAACTTCAGGAC 301 ACGGACCTCGGTGCAGTTGGCTTGTTTCACAAGCCTAAAGACAAGCTCCATTGGAAAGTT 361 CCCATTGGTATCCCCCAGGTGGAATGTTCTCCATCTGGGTGTTGCTGGCTGTCAACCATT 421 TTTCCTTTAGCGCGCATGACCTCCGGCAATCACAACTTCCTTCAACGACTCGTGAAGGTT 481 GCTGACGTATTGTACCGTGACGGTTGCTTAACCCCTAGACACCTCCGTGAACTCCAAGTT 541 TACGAGCGTGGTTGCAATTGGTATCCGATTACGGGGCCTGTGCCTGGGATGGCTGTGTAC 601 GCGAACTCCATGCACGTGTCCGACCAACCGTTCCCTGGTGCCACTCATGTGTTAACAAAT 661 TCCCCTTTGCCTCAACGGGCTTGTCGGCAGCCGTTCTGTCCGTTCGAAGAGGCCCATTCT 721 AGCATATACAGGTGGGAAAAATTTGTAATTTTTATGGATTCCTCCTCCGACGGTCGATCT 781 CGCATGATGTGGACTCCGGAATCCGATGACTCCACGGCTTTGGAAGTTCTGCCGCCCGAG 841 CTAGAACACCAGGTCAAGGTCCTTGTTCGGAGCTTTCCCGCCCATCACCTTGTCGACCTT 901 GCCGATTGGGAGCTCACTGAGTCCCCTGAGAACGGTTTTTCCTTCAGCACGTCACATCCT 961 TGCGGCTACCTTGTTCGGGACCCGGCTGTATCCGAAGGCAAGTGTTGGCTTTCCTGCTTT 1021 TTGAGCCAGTCAGCCGAAGTGCTCAGTCGCGAGGCGCATCTGGCTACCGCCTATGGTTAC 1081 CAAACCAAGTGGGGTGTGCCTGGCAAGTACATCCAGCGCAGACTTCAAGTTCACGGTCTC 1141 CGTGCTGTGGTCGACCCTGATGGTCCCATTCACGTTGAAGCATTGTCTTGCCCCCAGTCT 1201 TGGATCAGGCACTTGACCCTGAATGATGATGTCACCCCGGGATTCGTTCGCCTAATGTCT 1261 CTTCGCATTGTGCCGAACACAGAGCCTACCACACACCGGATCTTTCGTTTTGGAGTGCAC 1321 AAGTGGTATGGTGCCGCCGGCAAACGGGCCCGTGGCAAGCGTGCCGCCAAAAGTGAGAAA 1381 GACTCGGCTTCCACCCTCAAGGTTGCCCGACCGACTTCCACCAGTGGAATCGTCACCTAC 1441 TCCCCACCTGCGGACGGGTCTTGTGGTTGGCATGCCCTTGCCGCCATACTGAACCGGATG 1501 ATTAATAATGACTTCACGTCCCCTCTGCCTCGGTACAACAGGCCGGAGGACGATTGGGCT 1561 TCTGATGGTGACCTTGCTCAGGCCATTCAATGTTTGCAACTACCTGCCGCCATAGCTCGG 1621 AACCGCGCCTGCCCTAACGCCAAATACCTCGTAAAACTCAACGGAGTTCATTGGGAGGTA 1681 GAGGTGAGGCCTGGAATGGCTCCTCGCTCCCTCTCTCGTGAGTGCGTTGTTGGCGTCTGC 1741 TCTGAAGGCTGTGTCGCGTCGCCTTACCCGGAGGACGGGTTGCCTAAACGTGCACTTGAG 1801 GCCCTGGCGTCTGCTTATAGACTGCCTTCAGACTGTGTTTGTGATGGTATTATTGACTTC 1861 CTTGCCAATCCACCTCCCCAGGAGTTCTGGACTCTTGACAAAATGTTGACTTCCCCGTCA 1921 CCGGAGCAGTCCGGCTTCTCTAGTCTGTATAAATTGTTGTTAGAGGTCTTGCCGCAGAAA 1981 TGCGGATCCACAGAAGGGGAATTCATCTATACTGTTGAGAGGATGTTGAAGGATTGTCCG 2041 AGCTCCAAACAGGCCATGGCCCTCCTTGCAAAAATTAAGGTCCCATCCTCAAAGGCCCCA 2101 TCCGTGACTCTGAACGAGTGCTTCCCCACGGATGTTCCAGTCAACTCTGAGTTAATATCT 2161 TGGGAAGAGCCCAAAGACCCTGGCGCTGCTGTTGTCCTATGTCCATCGGATGCAAAAGAA 2221 TCTAAGGAAACAGCCCCTGAAGAAGCTCAAGCGAGAAACCGTAAGGTCCTCCACCCTGTG 2281 GTCCTTACCGAGGAACTTAGCGAGCAACAGGTGCAGGTGGTTGAGGGTGATCAGGATATG 2341 CCACTGGATTTGACTTGGCCAACCTTAACCGCTACGGCGACCCCTGTTAGAGGGCCGGTA 2401 CCGGACAATTTGAGCTCTGGCATTGGTGCCCAGCCCGCTACCGTTCAAGAACTCATTCTG 2461 GCGAGGCCTGCACCCCGTCTTGTTGAGCGCTGTGGCACGGAGTCGAACGGCAGCAGTTCA 2521 TTTCTGGATTTGCCTGACGTGCAGACCTCGGACCAGCCTTTAGACCTGTCCCTGGCCGCG 2581 TGGCCTGTAAGGGCTACCGCGTCTGACCCCGGTTGGATCCACGGTAGGCGTGAGCCTGTC 2641 TTTGTGAAGCCTCGAGGTGTTTTCTCTGATGGCGAGTCGGCCCTTCAGTTCGGAGAGCTT 2701 TCCGAAGCCAGTTCTGTCGTCGATGACCGGACAAAAGAAGCTCCGGTGGTTGACGCCCCC 2761 ATCGATTTGACAACTTCGAACGAGACGCTCTCTGGGTCTGACCCCTTTGAATTCGCCAAA 2821 TTCAGGCGCCCGCGTTTCTCCGCGCAAGCTTTAATCGACCGAGGTGGTCCGCTTGCCGAT 2881 GTTCATGCAAAGATAAAGAGTCGGGTATATGAACAATGCCTTCAAGCTTGTGAACCTGGT 2941 AGTCGTGCGACCCCAGCCACCAAGAAGTGGCTCGACAAAATGTGGGACAGGGTGGACATG 3001 AAAACTTGGCGCTGCACCTCGCAGTTCCAAGCTGGTCACATTCTTGAGTCCCTCAAATTC 3061 CTCCCTGACATGATTCAAGACACACCGCCTCCTGTTCCCAGGAAGAACCGAGCTGGTGAC 3121 AGTGCCGGCCTGAAGCAACTGGTGGCGCAGTGGGATAGGAAATTGAGTGTGACACCCCCC 3181 ACAAAACCGGTTGGACCGGTGCTTGACCAGACCGTCCCTCTGCCTATGGACATCCAGCAA 3241 GAAGATGCCATCTCCGCTGACAAGCCACCCCATTCGCAAAACCCTTCTAGTCAAGTAGAT 3301 GTGGGTGGAGGTTGGAAAAGTTTTATGCTCTCCGGCACCCGTTTCGCGGGGTCCGTTAGT 3361 CAGCGCCTTACGACATGGGTTTTTGAGGTTCTCTCCCATCTCCCAGCTTTTATGCTCACA 3421 CTTTTCTCGCCACGGGGCTCTATGGCTCCAGGTGATTGGCTGTTTGCAGGTGCTGTTCTA 3481 CTTGCTCTCCTGCTCTGCCGTTCTTACCCAATACTCGGATGCCTTCCCTTATTGGGTGTC 3541 TTTTCTGGTTCTGTGCGGTGTGTTCGTTTGGGTGTTTTTGGTTCTTGGATGGCTTTTGCT 3601 GTATTTTTATTCTCGACTCCACCCGACCCAGTCGGTTCTTCTTGTGACCACGATTCGCCG 3661 GAGTGTCATGCTGAGCTTTTGGCTCTTGAGCAGCGCCAACTTTGGGAACCTGTGCGCAGC 3721 CTTGTGGTCGGGCCATCGGGCCTCTTATGCGTCATTCTTGGCAAGTTACTCGGTGGGTCA 3781 CGTTGTCTCTGGTTTGTTCTCCTACGTATATGCATGCTCGCAGATTTGGCAATTTCTCTT 3841 ATTTATGTGGTGTCCCAAGGGCGTTGTCACAAGTGTTGGGGAAAGTGTATAAGGACGGCT 3901 CCTGCAGAAGTGACCCTTAATGTGTTTCCTTTTTCGCGCGCCACCCGCTCATCTCTTGTG 3961 TCCTTGTGTGATCGGTTCCAAGCGCCAAAAGGAGTTGACCCCGTGCACTTGGCGACAGGC 4021 TGGCGCGGGTGCTGGTGTGGTGAGAGCCCTATTCATCAATCACACCAAAAACCGATAGCT 4081 TATGCCAACTTGGATGAAAAGAAGATATCCGCCCAGACGGTGATTGCTGTCCCGTATGAT 4141 CCCAGTCAGGCCATTAAATGCCTGAAAGTTTTGCAGGCAGGAGGGGCTATTGTGGACCAG 4201 CCTACGCCCGAGGTCGTCCGTGTGTCTGAGATTCCCTTCTCGGCCCCATTTTTTCCGAAG 4261 GTCCCAGTCAACCCAGATTGCAGGGTTGTGGTAGATTCGGACACTTTTGTGGCTGCGGTC 4321 CGCTGCGGTTATTCGACAGCACAACTGGTCCTTGGTCGGGGCAACTTTGCCAAGCTAAAT 4381 CAGACCCCCCTCAGGAACTCTGTCCCCACCAAAACAACTGGTGGGGCCTCATACACCCTT 4441 GCCGTGGCCCAGGTATCTGTGTGGACTCTTGTTCATTTCATCCTCGGCCTTTGGTTAACG 4501 TCACCTCAAGTGTGTGGTCGAGGGACCTCTGACCCGTGGTGTTCGAACCCTTTTTCGTAT 4561 CCTACTTATGGCCCCGGAGTTGTGTGTTCCTCTCGACTCTGCGTGTCTGCCGACGGAGTT 4621 ACCCTGCCATTGTTCTCAGCCGTTGCCCATCTTTCCGGTAGAGAGGTGGGGATTTTTATT 4681 TTGGTGCTTGCCTCCTTGGGCGCTTTAGCCCACCGCTTGGCTCTTAAGGCAGACATGTCA 4741 ATGGTCTTTTTGGCGTTTTGTGCTTACGCCTGGCCCATGAGCTCCTGGTTAATTTGCTTC 4801 TTTCCTATGCTCTTGAGGTGGGTAACCCTTCATCCTCTCACTATGCTTTGGGTGCACTCA 4861 TTTTTGGTGTTTTGCCTACCAGCTGCCGGCGTTCTCTCGCTGGGAATAACCGGTCTTCTT 4921 TGGGCAGTTGGCCGTTTCACCCAGGTTGCCGGAATTATCACACCTTATGACATCCACCAG 4981 TATACCTCCGGACCACGTGGTGCAGCTGCTGTAGCAACGGCTCCAGAAGGTACTTACATG 5041 GCGGCCGTTCGGAGAGCCGCTTTGACTGGACGGACTTTGATCTTCACACCATCTGCAGTC 5101 GGATCCCTTCTTGAAGGTGCTTTCAGAACTCAAAAGCCCTGCCTTAACACCGTGAATGTC 5161 GTAGGCTCTTCCCTTGGTTCTGGAGGAGTTTTCACCATTGATGGCAGAAGAGTCATCGTC 5221 ACTGCCACCCATGTGTTGAATGGTAACACAGCCAGGGTCACTGGTGATTCCTACAACCGC 5281 ATGCACACGTTCAATACTAATGGTGATTATGCCTGGTCCCATGCTGATGACTGGCAAGGC 5341 GTTGCCCCTATGGTTAAGATCGCTAAGGGGTATCGCGGTCGTGCCTACTGGCAAACGTCA 5401 ACCGGAGTCGAACCTGGCATCATGGGGGAAGGATTCGCCTTCTGTTTCACTAACTGTGGC 5461 GACTCAGGGTCACCTGTCATTTCAGAAGCTGGTGACCTTATTGGAGTCCATACCGGTTCA 5521 AACAAACTCGGTTCTGGTCTTGTGACAACCCCTGAAGGGGAGACCTGCTCCATCAAGGAA 5581 ACTAGGCTCTCTGACCTTTCTAGACATTTTGCAGGTCCAAGCGTCCCTCTTGGGGACATT 5641 AAGTTGAGCCCAGCCATCATCCCTGATGTGACAACTATTCCGAGTGACTTGGCATCGCTC 5701 CTTGCTTCTGTCCCCGTGATGGAAGGTGGCCTCTCAACTGTCCAGCTTTTGTGCGTCTTT 5761 TTCCTTCTCTGGCGCATGATGGGCCATGCCTGGACACCCATTGTTGCCGTAGGCTTCTTT 5821 TTGCTGAATGAAATTCTCCCAGCAGTCTTGGTCCGAGCTGTGTTCTCTTTTGCACTCTTT 5881 GTACTTGCATGGGCCACCCCCTGGTCGGCACAAGTGTTGATGATTAGACTCCTCACGGCG 5941 GCTCTCAACCGCAACAGGTTGTCCCTGGCGTTCTACGCACTCGGAGGTGTCGTTGGCCTG 6001 GCCACAGAAATCGGGACTTTTGCTGGTGGATGGCCTGAACTGTCCCAAGCCCTCTCGACA 6061 TACTGCTTCCTGCCCAGGTTCCTTGCTGTGACTAGTTATGTCCCCACCATCATCATCGGT 6121 GGGCTCCATGCCCTCGGCGTAATTTTGTGGTTATTCAAATACCGATGCCTCCACAACATG 6181 CTGGTTGGTGATGGGAGTTTCTCAAGCGCTTTCTTCCTACGGTATTTTGCTGAGGGTAAT 6241 CTTAGGAAAGGCGTGTCGCAGTCCTGTGGCATGAATAACGAATCCCTGACAGCTGCTTTG 6301 GCTTGCAAGTTGTCGCAAGCTGACCTTGATTTTTTGTCCAGTTTAACGAACTTCAAGTGC 6361 TTTGTGTCCGCTTCAAACATGAAAAATGCAGCTGGCCAATACATCGAGGCGGCGTATGCT 6421 AGAGCTCTGCGTCAGGAGCTGGCCTCCTTGGTTCAGGTTGACAAGATGAAAGGAGTATTG 6481 GCCAAGCTCGAGGCTTTCGCTGAGACGGCCACTCCGTCACTTGACACAGGTGACGTGATT 6541 GTTCTGCTTGGGCAACACCCCCATGGATCCATCCTCGACATTAATGTGGGGGGTGAAAGG 6601 AAAACTGTGTCTGTGCAAGAAACACGATGCCTGGGTGGTTCCAAATTCAGTGTCTGCACT 6661 GTCGTGTCCAACACGCCCGTGGATACCTTGACCGGCATCCCACTTCAGACGCCAACCCCA 6721 CTTTTTGAAAATGGCCCGCGCCATCGCAGCGAGGACGACGACCTTAAAGTTGAGAGAATG 6781 AAAAAACACTGTGTATCCCTCGGCTTCCACAAAATCAATGGTAAAGTTTACTGCAAAATT 6841 TGGGACAAGTCTAACGGCGACACCTTTTACACGGATGATTCCCGATACACTCAAGACCAT 6901 GCTTTTCAGGACAGGTCAACCGACTATAGAGACAGGGATTATGAAGGTGTACAGACCGCC 6961 CCCCAACAGGGATTCGATCCAAAGTCCGAAGCCCCTGTTGGCACTGTTGTAATCGGTGGC 7021 ATTACGTATAACAGGCATCTGGTCAAAGGTAAGGAGGTCCTAGTTCCCAAACCTGACAAC 7081 TGCCTTGAAGCTGCCAGACTGTCCCTTGAGCAAGCTCTTGCTGGGATGGGCCAAACTTGT 7141 GACCTTACAGCTACCGAAGTGGAGAAACTAAAGCGCATCATTAGTCAACTCCAAGGTCTG 7201 ACCACTGAACAGGCTTTAAACTGCTAGCCGCCAGCGGCTTGACCCGCTGTGGCCGCGGCG 7261 GCCTAGTTGTAACTGAAACGGCGGTAAAAATCGTAAAATACCACAGCAGAACTTTCACCT 7321 TAGGCTCTTTAGACCTAAAAGTCACCTCCGAGGTGGAGGTGAAGAAATCAACTGAGCAGG 7381 GGCACGCTGTCGTGGCGAACTTATGTTCCGGTGTCGTCTTGATGAGGCCTCACCCACCGT 7441 CCCTTGTTGACGTTCTCCTCAAACCCGGACTTGACACAACACCCGGCATTCAACCAGGGC 7501 ATGGGGCCGGGAATATGGGCGTGAACGGTTCTATTTGGGATTTTGAAACTGCACCCACAA 7561 AGGTAGAACTAGAGTTGTCCAAGCAAATAATCCAAGCATGTGAAGTCAGGCGCGGGGACG 7621 CCCCTAACCTCCAACTCCCCTACAAGCTTTATCCTGTCAGGGGGGACCCCGAGCGGCGTA 7681 AAGGTCGCCTTGTCAACACTAGGTTTGGAGATTTACCTTACAAAACTCCCCAAGACACCA 7741 AGTCCGCAATTCATGCGGCTTGTTGCCTGCATCCCAATGGGGTCCTCGTGTCTGATGGTA 7801 AATCCACGCTGGGTACCACTCTTCAACATGGTTTCGAGCTTTATGTCCCCACTGTACCTT 7861 ATAGTGTCATGGAATACCTTGATTCACGCCCTGACACCCCTTTTATGTGTACTAAACATG 7921 GCACTTCCAAGGCTGCTGCAGAGGACCTCCAAAAATATGACCTATCCACTCAAGGGTTTG 7981 TCTTGCCTGGGGTCCTACGCCTAGTGCGCAGGTTCATCTTTAGCCATGTTGGTAAGGCGC 8041 CACCACTGTTCCTTCCATCAACCTACCCTGCCAAGAACTCCATGGCAGGGGTCAATGGCC 8101 AGAGGTTCCCAACAAAGGATGTCCAGAGCATACCTGAAATTGATGAAATGTGCGCCCGTG 8161 CCGTCAAGGAAAATTGGCAGACTGTGACACCTTGCACCCTCAAAAAACAGTACTGTTCCA 8221 AACCTAAAACTAGAACCATCCTAGGTACCAACAACTTCATAGCCTTGGCTCACAGGTCAG 8281 CACTCAGTGGTGTCACCCAGGCGTTCATGAAGAAGGCCTGGAAGTCCCCAATTGCCTTGG 8341 GGAAAAACAAGTTTAAGGAATTGCATTGCACTGTCGCCGGCAGATGCCTTGAGGCTGACC 8401 TGGCTTCCTGCGATCGCAGCACCCCCGCCATTGTGAGGTGGTTTGTTGCCAACCTCCTGT 8461 ATGAACTTGCAGGATGTGAAGAGTACTTGCCTAGCTACGTGCTCAACTGTTGCCATGACC 8521 TTGTGGCAACGCAGGATGGCGCTTTCACAAAACGCGGTGGCCTGTCGTCCGGGGACCCCG 8581 TCACCAGTGTGTCCAACACCGTCTACTCACTGATAATTTACGCCCAGCACATGGTGCTTT 8641 CGGCCTTGAAGATGGGTCATGAAATTGGTCTCAAGTTCCTTGAGGAACAGCTCAAATTTG 8701 AGGACCTTCTTGAAATCCAGCCCATGTTAGTGTATTCTGATGACCTCGTCTTGTATGCGG 8761 AAAGACCCACTTTTCCCAACTACCATTGGTGGGTCGAGCATCTTGACCTGATGTTGGGCT 8821 TTAAAACGGACCCAAAGAAAACTGTCATAACTGATAAACCCAGTTTTCTCGGCTGCAGAA 8881 TTGAAGCAGGACGGCAGTTAGTCCCCAATCGCGACCGTATTCTGGCTGCTCTTGCATATC 8941 ATATGAAGGCGCAGAACGCCTCAGAGTATTATGCGTCCGCTGCCGCAATTCTGATGGATT 9001 CGTGTGCTTGCATTGACCATGACCCCGAGTGGTATGAGGACCTTATCTGCGGCATCGCCC 9061 GGTGTGCTCGCCAGGACGGTTACCGTTTTCCAGGCCCGGCATTTTTCATGTCCATGTGGG 9121 AGAAGCTGAAAAGTCATAACGAAGGGAAGAAATGCCGTCACTGCGGCATCTGCGACGCCA 9181 AAGCCGACTATGCGTCCGCCTGTGGACTTGATTTGTGTTTGTTCCATTCACACTTTCATC 9241 AACACTGCCCAGTCACTCTGAGCTGTGGCCACCATGCCGGTTCAAAGGAATGTTCGCAGT 9301 GTCAGTCACCTGTCGGGGCTGGCAAATCCCCCCTTGACGCTGTGCTGAAACAAATCCCGT 9361 ACAAACCTCCTCGTACCATTATCATGAAGGTGGACAACAAAACAACGACCCTTGACCCGG 9421 GAAGATATCAGTCCCGTCGAGGTCTTGTTGCAGTCAAAAGAGGTATTGCAGGTAATGAGG 9481 TTGATCTTTCTGATGGAGACTACCAAGTGGTGCCTCTTTTGCCGACTTGCAAAGACATAA 9541 ACATGGTGAAGGTGGCTTGCAACGTACTACTCAGCAAGTTTATAGTAGGGCCGCCAGGTT 9601 CCGGAAAAACCACCTGGCTACTGAACCAAGTCCAGGACGATGATGTCATTTACACACCTA 9661 CTCATCAGACAATGTTTGACATAGTCAGTGCTCTTAAAGTTTGCAGGTATTCCATCCCAG 9721 GAGCCTCAGGACTCCCTTTTCCACCACCTGCCAGGTCCGGGCCGTGGGTTAGGCTCATCG 9781 CCAGCGGACATGTCCCTGGCCGAGTGTCATATCTCGATGAGGCAGGATATTGCAATCATC 9841 TAGACATTCTAAGGCTGCTTTCCAAAACACCCCTTGTGTGTTTGGGTGACCTTCAGCAAC 9901 TTCACCCGGTCGGCTTTGATTCCTATTGTTATGTGTTCGATCAGATGCCTCAGAAGCAGC 9961 TGACCACCATTTATAGATTTGGCCCTAACATCTGTGCAGCCATCCAGCCTTGTTACAGGG 10021 AGAAACTTGAATCCAAGGCCAGGAACACCAGAGTGGTTTTCACCACCCGGCCTGTGGCCT 10081 TTGGTCAGGTCCTGACACCGTACCACAAAGATCGTACCGGCTCTGCAATAACTATAGATT 10141 CATCCCAGGGGGCGACCTTCGACATTGTGACATTGCATCTACCATCGCCAAAGTCCCTAA 10201 ACAAATCCCGAGCACTTGTAGCCATCACTCGGGCAAGACATGGGTTGTTCATTTATGACC 10261 CTCATGACCAACTCCAGGAGTTTTTCAACTTAACCCCCGAGCGCACTGATTGTAACCTTG 10321 CGTTCAGCCGTGGGGATGAGCTGGTTGTTTTGAATGTGGATAATGCGGTCACAACTGTAG 10381 CGAAGGCCCTAGAGACAGGTTCACCCCGATTTCGAGTATCGGACCCGAGGTGCAAGTCTC 10441 TCTTAGCCGCTTGTTCGGCCAGTCTAGAAGGGAGCTGCATGCCACTACCACAAGTAGCAC 10501 ATAACCTGGGGTTTTACTTTTCCCCGGACAGCCCAGCTTTTGCACCCCTGCCAAAAGAGC 10561 TGGCGCCACATTGGCCAGTGGTCACCCACCAGAATAATCGAGCGTGGCCTGATCGACTTG 10621 TCGCTAGTATGCGCCCAATTGATGCCCGCTACAGCAAGCCAATGGTCGGTGCAGGGTATG 10681 TGGTCGGGCCATCCATTTTTCTTGGCACTCCTGGTGTGGTGTCATACTATCTCACATTAT 10741 ACATCGGGGGCGAGCCTCAGGCCCTGCCAGAAACACTCGTTTCAACAGGACGTATAGCCA 10801 CAGATTGTCGGGAATATCTCGACGCGGCTGAGGAAGAGGCAGCGAGAGAACTTCCCCACG 10861 CATTTATTGGCGATGTCAAAGGCACTACGGTCGGGGGGTGTCACCACATTACATCGAAAT 10921 ACCTACCTAGGTCCCTGCCTAAAGACTCTGTTGCTGTGGTTGGGGTGAGTTCGCCCGGTA 10981 GGGCTGCTAAAGCCGTGTGCACTCTCACCGATGTGTACCTCCCCGAACTCCGACCATATT 11041 TGCAACCGGAGACGGCATCAAAATGCTGGAAACTTAAACTGGATTTCAGGGATGTTCGAC 11101 TGATGGTCTGGAAAGGCGCCACAGCCTATTTCCAGTTGGAAGGGCTGACATGGTCAGCGC 11161 TGCCCGATTATGCTAGGTTCATTCAGCTACCCAAGGATGCCGTTGTGTACATCGATCCGT 11221 GTATAGGGCCGGCAACAGCCAATCGCAAGGTTGTGCGAACCACAGACTGGCGGGCCGACC 11281 TGGCAGTGACACCGTATGATTACGGTGCTCAGGTCATTTTGACAACAGCCTGGTTCGAGG 11341 ACCTTGGGCCGCAGTGGAAGATTTTGGGGTTGCAGCCTTTCAGACGAACATTTGGCTTTG 11401 AGAACACTGAAGATTGGGCAATTCTCGCACGCCGTATGAATGACGGCAAAGATTACACTG 11461 ACTATAATTGGCATTGTGTACGAGAACGCCCACACGCAATTTACGGGCGCGCCCGTGACC 11521 ATACGTATCATTTTGCCCTTGGCACTGAACTGCAAGTAGAGCTGGGCAGACCCCGGCTGC 11581 CTCCTGAGCAAGTGCCGTGAACGCGGAGTGATGCAATGGGTTCACTGTGGAGTAAAATCA 11641 GTCAGTTGTTCGTGGATGCCTTCACTGAGTTCCTTGTTAGTGTGGTTGACATTGTCATCT 11701 TTCTCGCCATATTGTTTGGGTTCACTGTTGCAGGCTGGTTATTGGTCTTCCTTCTCAGAG 11761 TGGTTTGCTCCGCGTTTCTCCGTTCGCGCTCTGCCATTCACTCTCCCGAACTATCGAAGG 11821 TCCTATGAGGGCTTGCTACCCAACTGCAGACCGGATGTCCCACAATTCGCAGTTAAGCAC 11881 CCGTTGGGTATACTTTGGCATATGCGAGTCTCCCACCTAATTGACGAAATGGTCTCTCGC 11941 CGCATTTACCGGACCATGGAACATTCGGGTCAAGCGGCCTGGAAGCAGGTTGTTAGTGAA 12001 GCCACTCTCACAAAACTGTCAAGGCTTGACGTAGTCACTCATTTCCAACACCTGGCCGCA 12061 GTGGAGGCTGATTCTTGCCGCTTCCTTAGCTCACGACTCGCGATGCTGAAAAACCTTGCC 12121 GTTGGCAATGTGAGCCTGGAGTACAACACTACTTTGGACCGCGTTGAGCTCATCTTTCCC 12181 ACACCAGGTACGAGGCCCAAGTTGACCGATTTTAGGCAATGGCTTATCAGCGTGCACGCT 12241 TCCATCTTCTCCTCTGTGGCTTCGTCTGTTACCTTGTTCACAGTGCTTTGGCTTCGAATT 12301 CCAGCTCTACGCTATGTTTTTGGTTTCCATTGGCCCACGGCAACACATCATTCGAACTAA 12361 CTATCAATTACACTATATGTAAGCCATGCCCTACCAGTCAAGCTGCCCAACAAAGACTCG 12421 AGCCTGGCCGTAACGTGTGGTGCAAAATAGGGCACGACAGGTGTGAGGAACGTGACCATG 12481 ATGAGTTGTCAATGTCCATTCCGTCCGGGTACGACAACCTCAAACTTGAGGGTTATTATG 12541 CTTGGCTGGCTTTTTTGTCCTTTTCCTACGCGGCCCAATTCCATCCGGAGCTGTTCGGAA 12601 TAGGAAACGTGTCGCGCGTCTTTGTGGATAAGCGACACCAGTTCATTTGCGCCGAGCATG 12661 ATGGACAAAATTCAACCATATCTGCCAGACACAACATCTCCGCGTCGTATGCGGTGTATT 12721 ACCATCATCAAATAGACGGGGGCAATTGGTTTCATTTGGAATGGCTGCGACCATTCTTTT 12781 CCTCCTGGCTGGTGCTCAACATCTCATGGTTTCTGAGGCGTTCGCCTGCAAGCCCTGCTT 12841 CTCGACGCATCTATCAGATATTAAGACCAACACGACCGCGGCTGCCGGTTTCATGGTCCT 12901 TCAGAACATCAATTGTTTCCAATCTCACAGGGCCTCAACAGCGCAAGGTACCACTCCCCT 12961 CAGGAGGTCGTCCCAATGTCGTGAAGCCGTCGGCATTCCCCAGTACATCACGATAACGGC 13021 TAATGTGACCGATGAATCGTATTTGTACAACGCGGACTTGCTGATGCTTTCCGCGTGCCT 13081 TTTCTACGCCTCGGAAATGAGCGAGAAAGGCTTCAAAGTCATCTTTGGGAATATTTCTGG 13141 CGTTGTTTCCGCTTGTGTTAATTTCACAGATTATGTGGCCCATGTGACCCAACACACTCA 13201 GCAGCACCATTTGGTAATTGATCACATTCGGTTACTACACTTCTTGACACCGTCTACGAT 13261 GAGGTGGGCTACAACCATTGCTTGTTTGTTTGCCATTCTTTTGGCGGTATGAAATGTTCT 13321 TGCAAGTTGGGGCATTTCTTGACTCCTCACTCTTGCTTCTGGTGGCTTTTTTTGCTGTGT 13381 ACCGGCTTGTCTTGGTCCTTTGTCGATGGCAACGACAACAGCTCGACATCCCAATACATA 13441 TATAATTTGACGATATGCGAGCTGAATGGGACCGAATGGTTGTCCGGTCATTTTGATTGG 13501 GCAGTCGAAACCTTTGTGCTTTACCCAGTTGCCACTCATATCATTTCACTGGGTTTTCTC 13561 ACAACAAGCCATTTCCTTGATGCGCTCGGTCTCGGCGCTGTGTCCGCCACAGGATTCATT 13621 GGCGAGCGGTATGTACTTAGCAGCATGTACGGCGTTTGCGCCTTCGCGGCGCTCGTATGT 13681 TTTGTCATCCGTGCTGCTAAAAATTGCATGGCTTGCCGCTATGCCCGCACCCGGTTTACC 13741 AACTTCATCGTGGACGACCGGGGAAGAATCCATCGATGGAAGTCTTCAATAGTGGTGGAG 13801 AAATTGGGCAAAGCTGAAGTCGGTGGTGACCTTGTCAACATTAAGCATGTTGTCCTCGAA 13861 GGGGTTAAAGCTCAACCCTTGACGAGGACTTCGGCTGAGCAATGGGAAGCCTAGACGACT 13921 TTTGCAACGATCCCACCGCCGCACAAAAACTCGTGCTGGCCTTTAGCATCACATATACAC 13981 CCATAATGATATACGCCCTTAAGGTGTCACGCGGCCGACTCCTGGGGCTGTTGCACATCT 14041 TGATATTTCTGAATTGTTCCTTTACTTTTGGGTACATGACATATGTGCATTTTCAATCCA 14101 CCAACCGTGTCGCACTCACTCTGGGGGCTGTAGTCGCCCTTTTGTGGGGTGTTTACAGCC 14161 TCACAGAGTCATGGAAGTTCATCACTTCCAGATGCAGATTGTGTTGCCTAGGCCGGCGAT 14221 ACATTCTGGCCCCTGCCCATCACGTAGAAAGTGCTGCAGGCCTCCATTCAATCCCAGCGT 14281 CTGGTAACCGAGCATACGCTGTGAGAAAGCCCGGACTAACATCAGTGAACGGCACTCTAG 14341 TACCTGGGCTTCGGAGCCTCGTGCTGGGCGGCAAACGAGCTGTTAAACGAGGAGTGGTTA 14401 ACCTCGTCAAGTATGGCCGGTAAGAACCAGAGCCAGAAGAAAAGAAGAAATGCAGCTCCG 14461 ATGGGGAAAGGCCAGCCAGTCAATCAACTGTGCCAGTTGCTGGGTACAATGATAAAGTCC 14521 CAGCGCCAGCAATCTAGGGGAGGACAGGCCAAAAAGAAGAAGCCTGAGAAGCCACATTTT 14581 CCCCTAGCTGCTGAAGATGACATTCGGCACCATCTCACCCAGGCCGAACGTTCCCTCTGC 14641 TTGCAATCGATCCAGACGGCTTTCAATCAAGGCGCAGGAACTGCGTCGCTTTCATCCAGC 14701 GGGAAGGTCAGTTTCCAGGTTGAGTTCATGCTGCCGGTTGCTCATACAGTGCGCCTGATT 14761 CGCGTGACTTCTACATCCGCCAGTCAGGGTGCAAATTAATTTGACAGTCAGGTGAATGGC 14821 CGCGATTGACGTGTGGCCTCTAA SEQIDNO:11ORF1aOFPARENTALPRRSVSTRAIN94881ENCODEDBY SEQUENCEOFSEQIDNO:10BETWEENNUCLEOTIDES178...7227 MSGMFSRCMCTPAARVFWNAGQVYCTRCLSARSLLSPELQDTDLGAVGLFHKPKDKLHWKVPIGIPQVECSPSGCCW LSTIFPLARMTSGNHNFLQRLVKVADVLYRDGCLTPRHLRELQVYERGCNWYPITGPVPGMAVYANSMHVSDQPFPG ATHVLTNSPLPQRACRQPFCPFEEAHSSIYRWEKFVIFMDSSSDGRSRMMWTPESDDSTALEVLPPELEHQVKVLVR SFPAHHLVDLADWELTESPENGFSFSTSHPCGYLVRDPAVSEGKCWLSCFLSQSAEVLSREAHLATAYGYQTKWGVP GKYIQRRLQVHGLRAVVDPDGPIHVEALSCPQSWIRHLTLNDDVTPGFVRLMSLRIVPNTEPTTHRIFRFGVHKWYG AAGKRARGKRAAKSEKDSASTLKVARPTSTSGIVTYSPPADGSCGWHALAAILNRMINNDFTSPLPRYNRPEDDWAS DGDLAQAIQCLQLPAAIARNRACPNAKYLVKLNGVHWEVEVRPGMAPRSLSRECVVGVCSEGCVASPYPEDGLPKRA LEALASAYRLPSDCVCDGIIDFLANPPPQEFWTLDKMLTSPSPEQSGFSSLYKLLLEVLPQKCGSTEGEFIYTVERM LKDCPSSKQAMALLAKIKVPSSKAPSVTLNECFPTDVPVNSELISWEEPKDPGAAVVLCPSDAKESKETAPEEAQAR NRKVLHPVVLTEELSEQQVQVVEGDQDMPLDLTWPTLTATATPVRGPVPDNLSSGIGAQPATVQELILARPAPRLVE RCGTESNGSSSFLDLPDVQTSDQPLDLSLAAWPVRATASDPGWIHGRREPVFVKPRGVFSDGESALQFGELSEASSV VDDRTKEAPVVDAPIDLTTSNETLSGSDPFEFAKFRRPRFSAQALIDRGGPLADVHAKIKSRVYEQCLQACEPGSRA TPATKKWLDKMWDRVDMKTWRCTSQFQAGHILESLKFLPDMIQDTPPPVPRKNRAGDSAGLKQLVAQWDRKLSVTPP TKPVGPVLDQTVPLPMDIQQEDAISADKPPHSQNPSSQVDVGGGWKSFMLSGTRFAGSVSQRLTTWVFEVLSHLPAF MLTLFSPRGSMAPGDWLFAGAVLLALLLCRSYPILGCLPLLGVFSGSVRCVRLGVFGSWMAFAVFLFSTPPDPVGSS CDHDSPECHAELLALEQRQLWEPVRSLVVGPSGLLCVILGKLLGGSRCLWFVLLRICMLADLAISLIYVVSQGRCHK CWGKCIRTAPAEVTLNVFPFSRATRSSLVSLCDRFQAPKGVDPVHLATGWRGCWCGESPIHQSHQKPIAYANLDEKK ISAQTVIAVPYDPSQAIKCLKVLQAGGAIVDQPTPEVVRVSEIPFSAPFFPKVPVNPDCRVVVDSDTFVAAVRCGYS TAQLVLGRGNFAKLNQTPLRNSVPTKTTGGASYTLAVAQVSVWTLVHFILGLWLTSPQVCGRGTSDPWCSNPFSYPT YGPGVVCSSRLCVSADGVTLPLFSAVAHLSGREVGIFILVLASLGALAHRLALKADMSMVFLAFCAYAWPMSSWLIC FFPMLLRWVTLHPLTMLWVHSFLVFCLPAAGVLSLGITGLLWAVGRFTQVAGIITPYDIHQYTSGPRGAAAVATAPE GTYMAAVRRAALTGRTLIFTPSAVGSLLEGAFRTQKPCLNTVNVVGSSLGSGGVFTIDGRRVIVTATHVLNGNTARV TGDSYNRMHTFNTNGDYAWSHADDWQGVAPMVKIAKGYRGRAYWQTSTGVEPGIMGEGFAFCFTNCGDSGSPVISEA GDLIGVHTGSNKLGSGLVTTPEGETCSIKETRLSDLSRHFAGPSVPLGDIKLSPAIIPDVTTIPSDLASLLASVPVM EGGLSTVQLLCVFFLLWRMMGHAWTPIVAVGFFLLNEILPAVLVRAVFSFALFVLAWATPWSAQVLMIRLLTAALNR NRLSLAFYALGGVVGLATEIGTFAGGWPELSQALSTYCFLPRFLAVTSYVPTIIIGGLHALGVILWLFKYRCLHNML VGDGSFSSAFFLRYFAEGNLRKGVSQSCGMNNESLTAALACKLSQADLDFLSSLTNFKCFVSASNMKNAAGQYIEAA YARALRQELASLVQVDKMKGVLAKLEAFAETATPSLDTGDVIVLLGQHPHGSILDINVGGERKTVSVQETRCLGGSK FSVCTVVSNTPVDTLTGIPLQTPTPLFENGPRHRSEDDDLKVERMKKHCVSLGFHKINGKVYCKIWDKSNGDTFYTD DSRYTQDHAFQDRSTDYRDRDYEGVQTAPQQGFDPKSEAPVGTVVIGGITYNRHLVKGKEVLVPKPDNCLEAARLSL EQALAGMGQTCDLTATEVEKLKRIISQLQGLTTEQALNC SEQIDNO:12ORF1BOFPARENTALPRRSVSTRAIN94881ENCODEDBY SEQUENCEOFSEQIDNO:10BETWEENNUCLEOTIDES7209...11600 TGFKLLAASGLTRCGRGGLVVTETAVKIVKYHSRTFTLGSLDLKVTSEVEVKKSTEQGHAVVANLCSGVVLMRPHPP SLVDVLLKPGLDTTPGIQPGHGAGNMGVNGSIWDFETAPTKVELELSKQIIQACEVRRGDAPNLQLPYKLYPVRGDP ERRKGRLVNTRFGDLPYKTPQDTKSAIHAACCLHPNGVLVSDGKSTLGTTLQHGFELYVPTVPYSVMEYLDSRPDTP FMCTKHGTSKAAAEDLQKYDLSTQGFVLPGVLRLVRRFIFSHVGKAPPLFLPSTYPAKNSMAGVNGQRFPTKDVQSI PEIDEMCARAVKENWQTVTPCTLKKQYCSKPKTRTILGTNNFIALAHRSALSGVTQAFMKKAWKSPIALGKNKFKEL HCTVAGRCLEADLASCDRSTPAIVRWFVANLLYELAGCEEYLPSYVLNCCHDLVATQDGAFTKRGGLSSGDPVTSVS NTVYSLIIYAQHMVLSALKMGHEIGLKFLEEQLKFEDLLEIQPMLVYSDDLVLYAERPTFPNYHWWVEHLDLMLGFK TDPKKTVITDKPSFLGCRIEAGRQLVPNRDRILAALAYHMKAQNASEYYASAAAILMDSCACIDHDPEWYEDLICGI ARCARQDGYRFPGPAFFMSMWEKLKSHNEGKKCRHCGICDAKADYASACGLDLCLFHSHFHQHCPVTLSCGHHAGSK ECSQCQSPVGAGKSPLDAVLKQIPYKPPRTIIMKVDNKTTTLDPGRYQSRRGLVAVKRGIAGNEVDLSDGDYQVVPL LPTCKDINMVKVACNVLLSKFIVGPPGSGKTTWLLNQVQDDDVIYTPTHQTMFDIVSALKVCRYSIPGASGLPFPPP ARSGPWVRLIASGHVPGRVSYLDEAGYCNHLDILRLLSKTPLVCLGDLQQLHPVGFDSYCYVFDQMPQKQLTTIYRF GPNICAAIQPCYREKLESKARNTRVVFTTRPVAFGQVLTPYHKDRTGSAITIDSSQGATFDIVTLHLPSPKSLNKSR ALVAITRARHGLFIYDPHDQLQEFFNLTPERTDCNLAFSRGDELVVLNVDNAVTTVAKALETGSPRFRVSDPRCKSL LAACSASLEGSCMPLPQVAHNLGFYFSPDSPAFAPLPKELAPHWPVVTHQNNRAWPDRLVASMRPIDARYSKPMVGA GYVVGPSIFLGTPGVVSYYLTLYIGGEPQALPETLVSTGRIATDCREYLDAAEEEAARELPHAFIGDVKGTTVGGCH HITSKYLPRSLPKDSVAVVGVSSPGRAAKAVCTLTDVYLPELRPYLQPETASKCWKLKLDFRDVRLMVWKGATAYFQ LEGLTWSALPDYARFIQLPKDAVVYIDPCIGPATANRKVVRTTDWRADLAVTPYDYGAQVILTTAWFEDLGPQWKIL GLQPFRRTFGFENTEDWAILARRMNDGKDYTDYNWHCVRERPHAIYGRARDHTYHFALGTELQVELGRPRLPPEQVP SEQIDNO:13ORF2OFPARENTALPRRSVSTRAIN94881ENCODEDBY SEQUENCEOFSEQIDNO:10BETWEENNUCLEOTIDES11611...12360 MQWVHCGVKSVSCSWMPSLSSLLVWLTLSSFSPYCLGSLLQAGYWSSFSEWFAPRFSVRALPFTLPNYRRSYEGLLP NCRPDVPQFAVKHPLGILWHMRVSHLIDEMVSRRIYRTMEHSGQAAWKQVVSEATLTKLSRLDVVTHFQHLAAVEAD SCRFLSSRLAMLKNLAVGNVSLEYNTTLDRVELIFPTPGTRPKLTDFRQWLISVHASIFSSVASSVTLFTVLWLRIP ALRYVFGFHWPTATHHSN SEQIDNO:14ORF3OFPARENTALPRRSVSTRAIN94881ENCODEDBY SEQUENCEOFSEQIDNO:10BETWEENNUCLEOTIDES12219...13016 MAYQRARFHLLLCGFVCYLVHSALASNSSSTLCFWFPLAHGNTSFELTINYTICKPCPTSQAAQQRLEPGRNVWCKI GHDRCEERDHDELSMSIPSGYDNLKLEGYYAWLAFLSFSYAAQFHPELFGIGNVSRVFVDKRHQFICAEHDGQNSTI SARHNISASYAVYYHHQIDGGNWFHLEWLRPFFSSWLVLNISWFLRRSPASPASRRIYQILRPTRPRLPVSWSFRTS IVSNLTGPQQRKVPLPSGGRPNVVKPSAFPSTSR SEQIDNO:15ORF4OFPARENTALPRRSVSTRAIN94881ENCODEDBY SEQUENCEOFSEQIDNO:10BETWEENNUCLEOTIDES12761...13312 MAATILFLLAGAQHLMVSEAFACKPCFSTHLSDIKTNTTAAAGFMVLQNINCFQSHRASTAQGTTPLRRSSQCREAV GIPQYITITANVTDESYLYNADLLMLSACLFYASEMSEKGFKVIFGNISGVVSACVNFTDYVAHVTQHTQQHHLVID HIRLLHFLTPSTMRWATTIACLFAILLAV SEQIDNO:16ORF5OFPARENTALPRRSVSTRAIN94881ENCODEDBY SEQUENCEOFSEQIDNO:10BETWEENNUCLEOTIDES13309...13914 MKCSCKLGHFLTPHSCFWWLFLLCTGLSWSFVDGNDNSSTSQYIYNLTICELNGTEWLSGHFDWAVETFVLYPVATH IISLGFLTTSHFLDALGLGAVSATGFIGERYVLSSMYGVCAFAALVCFVIRAAKNCMACRYARTRFTNFIVDDRGRI HRWKSSIVVEKLGKAEVGGDLVNIKHVVLEGVKAQPLTRTSAEQWEA SEQIDNO:17ORF6OFPARENTALPRRSVSTRAIN94881ENCODEDBY SEQUENCEOFSEQIDNO:10BETWEENNUCLEOTIDES13902...14423 MGSLDDFCNDPTAAQKLVLAFSITYTPIMIYALKVSRGRLLGLLHILIFLNCSFTFGYMTYVHFQSTNRVALTLGAV VALLWGVYSLTESWKFITSRCRLCCLGRRYILAPAHHVESAAGLHSIPASGNRAYAVRKPGLTSVNGTLVPGLRSLV LGGKRAVKRGVVNLVKYGR SEQIDNO:18ORF7OFPARENTALPRRSVSTRAIN94881ENCODEDBY SEQUENCEOFSEQIDNO:10BETWEENNUCLEOTIDES14413...14799 MAGKNQSQKKRRNAAPMGKGQPVNQLCQLLGTMIKSQRQQSRGGQAKKKKPEKPHFPLAAEDDIRHHLTQAERSLCL QSIQTAFNQGAGTASLSSSGKVSFQVEFMLPVAHTVRLIRVTSTSASQGAN SEQIDNO:19NucleotideencodingattenuatedPRRSV94881ORF1A 178 ATG 181 TCTGGGATGTTCTCCCGGTGCATGTGCACCCCGGCTGCCCGGGTATTTTGGAACGCCGGC 241 CAAGTCTATTGCACACGGTGTCTCAGTGCACGGTCTCTTCTCTCTCCAGAACTTCAGGAC 301 ACGGACCTCGGTGCAGTTGGCTTGTTTCACAAGCCTAAAGACAAGCTCCATTGGAAAGTT 361 CCCATTGGTATCCCCCAGGTGGAATGTTCTCCATCTGGGTGTTGCTGGCTGTCAACCATT 421 TTTCCTTTAGCGCGCATGACCTCCGGCAATCACAACTTCCTTCAACGACTCGTGAAGGTT 481 GCTGATGTATTGTACCGTGACGGTTGCTTAACCCCTAGACACCTCCGTGAACTCCAAGTT 541 TACGAGCGTGGTTGCAATTGGTATCCGATTACGGGGCCTGTGCCTGGGATGGCTGTGTAC 601 GCGAACTCCATGCACGTGTCCGACCAACCGTTCCCTGGTGCCACTCATGTGTTAACAAAT 661 TCCCCTTTGCCTCAACGGGCTTGTCGGCAGCCGTTCTGTCCGTTCGAAGAGGCCCATTCT 721 AGCATATACAGGTGGGAAAAATTTGTAATTTTTATGGATTCCTCCTCCGACGGTCGATCT 781 CGCATGATGTGGACTCCGGAATCCGATGACTCCACGGCTTTGGAAGTTCTGCCGCCCGAG 841 CTAGAACACCAGGTCAAGGTCCTTGTTCGGAGCTTTCCCGCCCATCACCTTGTCGACCTT 901 GCCGATTGGGAGCTCACTGAGTCCCCTGATAACGGTTTTTCCTTCAGCACGTCACATCCT 961 TGCGGCTACCTTGTTCGGGACCCGGCTGTATCCGAAGGCAAGTGTTGGCTTTCCTGCTTT 1021 TTGAGCCAGTCAGCCGAAGTGCTCAGTCGCGAGGCGCATCTGGCTACCGCCTATGGTTAC 1081 CAAACCAAGTGGGGTGTGCCTGGCAAGTACATCCAGCGCAGACTTCAAGTTCACGGTCTC 1141 CGTGCTGTGGTCGACCCTGATGGTCCCATTCACGTTGAAGCATTGTCTTGCCCCCAGTCT 1201 TGGATCAGGCACTTGACCCTGAATGATGATGTCACCCCGGGATTCGTTCGCCTAATGTCT 1261 CTTCGCATTGTGCCGAACACAGAGCCTACCACACACCGGATCTTTCGTTTTGGAGTGCAC 1321 AAGTGGTATGGTGCCGCCGGCAAACGGGCCCGTGGCAAGCGTGCCGCCAAAAGTGAGAAA 1381 GACTCGGCTTCCACCCTCAAGGTTGCCCGACCGACTTCCACCAGTGGAATCGTCACCTAC 1441 TCCCCACCTGCGGACGGGTCTTGTGGTTGGCATGCCCTTGCCGCCATACTGAACCGGATG 1501 ATTAATAATGACTTCACGTCCCCTCTGCCTCGGTACAACAGGCCGGAGGACGATTGGGCT 1561 TCTGATGGTGACCTTGCTCAGGCCATTCAATGTTTGCAACTACCTGCCGCCATAGCTCGG 1621 AACCGCGCCTGCCCTAACGCCAAATACCTCATAAAACTCAACGGAGTTCATTGGGAGGTA 1681 GAGGTGAGGCCTGGAATGGCTCCTCGCTCCCTCTCTCGTGAGTGCGTTGTTGGCGTCTGC 1741 TCTGAAGGCTGTGTCGCGTCGCCTTACCCGGAGGACGGGTTGCCTAAACGTGCACTTGAG 1801 GCCCTGGCGTCTGCTTATAGACTGCCTTCAGACTGTGTTTGTGATGGTATTATTGACTTC 1861 CTTGCCAATCCACCTCCCCAGGAGTTCTGGACTCTTGACAAAATGTTGACTTCCCCGTCA 1921 CCGGAGCAGTCCGGCTTCTCTAGTCTGTATAAATTGTTGTTAGAGATCTTGCCGCAGAAA 1981 TGCGGATCCACAGAAGGGGAATTCATCTATACTGTTGAGAGGATGTTGAAGGATTGTCCG 2041 AGCTCCAAACAGGCCATGGCCCTCCTTGCAAAAATTAAGGTCCCATCCTCAAAGGCCCCA 2101 TCCGTGACTCTGAACGAGTGCTTCCCCACGGATGTTCCAGTCAACTCTGAGTTAATATCT 2161 TGGGAAGAGCCCAAAGACCCTGGCGCTGCTGTTGTCCTATGTCCATCGGATGCAAAAGAA 2221 TCTAAGGAAACAGCCCCTGAAGAAGCTCAAGCGAGAAACCGTAAGGTCCTTCACCCTGTG 2281 GTCCTTACCGAGGAACTTAGCGAGCAACAGGTGCAGGTGGTTGAGGGTGATCAGGATATG 2341 CCACTGGATTTGACTTGGCCAACCTTAACCGCTACGGCGACCCCTGTTAGAGGGCCGGTA 2401 CCGGACAATTTGAGCTCTGGCATTGGTGCCCAGCCCGCTACCGTTCAAGAACTCATTCTG 2461 GCGAGGCCTGCACCCCGTCTTGTTGAGCGCTGTGGCACGGAGTCGAACGGCAGCAGTTCA 2521 TTTCTGGATTTGCCTGACGTGCAGACCTCGGACCAGCCTTTAGACCTGTCCCTGGCCGCG 2581 TGGCCTGTAAGGGCTACCGCGTCTGACCCCGGTTGGATCCACGGTAGGCGTGAGCCTGTC 2641 TTTGTGAAGCCTCGAGGTGTTTTCTCTGATGGCGAGTCGGCCCTTCAGTTCGGAGAGCTT 2701 TCCGAAGCCAGTTCTGTCGTCGATGACCGGACAAAAGAAGCTCCGGTGGTTGACGCCCCC 2761 ATCGATTTGACAACTTCGAACGAGACGCTCTCTGGGTCTGACCCCTTTGAATTCGCCAAA 2821 TTCAGGCGCCCGCGTTTCTCCGCGCAAGCTTTAATCGACCGAGGTGGTCCGCTTGCCGAT 2881 GTTCATGCAAAGATAAAGAGTCGGGTATATGAACAATGCCTTCAAGCTTGTGAACCTGGT 2941 AGTCGTGCGACCCCAGCCACCAAGAAGTGGCTCGACAAAATGTGGGACAGGGTGGACATG 3001 AAAACTTGGCGCTGCACCTCGCAGTTCCAAGCTGGTCACATTCTTGAGTCCCTCAAATTC 3061 CTCCCTGACATGATTCAAGACACACCGCCTCCTGTTCCCAGGAAGAACCGAGCTGGTGAC 3121 AGTGCCGGCCTGAAGCAACTGGTGGCGCAGTGGGATAGGAAATCGAGTGTGACACCCCCC 3181 ACAAAACCGGTTGGACCGGTGCTTGACCAGGCCGTCCCTCTGCCTATGGACATCCAGCAA 3241 GGAGATGCCATCTCCGCTGACAAGCCACCCCATTCGCAAAACCCTTCTAGTCAAGTAGAT 3301 GTGGGTGGAGGTTGGAAAAGTTTTATGCTCTCCGGCACCCGTTTCGCGGGGTCCGTTAGT 3361 CAGCGCCTTACGACATGGGTTTTTGAGGTTCTCTCCCATCTCCCAGCTTTTATGCTCACA 3421 CTTTTCTCGCCACGGGGCTCTATGGCTCCAGGTGATTGGCTGTTTGCAGGTGCTGTTCTA 3481 CTTGCTCTCCTGCTCTGCCGTTCTTACCCAATACTCGGATGCCTTCCCTTATTGGGTGTC 3541 TTTTCTGGTTCTGTGCGGTGTGTTCGTTTGGGTGTTTTTGGTTCTTGGATGGCTTTTGCT 3601 GTATTTTTATTCTCGACTCCACCCGACCCAGTCGGTTCTTCTTGTGACCACGATTCGCCG 3661 GAGTGTCATGCTGAGCTTTTGGCTCTTGAGCAGCGCCAACTTTGGGAACCTGTGCGCAGC 3721 CTTGTGGTCGGGCCATCGGGCCTCTTATGCGTCATTCTTGGCAAGTTACTCGGTGGGTCA 3781 CGTTGTCTCTGGTTTGTTCTCCTACGTATATGCATGCTCGCAGATTTGGCAATTTCTCTT 3841 ATTTATGTGGTGTCCCAAGGGCGTTGTCACAAGTGTTGGGGAAAGTGTATAAGGACGGCT 3901 CCTGCAGAAGTGGCCCTTAATGTGTTTCCTTTTTCGCGCGCCACCCGCTCATCTCTTGTG 3961 TCCTTGTGTGATCGGTTCCAAGCGCCAAAAGGAGTTGACCCCGTGCACTTGGCGACAGGC 4021 TGGCGCGGGTGCTGGTGTGGTGAGAGCCCTATTCATCAATCACACCAAAAACCGATAGCT 4081 TATGCCAACTTGGATGAAAAGAAGATATCCGCCCAGACGGTGATTGCTGTCCCGTATGAT 4141 CCTAGTCAGGCCATTAAATGCCTGAAAGTTTTGCAGGCAGGAGGGGCTATTGTGGACCAG 4201 CCTACGCCCGAGGTCGTCCGTGTGTCTGAGATTCCCTTCTCGGCCCCATTTTTTCCGAAG 4261 GTCCCAGTCAACCCAGACTGCAGGGTTGTGGTAGATTCGGACACTTTTGTGGCTGCGGTC 4321 CGCTGCGGTTATTCGACAGCACAACTGGTCCTTGGTCGGGGCAACTTTGCCAAGCTAAAT 4381 CAGACCCCCCTCAGGAACTCTGTCCCCACCAAAACAACTGGTGGGGCCTCATACACCCTT 4441 GCCGTGGCCCAGGTATCTGTGTGGACTCTTGTTCATTTCATCCTCGGCCTTTGGTTAACG 4501 TCACCTCAAGTGTGTGGTCGAGGGACCTCTGACCCGTGGTGTTCGAACCCTTTTTCGTAT 4561 CCTACTTATGGCCCCGGAGTTGTGTGTTCCTCTCGACTCTGCGTGTCTGCCGACGGAGTT 4621 ACCCTGCCATTGTTCTCAGCCGTTGCCCATCTTTCCGGTAGAGAGGTGGGGATTTTTATT 4681 TTGGTGCTTGCCTCCTTGGGCGCTTTAGCCCACCGCTTGGCTCTTAAGGCAGACATGTCA 4741 ATGGTCTTTTTGGCGTTTTGTGCTTACGCCTGGCCCATGAGCTCCTGGTTAATTTGCTTC 4801 TTTCCTATGCTCTTGAGGTGGGTAACCCTTCATCCTCTCACTATGCTTTGGGTGCACTCA 4861 TTTTTGGTGTTTTGCCTACCAGCTGCCGGCGTTCTCTCGCTGGGAATAACCGGTCTTCTT 4921 TGGGCAGTTGGCCGTTTCACCCAGGTTGCCGGAATTATCACACCTTATGACATCCACCAG 4981 TATACCTCCGGACCACGTGGTGCAGCTGCTGTAGCAACGGCTCCAGAAGGTACTTACATG 5041 GCGGCCGTTCGGAGAGCCGCTTTGACTGGACGGACTTTGATCTTCACACCATCTGCAGTC 5101 GGATCCCTTCTTGAAGGTGCTTTCAGAACTCAAAAGCCCTGCCTTAACACCGTGAATGTC 5161 GTAGGCTCTTCCCTTGGTTCTGGAGGAGTTTTCACCATTGATGGCAGAAGAGTCATCGTC 5221 ACTGCCACCCATGTGTTGAATGGTAACACAGCCAGGGTCACTGGTGATTCCTACAACCGC 5281 ATGCACACGTTCAATACTAATGGTGATTATGCCTGGTCCCATGCTGATGACTGGCAAGGC 5341 GTTGCCCCTATGGTTAAGATCGCTAAGGGGTATCGCGGTCGTGCCTACTGGCAAACGTCA 5401 ACCGGAGTCGAACCTGGCATCATGGGGGAAGGATTCGCCTTCTGTTTCACTAACTGTGGC 5461 GACTCAGGGTCACCTGTCATTTCAGAAGCTGGTGACCTTATTGGAGTCCATACCGGTTCA 5521 AACAAACTCGGTTCTGGTCTTGTGACAACCCCTGAAGGGGAGACCTGCTCCATCAAGGAA 5581 ACTAGGCTCTCTGACCTTTCTAGACATTTTGCAGGTCCAAGCGTCCCTCTTGGGGACATT 5641 AAGTTGAGCCCAGCCATCATCCCTGATGTGACAACTATTCCGAGTGACTTGGCATCGCTC 5701 CTTGCTTCTGTCCCCGTGATGGAAGGTGGCCTCTCAACTGTCCAGCTTTTGTGCGTCTTT 5761 TTCCTTCTCTGGCGCATGATGGGCCATGCCTGGACACCCATTGTTGCCGTAGGCTTCTTT 5821 TTGCTGAATGAAATTCTCCCAGCAGTCTTGGTCCGAGCTGTGTTCTCTTTTGCACTCTTT 5881 GTACTTGCATGGGCCACCCCCTGGTCGGCACAAGTGTTGATGATTAGACTCCTCACGGCG 5941 GCTCTCAACCGCAACAGGTTGTCCCTGGCGTTCTACGCATTCGGAGGTGTCGTTGGCCTG 6001 GCCACAGAAATCGGGACTTTTGCTGGTGGATGGCCTGAACTGTCCCAAGCCCTCTCGACA 6061 TACTGCTTCCTGCCCAGGTTCCTTGCTGTGACTAGTTATGTCCCCACCATCATCATCGGT 6121 GGGCTCCATGCCCTCGGCGTAATTTTGTGGTTATTCAAATACCGATGCCTCCACAACATG 6181 CTGGTTGGTGATGGGAGTTTCTCAAGCGCTTTCTTCCTACGGTATTTTGCTGAGGGTAAT 6241 CTTAGGAAAGGCGTGTCGCAGTCCTGTGGCATGAATAACGAATCCCTGACAGCTGCTTTG 6301 GCTTGCAAGTTGTCGCAAGCTGACCTTGATTTTTTGTCCAGTTTAACGAACTTCAAGTGC 6361 TTTGTGTCCGCTTCAAACATGAAAAATGCAGCTGGCCAATACATCGAGGCGGCGTATGCT 6421 AGAGCTCTGCGTCAGGAGCTGGCCTCCTTGGTTCAGGTTGACAAGATGAAAGGAGTATTG 6481 GCCAAGCTCGAGGCTTTCGCTGAGACGGCCACTCCGTCACTTGACACAGGGGACGTGATT 6541 GTTCTGCTTGGGCAACACCCCCATGGATCCATCCTCGACATTAATGTGGGGGGTGAAAGG 6601 AAAACTGTGTCTGTGCAAGAAACACGATGCCTGGGTGGTTCCAAATTCAGTGTCTGCACT 6661 GTCGTGTCCAACACGCCCGTGGATACCTTGACCGGTATCCCACTTCAGACGCCAACCCCA 6721 CTTTTTGAAAATGGCCCGCGCCATCGCAGCGAGGACGACGACCTCAAAGTTGAGAGAATG 6781 AAAAAACACTGTGTATCCCTCGGCTTCCACAAAATCAATGGTAAAGTTTACTGCAAAATT 6841 TGGGACAAGTCTAACGGCGACACCTTTTACACGGATGATTCCCGATACACTCAAGACCAT 6901 GCTTTTCAGGACAGGTCAACCGACTATAGAGACAGGGATTATGAAGGTGTACAGACCGCC 6961 CCCCAACAGGGATTCGATCCAAAGTCCGAAGCCCCTGTTGGCACTGTTGTAATCGGTGGC 7021 ATTACGTATAACAGGCATCTGGTCAAAGGTAAGGAGGTCCTAGTTCCCAAACCTGACAAC 7081 TGCCTTGAAGCTGCCAGACTGTCCCTTGAGCAAGCTCTTGCTGGGATGGGCCAAACTTGT 7141 GACCTTACAGCTACCGAAGTGGAGAAACTAAAGCGCATCATTAGTCAACTCCAAGGTCTG 7201 ACCACTGAACAGGCTTTAAACTGCTAG SEQIDNO:20NucleotideencodingattenuatedPRRSV94881ORF1B 7209 ACAGGCTTTAAACTGCTAGCCGCCAGCGGCTTGACCCGCTGTGGCCGCGGCG 7261 GCCTAGTTGTAACTGAAACGGCGGTAAAAATCGTAAAATACCACAGCAGAACTTTCACCT 7321 TAGGCTCTTTAGACCTAAAAGTCACCTCCGAGGTGGAGGTGAAGAAATCAACTGAGCAGG 7381 GGCACGCTGTCGTGGCGAACTTATGTTCCGGTGTCGTCTTGATGAGGCCTCACCCACCGT 7441 CCCTTGTTGACGTTCTCCTCAAACCCGGACTTGACACAACACCCGGCATTCAACCAGGGC 7501 ATGGGGCCGGGAATATGGGCGTGAACGGTTCTATTTGGGATTTTGAAACTGCACCCACAA 7561 AGGTAGAACTAGAGTTGTCCAAGCAAATAATCCAAGCATGTGAAGTCAGGCGCGGGGACG 7621 CCCCTAACCTCCAACTCCCCTACAAGCTTTATCCTGTCAGGGGGGACCCCGAGCGGCGTA 7681 AAGGTCGCCTTGTCAACACTAGGTTTGGAGATTTACCTTACAAAACTCCCCAAGACACCA 7741 AGTCCGCAATTCATGCGGCTTGTTGCCTGCATCCCAATGGGGTCCTCGTGTCTGATGGCA 7801 AATCCACGCTGGGTACCACTCTTCAACATGGTTTCGAGCTTTATGTCCCCACTGTACCTT 7861 ATAGTGTCATGGAATACCTTGATTCACGCCCTGACACCCCTTTTATGTGTACTAAACATG 7921 GCACTTCCAAGGCTGCTGCAGAGGACCTCCAAAAATATGACCTATCCACTCAAGGGTTTG 7981 TCTTGCCTGGGGTCCTACGCCTAGTGCGCAGGTTCATCTTTAGCCATGTTGGTAAGGCGC 8041 CACCACTGTTCCTTCCATCAACCTACCCTGCCAAGAACTCCATGGCAGGGGTCAATGGCC 8101 AGAGGTTCCCAACAAAGGATGTCCAGAGCATACCTGAAATTGATGAAATGTGCGCCCGTG 8161 CCGTCAAGGAAAATTGGCAGACTGTGACACCTTGCACCCTCAAAAAACAGTACTGTTCCA 8221 AACCTAAAACTAGAACCATCCTAGGTACCAACAACTTCATAGCCTTGGCTCACAGGTCAG 8281 CACTCAGTGGTGTCACCCAGGCGTTCATGAAGAAGGCCTGGAAGTCCCCAATTGCCTTGG 8341 GGAAAAACAAGTTTAAGGAATTGCATTGCACTGTCGCCGGCAGATGCCTTGAGGCTGACC 8401 TGGCTTCCTGCGATCGCAGCACCCCCGCCATTGTGAGGTGGTTTGTTGCCAACCTCCTGT 8461 ATGAACTTGCAGGATGTGAAGAGTACTTGCCTAGCTACGTGCTCAACTGTTGCCATGACC 8521 TTGTGGCAACGCAGGATGGCGCTTTCACAAAACGCGGTGGCCTGTCGTCCGGGGACCCCG 8581 TCACCAGTGTGTCCAACACCGTCTACTCACTGATAATTTACGCCCAGCACATGGTGCTTT 8641 CGGCCTTGAAGATGGGTCATGAAATTGGTCTCAAGTTCCTTGAGGAACAGCTCAAATTTG 8701 AGGACCTTCTTGAAATCCAGCCCATGTTAGTGTATTCTGATGACCTCGTCTTGTATGCGG 8761 AAAGACCCACTTTTCCCAACTACCATTGGTGGGTCGAGCATCTTGACCTGATGTTGGGCT 8821 TTAAAACGGACCCAAAGAAAACTGTCATAACTGATAAACCCAGTTTTCTCGGCTGCAGAA 8881 TTGAAGCAGGACGGCAGTTAGTCCCCAATCGCGACCGTATTCTGGCTGCTCTTGCATATC 8941 ATATGAAGGCGCAGAACGCCTCAGAGTATTATGCGTCCGCTGCCGCAATTCTGATGGATT 9001 CGTGTGCTTGCATTGACCATGACCCCGAGTGGTATGAGGATCTTATCTGCGGCATCGCCC 9061 GGTGTGCTCGCCAGGACGGTTACCGTTTTCCAGGCCCGGCATTTTTCATGTCCATGTGGG 9121 AGAAGCTGAAAAGTCATAATGAAGGGAAGAAATGCCGTCACTGCGGCATCTGCGACGCCA 9181 AAGCCGACTATGCGTCCGCCTGTGGACTTGATTTGTGTTTGTTCCATTCACACTTTCATC 9241 AACACTGCCCAGTCACTCTGAGCTGTGGCCACCATGCCGGTTCAAAGGAATGTTCGCAGT 9301 GTCAGTCACCTGTCGGGGCTGGCAAATCCCCCCTTGACGCTGTGCTGAAACAAATCCCGT 9361 ACAAACCTCCTCGTACCATTATCATGAAGGTGGACAACAAAACAACGACCCTTGACCCGG 9421 GAAGATATCAGTCCCGTCGAGGTCTTGTTGCAGTCAAAAGAGGTATTGCAGGTAATGAGG 9481 TTGATCTTTCTGATGGAGACTACCAAGTGGTGCCTCTTTTGCCGACTTGCAAAGACATAA 9541 ACATGGTGAAGGTGGCTTGCAACGTACTACTCAGCAAGTTTATAGTAGGGCCGCCAGGTT 9601 CCGGAAAAACCACCTGGCTACTGAACCAAGTCCAGGACGATGATGTCATTTACACACCTA 9661 CTCATCAGACAATGTTTGACATAGTCAGTGCTCTTAAAGTTTGCAGGTATTCCATCCCAG 9721 GAGCCTCAGGACTCCCTTTTCCACCACCTGCCAGGTCCGGGCCGTGGGTTAGGCTCATCG 9781 CCAGCGGACATGTCCCTGGCCGAGTGTCATATCTCGATGAGGCAGGATATTGCAATCATC 9841 TAGACATTCTAAGGCTGCTTTCCAAAACACCCCTTGTGTGTTTGGGTGACCTTCAGCAAC 9901 TTCACCCGGTCGGCTTTGATTCCTATTGTTATGTGTTCGATCAGATGCCTCAGAAGCAGC 9961 TGACCACCATTTATAGATTTGGCCCTAACATCTGTGCAGCCATCCAGCCTTGTTACAGGG 10021 AGAAACTTGAATCCAAGGCCAGGAACACCAGAGTGGTTTTCACCACCCGGCCTGTGGCCT 10081 TTGGTCAGGTCCTGACACCGTACCACAAAGATCGTACCGGCTCTGCAATAACTATAGATT 10141 CATCCCAGGGGGCGACCTTCGACATTGTGACATTGCATCTACCATCGCCAAAGTCCCTAA 10201 ACAAATCCCGAGCACTTGTAGCCATCACTCGGGCAAGACATGGGTTGTTCATTTATGACC 10261 CTCATGACCAACTCCAGGAGTTTTTCAACTTAACCCCCGAGCGCACTGATTGTAACCTTG 10321 CGTTCAGCCGTGGGGATGAGCTGGTTGTTTTGAATGTGGATAATGCGGTCACAACTGTAG 10381 CGAAGGCCCTAGAGACAGGTTCACCCCGATTTCGAGTATCGGACCCGAGGTGCAAGTCTC 10441 TCTTAGCCGCTTGTTCGGCCAGTCTAGAAGGGAGCTGCATGCCACTACCACAAGTAGCAC 10501 ATAACCTGGGGTTTTACTTTTCCCCGGACAGCCCAGCTTTTGCACCCCTGCCAAAAGAGC 10561 TGGCGCCACATTGGCCAGTGGTCACCCACCAGAATAATCGAGCGTGGCCTGATCGACTTG 10621 TCGCTAGTATGCGCCCAATTGATGCCCGCTACAGCAAGCCAATGGTCGGTGCAGGGTATG 10681 TGGTCGGGCCATCCATTTTTCTTGGCACTCCTGGTGTGGTGTCATACTATCTCACATTAT 10741 ACATCGGGGGCGAGCCTCAGGCCCTGCCAGAAACACTCGTTTCAACAGGACGTATAGCCA 10801 CAGATTGTCGGGAATATCTCGACGCGGCTGAGGAAGAGGCAGCGAGAGAACTTCCCCACG 10861 CATTTATTGGCGATGTCAAAGGCACTACGATCGGGGGGTGTCACCACATTACATCGAAAT 10921 ACCTACCTAGGTCCCTGCCTAAAGACTCTGTTGCTGTGGTTGGGGTGAGTTCGCCCGGTA 10981 GGGCTGCTAAAGCCGTGTGCACTCTCACCGATGTGTACCTCCCCGAACTCCGACCATATT 11041 TGCAACCGGAGACGGCATCAAAATGCTGGAAACTTAAACTGGATTTCAGGGATGTTCGAC 11101 TGATGGTCTGGAAAGGCGCCACAGCCTATTTCCAGTTGGAAGGGCTGACATGGTCAGCGC 11161 TGCCCGATTATGCTAGGTTCATTCAGCTACCCAAGGATGCCGTTGTGTACATCGATCCGT 11221 GTATAGGGCCGGCAACAGCCAATCGCAAGGTTGTGCGAACCACAGACTGGCGGGCCGACC 11281 TGGCAGTGACACCGTATGATTACGGTGCTCAGGTCATTTTGACAACAGCCTGGTTCGAGG 11341 ACCTTGGGCCGCAGTGGAAGATTTTGGGGTTGCAGCCTTTCAGACGAACATTTGGCTTTG 11401 AGAACACTGAAGATTGGGCAATTCTCGCACGCCGTATGAATGACGGCAAAGATTACACTG 11461 ACTATAATTGGCATTGTGTACGAGAACGCCCACACGCAATTTACGGGCGCGCCCGTGACC 11521 ATACGTATCATTTTGCCCTTGGCACTGAACTGCAAGTAGAGCTGGGCAGACCCCGGCTGC 11581 CTCCTGAGCAAGTGCCGTGA SEQIDNO:21NucleotideencodingattenuatedPRRSV94881ORF2 11611 ATGCAATGGGTTTACTGTGGAGTAAAATCA 11641 GTCAGTTGTTCGTGGATGCCTTCACTGAGTTCCTTGTTAGTGTGGTTGACATTGTCATCT 11701 TTCTCGCCATATTGTTTGGGTTCACTGTTGCAGGCTGGTTATTGGTCTTCCTTCTCAGAG 11761 TGGTTTGCTCCGCGTTTCTCCGTTCGCGCTCTGCCATTCACTCTTCCGAACTATCGAAGG 11821 TCCTATGAGGGCTTGCTACCCAACTGCAGACCGGATGTCCCACAATTCGCAGTTAAGCAC 11881 CCGTTGGGTATACTTTGGCATATGCGAGTCTCCCACCTAATTGACGAAATGGTCTCTCGC 11941 CGCATTTACCGGACCATGGAACATTCGGGTCAAGCGGCCTGGAAGCAGGTTGTTAGTGAA 12001 GCCACTCTCACAAAACTGTCAAGGCTTGACGTAGTCACTCATTTCCAACACCTGGCCGCA 12061 GTGGAGGCTGATTCTTGCCGCTTCCTTAGCTCACGACTCGCGATGCTGAAAAACCTTGCC 12121 GTTGGCAATGTGAGCCTGGAGTACAACACTACTTTGGACCGCGTTGAGCTCATCTTTCCC 12181 ACACCAGGTACGAGGCCCAAGTTGACCGATTTTAGGCAATGGCTTATCAGCGTGCACGCT 12241 TCCATCTTCTCCTCTGTGGCTTCGTCTGTTACCTTGTTCACAGTGCTTTGGCTTCGAATT 12301 CCAGCTCTACGCTATGTTTTTGGTTTCCATTGGCCCACGGCAACACATCATTCGAACTAA SEQIDNO:22NucleotideencodingattenuatedPRRSV94881ORF3 12219 ATGGCTTATCAGCGTGCACGCT 12241 TCCATCTTCTCCTCTGTGGCTTCGTCTGTTACCTTGTTCACAGTGCTTTGGCTTCGAATT 12301 CCAGCTCTACGCTATGTTTTTGGTTTCCATTGGCCCACGGCAACACATCATTCGAACTAA 12361 CTATCAATTACACTATATGTAAGCCATGCCCTACCAGTCAAGCTGCCCAACAAAGACTCG 12421 AGCCTGGCCGTAACGTGTGGTGCAAAATAGGGCACGACAGGTGTGAGGAACGTGACCATG 12481 ATGAGTTGTCAATGTCCATTCCGTCCGGGTACGACAACCTCAAACTTGAGGGTTATTATG 12541 CTTGGCTGGCTTTTTTGTCCTTTTCCTACGCGGCCCAATTCCATCCGGAGCTGTTCGGAA 12601 TAGGAAACGTGTCGCGCGTCTTTGTGGATAAGCGACACCAGTTCATTTGCGCCGAGCATG 12661 ATGGACAAAATTCAACCATATCTGCCAGACACAACATCTCCGCGTCGTATGCGGTGTATT 12721 ACCATCATCAAATAGACGGGGGCAATTGGTTTCATTTGGAATGGCTGCGACCATTCTTTT 12781 CCTCCTGGCTGGTGCTCAACATCTCATGGTTTCTGAGGCGTTCGCCTGCAAGCCCTGCTT 12841 CTCGACGCATCTATCAGATATTAAGACCAACACGACCGCGGCTGCCGGTTTCATGGTCCT 12901 TCAGAACATCAATTGTTTCCAATCTCACAGGGCCTCAACAGCGCAAGGTACCACTCCCCT 12961 CAGGAGGTCGTCCCAATGTCGTGAAGCCGTCGGCATTCCCCAGTACATCACGATAA SEQIDNO:23NucleotideencodingattenuatedPRRSV94881ORF4 12761 ATGGCTGCGACCATTCTTTT 12781 CCTCCTGGCTGGTGCTCAACATCTCATGGTTTCTGAGGCGTTCGCCTGCAAGCCCTGCTT 12841 CTCGACGCATCTATCAGATATTAAGACCAACACGACCGCGGCTGCCGGTTTCATGGTCCT 12901 TCAGAACATCAATTGTTTCCAATCTCACAGGGCCTCAACAGCGCAAGGTACCACTCCCCT 12961 CAGGAGGTCGTCCCAATGTCGTGAAGCCGTCGGCATTCCCCAGTACATCACGATAACGGC 13021 TAATGTGACCGATGAATCGTATTTGTACAACGCGGACTTGCTGATGCTTTCCGCGTGCCT 13081 TTTCTACGCCTCGGAAATGAGCGAGAAAGGCTTCAAAGTCATCTTTGGGAATATTTCTGG 13141 CGTTGTTTCCGCTTGTGTTAATTTCACAGATTATGTGGCCCATGTGACCCAACACACTCA 13201 GCAGCACCATTTGGTAATTGATCACATTCGGTTACTACACTTCTTGACACCGTCTACGAT 13261 GAGGTGGGCTACAACCATTGCTTGTTTGCTTGCCATTCTTTTGGCGGTATGA SEQIDNO:24NucleotideencodingattenuatedPRRSV94881ORF5 13309 ATGAAATGTTCT 13321 TGCAAGTTGGGGCATTTCTTGACTCCTCACTCTTGCTTCTGGTGGCTTTTTTTGCTGTGT 13381 ACCGGCTTGTCTTGGTCCTTTGTCGATGGCAACGACGACAGCTCGACATCCCAATACATA 13441 TATAATTTGACGATATGCGAGCTGAATGGGACCGAATGGTTGTCCGGTCATTTTGATTGG 13501 GCAGTCGAAACCTTTGTGCTTTACCCAGTTGCCACTCATATCATTTCACTGGGTTTTCTC 13561 ACAACAAGCCATTTCCTTGATGCGCTCGGTCTCGGCGCTGTGTCCGCCACAGGATTCATT 13621 GGCGAGCGGTATGTACTTAGCAGCATGTACGGCGTTTGCGCCTTCGCGGCGTTCGTATGT 13681 TTTGTCATCCGTGCTGCTAAAAATTGCATGGCTTGCCGCTATGCCCGCACCCGGTTTACC 13741 AACTTCATCGTGGACGACCGGGGAAGAATCCATCGATGGAAGTCTTCAATAGTGGTGGAG 13801 AAATTGGGCAAAGCTGAAGTCGGTGGTGACCTTGTCAACATTAAGCATGTTGTCCTCGAA 13861 GGGGTTAAAGCTCAACCTTTGACGAGGACTTCGGCTGAGCAATGGGAAGCCTAG SEQIDNO:25NucleotideencodingattenuatedPRRSV94881ORF6 13902 ATGGGAAGCCTAGACGACT 13921 TTTGCAACGATCCCACCGCCGCACAAAAACTCGTGCTGGCCTTTAGCATCACATATACAC 13981 CCATAATGATATACGCCCTTAAGGTGTCACGCGGCCGACTCCTGGGGCTGTTGCACATCT 14041 TGATATTTCTGAATTGTTCCTTTACTTTTGGGTACATGACATATGTGCATTTTCAATCCA 14101 CCAACCGTGTCGCATTCACTCTGGGGGCTGTAGTCGCCCTTTTGTGGGGTGTTTACAGCC 14161 TCACAGAGTCATGGAAGTTCATCACTTCCAGATGCAGATTGTGTTGCCTAGGCCGGCGAT 14221 ACATTCTGGCCCCTGCCCATCACGTAGAAAGTGCTGCAGGCCTCCATTCAATCCCAGCGT 14281 CTGGTAACCGAGCATACGCTGTGAGAAAGCCCGGACTAACATCAGTGAACGGCACTCTAG 14341 TACCTGGGCTTCGGAGCCTCGTGCTGGGCGGCAAACGAGCTGTTAAACGAGGAGTGGTTA 14401 ACCTCGTCAAGTATGGCCGGTAA SEQIDNO:26NucleotideencodingattenuatedPRRSV94881ORF7 14413 ATGGCCGGTAAGAACCAGAGCCAGAAGAAAAGAAGAAATGCAGCTCCG 14461 ATGGGGAAAGGCCAGCCAGTCAATCAACTGTGCCAGTTGCTGGGTACAATGATAAAGTCC 14521 CAGCGCCAGCAATCTAGGGGAGGACAGGCCAAAAAGAAGAAGCCTGAGAAGCCACATTTT 14581 CCCCTAGCTGCTGAAGATGACATTCGGCACCATCTCACCCAGGCCGAACGTTCCCTCTGC 14641 TTGCAATCGATCCAGACGGCTTTCAATCAAGGCGCAGGAACTGCGTCGCTTTCATCCAGC 14701 GGGAAGGTCAGTTTCCAGGTTGAGTTCATGCTGCCGGTTGCTCATACAGTGCGCCTGATT 14761 CGCGTGACTTCTACATCCGCCAGTCAGGGTGCAAATTAATTTGACAGTCAGGTGAATGGC 14821 CGCGATTGACGTGTGGCCTCTAA SEQIDNO:27NucleotideencodingparentalPRRSV94881ORF1a 178 ATG 181 TCTGGGATGTTCTCCCGGTGCATGTGCACCCCGGCTGCCCGGGTATTTTGGAACGCCGGC 241 CAAGTCTATTGCACACGGTGTCTCAGTGCACGGTCTCTTCTCTCTCCAGAACTTCAGGAC 301 ACGGACCTCGGTGCAGTTGGCTTGTTTCACAAGCCTAAAGACAAGCTCCATTGGAAAGTT 361 CCCATTGGTATCCCCCAGGTGGAATGTTCTCCATCTGGGTGTTGCTGGCTGTCAACCATT 421 TTTCCTTTAGCGCGCATGACCTCCGGCAATCACAACTTCCTTCAACGACTCGTGAAGGTT 481 GCTGACGTATTGTACCGTGACGGTTGCTTAACCCCTAGACACCTCCGTGAACTCCAAGTT 541 TACGAGCGTGGTTGCAATTGGTATCCGATTACGGGGCCTGTGCCTGGGATGGCTGTGTAC 601 GCGAACTCCATGCACGTGTCCGACCAACCGTTCCCTGGTGCCACTCATGTGTTAACAAAT 661 TCCCCTTTGCCTCAACGGGCTTGTCGGCAGCCGTTCTGTCCGTTCGAAGAGGCCCATTCT 721 AGCATATACAGGTGGGAAAAATTTGTAATTTTTATGGATTCCTCCTCCGACGGTCGATCT 781 CGCATGATGTGGACTCCGGAATCCGATGACTCCACGGCTTTGGAAGTTCTGCCGCCCGAG 841 CTAGAACACCAGGTCAAGGTCCTTGTTCGGAGCTTTCCCGCCCATCACCTTGTCGACCTT 901 GCCGATTGGGAGCTCACTGAGTCCCCTGAGAACGGTTTTTCCTTCAGCACGTCACATCCT 961 TGCGGCTACCTTGTTCGGGACCCGGCTGTATCCGAAGGCAAGTGTTGGCTTTCCTGCTTT 1021 TTGAGCCAGTCAGCCGAAGTGCTCAGTCGCGAGGCGCATCTGGCTACCGCCTATGGTTAC 1081 CAAACCAAGTGGGGTGTGCCTGGCAAGTACATCCAGCGCAGACTTCAAGTTCACGGTCTC 1141 CGTGCTGTGGTCGACCCTGATGGTCCCATTCACGTTGAAGCATTGTCTTGCCCCCAGTCT 1201 TGGATCAGGCACTTGACCCTGAATGATGATGTCACCCCGGGATTCGTTCGCCTAATGTCT 1261 CTTCGCATTGTGCCGAACACAGAGCCTACCACACACCGGATCTTTCGTTTTGGAGTGCAC 1321 AAGTGGTATGGTGCCGCCGGCAAACGGGCCCGTGGCAAGCGTGCCGCCAAAAGTGAGAAA 1381 GACTCGGCTTCCACCCTCAAGGTTGCCCGACCGACTTCCACCAGTGGAATCGTCACCTAC 1441 TCCCCACCTGCGGACGGGTCTTGTGGTTGGCATGCCCTTGCCGCCATACTGAACCGGATG 1501 ATTAATAATGACTTCACGTCCCCTCTGCCTCGGTACAACAGGCCGGAGGACGATTGGGCT 1561 TCTGATGGTGACCTTGCTCAGGCCATTCAATGTTTGCAACTACCTGCCGCCATAGCTCGG 1621 AACCGCGCCTGCCCTAACGCCAAATACCTCGTAAAACTCAACGGAGTTCATTGGGAGGTA 1681 GAGGTGAGGCCTGGAATGGCTCCTCGCTCCCTCTCTCGTGAGTGCGTTGTTGGCGTCTGC 1741 TCTGAAGGCTGTGTCGCGTCGCCTTACCCGGAGGACGGGTTGCCTAAACGTGCACTTGAG 1801 GCCCTGGCGTCTGCTTATAGACTGCCTTCAGACTGTGTTTGTGATGGTATTATTGACTTC 1861 CTTGCCAATCCACCTCCCCAGGAGTTCTGGACTCTTGACAAAATGTTGACTTCCCCGTCA 1921 CCGGAGCAGTCCGGCTTCTCTAGTCTGTATAAATTGTTGTTAGAGGTCTTGCCGCAGAAA 1981 TGCGGATCCACAGAAGGGGAATTCATCTATACTGTTGAGAGGATGTTGAAGGATTGTCCG 2041 AGCTCCAAACAGGCCATGGCCCTCCTTGCAAAAATTAAGGTCCCATCCTCAAAGGCCCCA 2101 TCCGTGACTCTGAACGAGTGCTTCCCCACGGATGTTCCAGTCAACTCTGAGTTAATATCT 2161 TGGGAAGAGCCCAAAGACCCTGGCGCTGCTGTTGTCCTATGTCCATCGGATGCAAAAGAA 2221 TCTAAGGAAACAGCCCCTGAAGAAGCTCAAGCGAGAAACCGTAAGGTCCTCCACCCTGTG 2281 GTCCTTACCGAGGAACTTAGCGAGCAACAGGTGCAGGTGGTTGAGGGTGATCAGGATATG 2341 CCACTGGATTTGACTTGGCCAACCTTAACCGCTACGGCGACCCCTGTTAGAGGGCCGGTA 2401 CCGGACAATTTGAGCTCTGGCATTGGTGCCCAGCCCGCTACCGTTCAAGAACTCATTCTG 2461 GCGAGGCCTGCACCCCGTCTTGTTGAGCGCTGTGGCACGGAGTCGAACGGCAGCAGTTCA 2521 TTTCTGGATTTGCCTGACGTGCAGACCTCGGACCAGCCTTTAGACCTGTCCCTGGCCGCG 2581 TGGCCTGTAAGGGCTACCGCGTCTGACCCCGGTTGGATCCACGGTAGGCGTGAGCCTGTC 2641 TTTGTGAAGCCTCGAGGTGTTTTCTCTGATGGCGAGTCGGCCCTTCAGTTCGGAGAGCTT 2701 TCCGAAGCCAGTTCTGTCGTCGATGACCGGACAAAAGAAGCTCCGGTGGTTGACGCCCCC 2761 ATCGATTTGACAACTTCGAACGAGACGCTCTCTGGGTCTGACCCCTTTGAATTCGCCAAA 2821 TTCAGGCGCCCGCGTTTCTCCGCGCAAGCTTTAATCGACCGAGGTGGTCCGCTTGCCGAT 2881 GTTCATGCAAAGATAAAGAGTCGGGTATATGAACAATGCCTTCAAGCTTGTGAACCTGGT 2941 AGTCGTGCGACCCCAGCCACCAAGAAGTGGCTCGACAAAATGTGGGACAGGGTGGACATG 3001 AAAACTTGGCGCTGCACCTCGCAGTTCCAAGCTGGTCACATTCTTGAGTCCCTCAAATTC 3061 CTCCCTGACATGATTCAAGACACACCGCCTCCTGTTCCCAGGAAGAACCGAGCTGGTGAC 3121 AGTGCCGGCCTGAAGCAACTGGTGGCGCAGTGGGATAGGAAATTGAGTGTGACACCCCCC 3181 ACAAAACCGGTTGGACCGGTGCTTGACCAGACCGTCCCTCTGCCTATGGACATCCAGCAA 3241 GAAGATGCCATCTCCGCTGACAAGCCACCCCATTCGCAAAACCCTTCTAGTCAAGTAGAT 3301 GTGGGTGGAGGTTGGAAAAGTTTTATGCTCTCCGGCACCCGTTTCGCGGGGTCCGTTAGT 3361 CAGCGCCTTACGACATGGGTTTTTGAGGTTCTCTCCCATCTCCCAGCTTTTATGCTCACA 3421 CTTTTCTCGCCACGGGGCTCTATGGCTCCAGGTGATTGGCTGTTTGCAGGTGCTGTTCTA 3481 CTTGCTCTCCTGCTCTGCCGTTCTTACCCAATACTCGGATGCCTTCCCTTATTGGGTGTC 3541 TTTTCTGGTTCTGTGCGGTGTGTTCGTTTGGGTGTTTTTGGTTCTTGGATGGCTTTTGCT 3601 GTATTTTTATTCTCGACTCCACCCGACCCAGTCGGTTCTTCTTGTGACCACGATTCGCCG 3661 GAGTGTCATGCTGAGCTTTTGGCTCTTGAGCAGCGCCAACTTTGGGAACCTGTGCGCAGC 3721 CTTGTGGTCGGGCCATCGGGCCTCTTATGCGTCATTCTTGGCAAGTTACTCGGTGGGTCA 3781 CGTTGTCTCTGGTTTGTTCTCCTACGTATATGCATGCTCGCAGATTTGGCAATTTCTCTT 3841 ATTTATGTGGTGTCCCAAGGGCGTTGTCACAAGTGTTGGGGAAAGTGTATAAGGACGGCT 3901 CCTGCAGAAGTGACCCTTAATGTGTTTCCTTTTTCGCGCGCCACCCGCTCATCTCTTGTG 3961 TCCTTGTGTGATCGGTTCCAAGCGCCAAAAGGAGTTGACCCCGTGCACTTGGCGACAGGC 4021 TGGCGCGGGTGCTGGTGTGGTGAGAGCCCTATTCATCAATCACACCAAAAACCGATAGCT 4081 TATGCCAACTTGGATGAAAAGAAGATATCCGCCCAGACGGTGATTGCTGTCCCGTATGAT 4141 CCCAGTCAGGCCATTAAATGCCTGAAAGTTTTGCAGGCAGGAGGGGCTATTGTGGACCAG 4201 CCTACGCCCGAGGTCGTCCGTGTGTCTGAGATTCCCTTCTCGGCCCCATTTTTTCCGAAG 4261 GTCCCAGTCAACCCAGATTGCAGGGTTGTGGTAGATTCGGACACTTTTGTGGCTGCGGTC 4321 CGCTGCGGTTATTCGACAGCACAACTGGTCCTTGGTCGGGGCAACTTTGCCAAGCTAAAT 4381 CAGACCCCCCTCAGGAACTCTGTCCCCACCAAAACAACTGGTGGGGCCTCATACACCCTT 4441 GCCGTGGCCCAGGTATCTGTGTGGACTCTTGTTCATTTCATCCTCGGCCTTTGGTTAACG 4501 TCACCTCAAGTGTGTGGTCGAGGGACCTCTGACCCGTGGTGTTCGAACCCTTTTTCGTAT 4561 CCTACTTATGGCCCCGGAGTTGTGTGTTCCTCTCGACTCTGCGTGTCTGCCGACGGAGTT 4621 ACCCTGCCATTGTTCTCAGCCGTTGCCCATCTTTCCGGTAGAGAGGTGGGGATTTTTATT 4681 TTGGTGCTTGCCTCCTTGGGCGCTTTAGCCCACCGCTTGGCTCTTAAGGCAGACATGTCA 4741 ATGGTCTTTTTGGCGTTTTGTGCTTACGCCTGGCCCATGAGCTCCTGGTTAATTTGCTTC 4801 TTTCCTATGCTCTTGAGGTGGGTAACCCTTCATCCTCTCACTATGCTTTGGGTGCACTCA 4861 TTTTTGGTGTTTTGCCTACCAGCTGCCGGCGTTCTCTCGCTGGGAATAACCGGTCTTCTT 4921 TGGGCAGTTGGCCGTTTCACCCAGGTTGCCGGAATTATCACACCTTATGACATCCACCAG 4981 TATACCTCCGGACCACGTGGTGCAGCTGCTGTAGCAACGGCTCCAGAAGGTACTTACATG 5041 GCGGCCGTTCGGAGAGCCGCTTTGACTGGACGGACTTTGATCTTCACACCATCTGCAGTC 5101 GGATCCCTTCTTGAAGGTGCTTTCAGAACTCAAAAGCCCTGCCTTAACACCGTGAATGTC 5161 GTAGGCTCTTCCCTTGGTTCTGGAGGAGTTTTCACCATTGATGGCAGAAGAGTCATCGTC 5221 ACTGCCACCCATGTGTTGAATGGTAACACAGCCAGGGTCACTGGTGATTCCTACAACCGC 5281 ATGCACACGTTCAATACTAATGGTGATTATGCCTGGTCCCATGCTGATGACTGGCAAGGC 5341 GTTGCCCCTATGGTTAAGATCGCTAAGGGGTATCGCGGTCGTGCCTACTGGCAAACGTCA 5401 ACCGGAGTCGAACCTGGCATCATGGGGGAAGGATTCGCCTTCTGTTTCACTAACTGTGGC 5461 GACTCAGGGTCACCTGTCATTTCAGAAGCTGGTGACCTTATTGGAGTCCATACCGGTTCA 5521 AACAAACTCGGTTCTGGTCTTGTGACAACCCCTGAAGGGGAGACCTGCTCCATCAAGGAA 5581 ACTAGGCTCTCTGACCTTTCTAGACATTTTGCAGGTCCAAGCGTCCCTCTTGGGGACATT 5641 AAGTTGAGCCCAGCCATCATCCCTGATGTGACAACTATTCCGAGTGACTTGGCATCGCTC 5701 CTTGCTTCTGTCCCCGTGATGGAAGGTGGCCTCTCAACTGTCCAGCTTTTGTGCGTCTTT 5761 TTCCTTCTCTGGCGCATGATGGGCCATGCCTGGACACCCATTGTTGCCGTAGGCTTCTTT 5821 TTGCTGAATGAAATTCTCCCAGCAGTCTTGGTCCGAGCTGTGTTCTCTTTTGCACTCTTT 5881 GTACTTGCATGGGCCACCCCCTGGTCGGCACAAGTGTTGATGATTAGACTCCTCACGGCG 5941 GCTCTCAACCGCAACAGGTTGTCCCTGGCGTTCTACGCACTCGGAGGTGTCGTTGGCCTG 6001 GCCACAGAAATCGGGACTTTTGCTGGTGGATGGCCTGAACTGTCCCAAGCCCTCTCGACA 6061 TACTGCTTCCTGCCCAGGTTCCTTGCTGTGACTAGTTATGTCCCCACCATCATCATCGGT 6121 GGGCTCCATGCCCTCGGCGTAATTTTGTGGTTATTCAAATACCGATGCCTCCACAACATG 6181 CTGGTTGGTGATGGGAGTTTCTCAAGCGCTTTCTTCCTACGGTATTTTGCTGAGGGTAAT 6241 CTTAGGAAAGGCGTGTCGCAGTCCTGTGGCATGAATAACGAATCCCTGACAGCTGCTTTG 6301 GCTTGCAAGTTGTCGCAAGCTGACCTTGATTTTTTGTCCAGTTTAACGAACTTCAAGTGC 6361 TTTGTGTCCGCTTCAAACATGAAAAATGCAGCTGGCCAATACATCGAGGCGGCGTATGCT 6421 AGAGCTCTGCGTCAGGAGCTGGCCTCCTTGGTTCAGGTTGACAAGATGAAAGGAGTATTG 6481 GCCAAGCTCGAGGCTTTCGCTGAGACGGCCACTCCGTCACTTGACACAGGTGACGTGATT 6541 GTTCTGCTTGGGCAACACCCCCATGGATCCATCCTCGACATTAATGTGGGGGGTGAAAGG 6601 AAAACTGTGTCTGTGCAAGAAACACGATGCCTGGGTGGTTCCAAATTCAGTGTCTGCACT 6661 GTCGTGTCCAACACGCCCGTGGATACCTTGACCGGCATCCCACTTCAGACGCCAACCCCA 6721 CTTTTTGAAAATGGCCCGCGCCATCGCAGCGAGGACGACGACCTTAAAGTTGAGAGAATG 6781 AAAAAACACTGTGTATCCCTCGGCTTCCACAAAATCAATGGTAAAGTTTACTGCAAAATT 6841 TGGGACAAGTCTAACGGCGACACCTTTTACACGGATGATTCCCGATACACTCAAGACCAT 6901 GCTTTTCAGGACAGGTCAACCGACTATAGAGACAGGGATTATGAAGGTGTACAGACCGCC 6961 CCCCAACAGGGATTCGATCCAAAGTCCGAAGCCCCTGTTGGCACTGTTGTAATCGGTGGC 7021 ATTACGTATAACAGGCATCTGGTCAAAGGTAAGGAGGTCCTAGTTCCCAAACCTGACAAC 7081 TGCCTTGAAGCTGCCAGACTGTCCCTTGAGCAAGCTCTTGCTGGGATGGGCCAAACTTGT 7141 GACCTTACAGCTACCGAAGTGGAGAAACTAAAGCGCATCATTAGTCAACTCCAAGGTCTG 7201 ACCACTGAACAGGCTTTAAACTGCTAGCCGCCAGCGGCTTGACCCGCTGTGGCCGCGGCG SEQIDNO:28NucleotideencodingparentalPRRSV94881ORF1b 7209 ACAGGCTTTAAACTGCTAGCCGCCAGCGGCTTGACCCGCTGTGGCCGCGGCG 7261 GCCTAGTTGTAACTGAAACGGCGGTAAAAATCGTAAAATACCACAGCAGAACTTTCACCT 7321 TAGGCTCTTTAGACCTAAAAGTCACCTCCGAGGTGGAGGTGAAGAAATCAACTGAGCAGG 7381 GGCACGCTGTCGTGGCGAACTTATGTTCCGGTGTCGTCTTGATGAGGCCTCACCCACCGT 7441 CCCTTGTTGACGTTCTCCTCAAACCCGGACTTGACACAACACCCGGCATTCAACCAGGGC 7501 ATGGGGCCGGGAATATGGGCGTGAACGGTTCTATTTGGGATTTTGAAACTGCACCCACAA 7561 AGGTAGAACTAGAGTTGTCCAAGCAAATAATCCAAGCATGTGAAGTCAGGCGCGGGGACG 7621 CCCCTAACCTCCAACTCCCCTACAAGCTTTATCCTGTCAGGGGGGACCCCGAGCGGCGTA 7681 AAGGTCGCCTTGTCAACACTAGGTTTGGAGATTTACCTTACAAAACTCCCCAAGACACCA 7741 AGTCCGCAATTCATGCGGCTTGTTGCCTGCATCCCAATGGGGTCCTCGTGTCTGATGGTA 7801 AATCCACGCTGGGTACCACTCTTCAACATGGTTTCGAGCTTTATGTCCCCACTGTACCTT 7861 ATAGTGTCATGGAATACCTTGATTCACGCCCTGACACCCCTTTTATGTGTACTAAACATG 7921 GCACTTCCAAGGCTGCTGCAGAGGACCTCCAAAAATATGACCTATCCACTCAAGGGTTTG 7981 TCTTGCCTGGGGTCCTACGCCTAGTGCGCAGGTTCATCTTTAGCCATGTTGGTAAGGCGC 8041 CACCACTGTTCCTTCCATCAACCTACCCTGCCAAGAACTCCATGGCAGGGGTCAATGGCC 8101 AGAGGTTCCCAACAAAGGATGTCCAGAGCATACCTGAAATTGATGAAATGTGCGCCCGTG 8161 CCGTCAAGGAAAATTGGCAGACTGTGACACCTTGCACCCTCAAAAAACAGTACTGTTCCA 8221 AACCTAAAACTAGAACCATCCTAGGTACCAACAACTTCATAGCCTTGGCTCACAGGTCAG 8281 CACTCAGTGGTGTCACCCAGGCGTTCATGAAGAAGGCCTGGAAGTCCCCAATTGCCTTGG 8341 GGAAAAACAAGTTTAAGGAATTGCATTGCACTGTCGCCGGCAGATGCCTTGAGGCTGACC 8401 TGGCTTCCTGCGATCGCAGCACCCCCGCCATTGTGAGGTGGTTTGTTGCCAACCTCCTGT 8461 ATGAACTTGCAGGATGTGAAGAGTACTTGCCTAGCTACGTGCTCAACTGTTGCCATGACC 8521 TTGTGGCAACGCAGGATGGCGCTTTCACAAAACGCGGTGGCCTGTCGTCCGGGGACCCCG 8581 TCACCAGTGTGTCCAACACCGTCTACTCACTGATAATTTACGCCCAGCACATGGTGCTTT 8641 CGGCCTTGAAGATGGGTCATGAAATTGGTCTCAAGTTCCTTGAGGAACAGCTCAAATTTG 8701 AGGACCTTCTTGAAATCCAGCCCATGTTAGTGTATTCTGATGACCTCGTCTTGTATGCGG 8761 AAAGACCCACTTTTCCCAACTACCATTGGTGGGTCGAGCATCTTGACCTGATGTTGGGCT 8821 TTAAAACGGACCCAAAGAAAACTGTCATAACTGATAAACCCAGTTTTCTCGGCTGCAGAA 8881 TTGAAGCAGGACGGCAGTTAGTCCCCAATCGCGACCGTATTCTGGCTGCTCTTGCATATC 8941 ATATGAAGGCGCAGAACGCCTCAGAGTATTATGCGTCCGCTGCCGCAATTCTGATGGATT 9001 CGTGTGCTTGCATTGACCATGACCCCGAGTGGTATGAGGACCTTATCTGCGGCATCGCCC 9061 GGTGTGCTCGCCAGGACGGTTACCGTTTTCCAGGCCCGGCATTTTTCATGTCCATGTGGG 9121 AGAAGCTGAAAAGTCATAACGAAGGGAAGAAATGCCGTCACTGCGGCATCTGCGACGCCA 9181 AAGCCGACTATGCGTCCGCCTGTGGACTTGATTTGTGTTTGTTCCATTCACACTTTCATC 9241 AACACTGCCCAGTCACTCTGAGCTGTGGCCACCATGCCGGTTCAAAGGAATGTTCGCAGT 9301 GTCAGTCACCTGTCGGGGCTGGCAAATCCCCCCTTGACGCTGTGCTGAAACAAATCCCGT 9361 ACAAACCTCCTCGTACCATTATCATGAAGGTGGACAACAAAACAACGACCCTTGACCCGG 9421 GAAGATATCAGTCCCGTCGAGGTCTTGTTGCAGTCAAAAGAGGTATTGCAGGTAATGAGG 9481 TTGATCTTTCTGATGGAGACTACCAAGTGGTGCCTCTTTTGCCGACTTGCAAAGACATAA 9541 ACATGGTGAAGGTGGCTTGCAACGTACTACTCAGCAAGTTTATAGTAGGGCCGCCAGGTT 9601 CCGGAAAAACCACCTGGCTACTGAACCAAGTCCAGGACGATGATGTCATTTACACACCTA 9661 CTCATCAGACAATGTTTGACATAGTCAGTGCTCTTAAAGTTTGCAGGTATTCCATCCCAG 9721 GAGCCTCAGGACTCCCTTTTCCACCACCTGCCAGGTCCGGGCCGTGGGTTAGGCTCATCG 9781 CCAGCGGACATGTCCCTGGCCGAGTGTCATATCTCGATGAGGCAGGATATTGCAATCATC 9841 TAGACATTCTAAGGCTGCTTTCCAAAACACCCCTTGTGTGTTTGGGTGACCTTCAGCAAC 9901 TTCACCCGGTCGGCTTTGATTCCTATTGTTATGTGTTCGATCAGATGCCTCAGAAGCAGC 9961 TGACCACCATTTATAGATTTGGCCCTAACATCTGTGCAGCCATCCAGCCTTGTTACAGGG 10021 AGAAACTTGAATCCAAGGCCAGGAACACCAGAGTGGTTTTCACCACCCGGCCTGTGGCCT 10081 TTGGTCAGGTCCTGACACCGTACCACAAAGATCGTACCGGCTCTGCAATAACTATAGATT 10141 CATCCCAGGGGGCGACCTTCGACATTGTGACATTGCATCTACCATCGCCAAAGTCCCTAA 10201 ACAAATCCCGAGCACTTGTAGCCATCACTCGGGCAAGACATGGGTTGTTCATTTATGACC 10261 CTCATGACCAACTCCAGGAGTTTTTCAACTTAACCCCCGAGCGCACTGATTGTAACCTTG 10321 CGTTCAGCCGTGGGGATGAGCTGGTTGTTTTGAATGTGGATAATGCGGTCACAACTGTAG 10381 CGAAGGCCCTAGAGACAGGTTCACCCCGATTTCGAGTATCGGACCCGAGGTGCAAGTCTC 10441 TCTTAGCCGCTTGTTCGGCCAGTCTAGAAGGGAGCTGCATGCCACTACCACAAGTAGCAC 10501 ATAACCTGGGGTTTTACTTTTCCCCGGACAGCCCAGCTTTTGCACCCCTGCCAAAAGAGC 10561 TGGCGCCACATTGGCCAGTGGTCACCCACCAGAATAATCGAGCGTGGCCTGATCGACTTG 10621 TCGCTAGTATGCGCCCAATTGATGCCCGCTACAGCAAGCCAATGGTCGGTGCAGGGTATG 10681 TGGTCGGGCCATCCATTTTTCTTGGCACTCCTGGTGTGGTGTCATACTATCTCACATTAT 10741 ACATCGGGGGCGAGCCTCAGGCCCTGCCAGAAACACTCGTTTCAACAGGACGTATAGCCA 10801 CAGATTGTCGGGAATATCTCGACGCGGCTGAGGAAGAGGCAGCGAGAGAACTTCCCCACG 10861 CATTTATTGGCGATGTCAAAGGCACTACGGTCGGGGGGTGTCACCACATTACATCGAAAT 10921 ACCTACCTAGGTCCCTGCCTAAAGACTCTGTTGCTGTGGTTGGGGTGAGTTCGCCCGGTA 10981 GGGCTGCTAAAGCCGTGTGCACTCTCACCGATGTGTACCTCCCCGAACTCCGACCATATT 11041 TGCAACCGGAGACGGCATCAAAATGCTGGAAACTTAAACTGGATTTCAGGGATGTTCGAC 11101 TGATGGTCTGGAAAGGCGCCACAGCCTATTTCCAGTTGGAAGGGCTGACATGGTCAGCGC 11161 TGCCCGATTATGCTAGGTTCATTCAGCTACCCAAGGATGCCGTTGTGTACATCGATCCGT 11221 GTATAGGGCCGGCAACAGCCAATCGCAAGGTTGTGCGAACCACAGACTGGCGGGCCGACC 11281 TGGCAGTGACACCGTATGATTACGGTGCTCAGGTCATTTTGACAACAGCCTGGTTCGAGG 11341 ACCTTGGGCCGCAGTGGAAGATTTTGGGGTTGCAGCCTTTCAGACGAACATTTGGCTTTG 11401 AGAACACTGAAGATTGGGCAATTCTCGCACGCCGTATGAATGACGGCAAAGATTACACTG 11461 ACTATAATTGGCATTGTGTACGAGAACGCCCACACGCAATTTACGGGCGCGCCCGTGACC 11521 ATACGTATCATTTTGCCCTTGGCACTGAACTGCAAGTAGAGCTGGGCAGACCCCGGCTGC 11581 CTCCTGAGCAAGTGCCGTGA SEQIDNO:29NucleotideencodingparentalPRRSV94881ORF2 11611 ATGCAATGGGTTCACTGTGGAGTAAAATCA 11641 GTCAGTTGTTCGTGGATGCCTTCACTGAGTTCCTTGTTAGTGTGGTTGACATTGTCATCT 11701 TTCTCGCCATATTGTTTGGGTTCACTGTTGCAGGCTGGTTATTGGTCTTCCTTCTCAGAG 11761 TGGTTTGCTCCGCGTTTCTCCGTTCGCGCTCTGCCATTCACTCTCCCGAACTATCGAAGG 11821 TCCTATGAGGGCTTGCTACCCAACTGCAGACCGGATGTCCCACAATTCGCAGTTAAGCAC 11881 CCGTTGGGTATACTTTGGCATATGCGAGTCTCCCACCTAATTGACGAAATGGTCTCTCGC 11941 CGCATTTACCGGACCATGGAACATTCGGGTCAAGCGGCCTGGAAGCAGGTTGTTAGTGAA 12001 GCCACTCTCACAAAACTGTCAAGGCTTGACGTAGTCACTCATTTCCAACACCTGGCCGCA 12061 GTGGAGGCTGATTCTTGCCGCTTCCTTAGCTCACGACTCGCGATGCTGAAAAACCTTGCC 12121 GTTGGCAATGTGAGCCTGGAGTACAACACTACTTTGGACCGCGTTGAGCTCATCTTTCCC 12181 ACACCAGGTACGAGGCCCAAGTTGACCGATTTTAGGCAATGGCTTATCAGCGTGCACGCT 12241 TCCATCTTCTCCTCTGTGGCTTCGTCTGTTACCTTGTTCACAGTGCTTTGGCTTCGAATT 12301 CCAGCTCTACGCTATGTTTTTGGTTTCCATTGGCCCACGGCAACACATCATTCGAACTAA SEQIDNO:30NucleotideencodingparentalPRRSV94881ORF3 12219 ATGGCTTATCAGCGTGCACGCT 12241 TCCATCTTCTCCTCTGTGGCTTCGTCTGTTACCTTGTTCACAGTGCTTTGGCTTCGAATT 12301 CCAGCTCTACGCTATGTTTTTGGTTTCCATTGGCCCACGGCAACACATCATTCGAACTAA 12361 CTATCAATTACACTATATGTAAGCCATGCCCTACCAGTCAAGCTGCCCAACAAAGACTCG 12421 AGCCTGGCCGTAACGTGTGGTGCAAAATAGGGCACGACAGGTGTGAGGAACGTGACCATG 12481 ATGAGTTGTCAATGTCCATTCCGTCCGGGTACGACAACCTCAAACTTGAGGGTTATTATG 12541 CTTGGCTGGCTTTTTTGTCCTTTTCCTACGCGGCCCAATTCCATCCGGAGCTGTTCGGAA 12601 TAGGAAACGTGTCGCGCGTCTTTGTGGATAAGCGACACCAGTTCATTTGCGCCGAGCATG 12661 ATGGACAAAATTCAACCATATCTGCCAGACACAACATCTCCGCGTCGTATGCGGTGTATT 12721 ACCATCATCAAATAGACGGGGGCAATTGGTTTCATTTGGAATGGCTGCGACCATTCTTTT 12781 CCTCCTGGCTGGTGCTCAACATCTCATGGTTTCTGAGGCGTTCGCCTGCAAGCCCTGCTT 12841 CTCGACGCATCTATCAGATATTAAGACCAACACGACCGCGGCTGCCGGTTTCATGGTCCT 12901 TCAGAACATCAATTGTTTCCAATCTCACAGGGCCTCAACAGCGCAAGGTACCACTCCCCT 12961 CAGGAGGTCGTCCCAATGTCGTGAAGCCGTCGGCATTCCCCAGTACATCACGATAA SEQIDNO:31NucleotideencodingparentalPRRSV94881ORF4 12761 ATGGCTGCGACCATTCTTTT 12781 CCTCCTGGCTGGTGCTCAACATCTCATGGTTTCTGAGGCGTTCGCCTGCAAGCCCTGCTT 12841 CTCGACGCATCTATCAGATATTAAGACCAACACGACCGCGGCTGCCGGTTTCATGGTCCT 12901 TCAGAACATCAATTGTTTCCAATCTCACAGGGCCTCAACAGCGCAAGGTACCACTCCCCT 12961 CAGGAGGTCGTCCCAATGTCGTGAAGCCGTCGGCATTCCCCAGTACATCACGATAACGGC 13021 TAATGTGACCGATGAATCGTATTTGTACAACGCGGACTTGCTGATGCTTTCCGCGTGCCT 13081 TTTCTACGCCTCGGAAATGAGCGAGAAAGGCTTCAAAGTCATCTTTGGGAATATTTCTGG 13141 CGTTGTTTCCGCTTGTGTTAATTTCACAGATTATGTGGCCCATGTGACCCAACACACTCA 13201 GCAGCACCATTTGGTAATTGATCACATTCGGTTACTACACTTCTTGACACCGTCTACGAT 13261 GAGGTGGGCTACAACCATTGCTTGTTTGTTTGCCATTCTTTTGGCGGTATGA SEQIDNO:32NucleotideencodingparentalPRRSV94881ORF5 13309 ATGAAATGTTCT 13321 TGCAAGTTGGGGCATTTCTTGACTCCTCACTCTTGCTTCTGGTGGCTTTTTTTGCTGTGT 13381 ACCGGCTTGTCTTGGTCCTTTGTCGATGGCAACGACAACAGCTCGACATCCCAATACATA 13441 TATAATTTGACGATATGCGAGCTGAATGGGACCGAATGGTTGTCCGGTCATTTTGATTGG 13501 GCAGTCGAAACCTTTGTGCTTTACCCAGTTGCCACTCATATCATTTCACTGGGTTTTCTC 13561 ACAACAAGCCATTTCCTTGATGCGCTCGGTCTCGGCGCTGTGTCCGCCACAGGATTCATT 13621 GGCGAGCGGTATGTACTTAGCAGCATGTACGGCGTTTGCGCCTTCGCGGCGCTCGTATGT 13681 TTTGTCATCCGTGCTGCTAAAAATTGCATGGCTTGCCGCTATGCCCGCACCCGGTTTACC 13741 AACTTCATCGTGGACGACCGGGGAAGAATCCATCGATGGAAGTCTTCAATAGTGGTGGAG 13801 AAATTGGGCAAAGCTGAAGTCGGTGGTGACCTTGTCAACATTAAGCATGTTGTCCTCGAA 13861 GGGGTTAAAGCTCAACCCTTGACGAGGACTTCGGCTGAGCAATGGGAAGCCTAG SEQIDNO:33NucleotideencodingparentalPRRSV94881ORF6 13902 ATGGGAAGCCTAGACGACT 13921 TTTGCAACGATCCCACCGCCGCACAAAAACTCGTGCTGGCCTTTAGCATCACATATACAC 13981 CCATAATGATATACGCCCTTAAGGTGTCACGCGGCCGACTCCTGGGGCTGTTGCACATCT 14041 TGATATTTCTGAATTGTTCCTTTACTTTTGGGTACATGACATATGTGCATTTTCAATCCA 14101 CCAACCGTGTCGCACTCACTCTGGGGGCTGTAGTCGCCCTTTTGTGGGGTGTTTACAGCC 14161 TCACAGAGTCATGGAAGTTCATCACTTCCAGATGCAGATTGTGTTGCCTAGGCCGGCGAT 14221 ACATTCTGGCCCCTGCCCATCACGTAGAAAGTGCTGCAGGCCTCCATTCAATCCCAGCGT 14281 CTGGTAACCGAGCATACGCTGTGAGAAAGCCCGGACTAACATCAGTGAACGGCACTCTAG 14341 TACCTGGGCTTCGGAGCCTCGTGCTGGGCGGCAAACGAGCTGTTAAACGAGGAGTGGTTA 14401 ACCTCGTCAAGTATGGCCGGTAA SEQIDNO:34NucleotideencodingparentalPRRSV94881ORF7 14413 ATGGCCGGTAAGAACCAGAGCCAGAAGAAAAGAAGAAATGCAGCTCCG 14461 ATGGGGAAAGGCCAGCCAGTCAATCAACTGTGCCAGTTGCTGGGTACAATGATAAAGTCC 14521 CAGCGCCAGCAATCTAGGGGAGGACAGGCCAAAAAGAAGAAGCCTGAGAAGCCACATTTT 14581 CCCCTAGCTGCTGAAGATGACATTCGGCACCATCTCACCCAGGCCGAACGTTCCCTCTGC 14641 TTGCAATCGATCCAGACGGCTTTCAATCAAGGCGCAGGAACTGCGTCGCTTTCATCCAGC 14701 GGGAAGGTCAGTTTCCAGGTTGAGTTCATGCTGCCGGTTGCTCATACAGTGCGCCTGATT 14761 CGCGTGACTTCTACATCCGCCAGTCAGGGTGCAAATTAA