Methods for high yield production of terpenes
09534227 ยท 2017-01-03
Assignee
Inventors
- Toni Kutchan (St. Louis, MO, US)
- Yasuhiro Higashi (Yokohama Kanagawa, JP)
- Xiaohong Feng (Ladue, MO, US)
Cpc classification
C07C11/21
CHEMISTRY; METALLURGY
C07K2319/08
CHEMISTRY; METALLURGY
C12N15/8243
CHEMISTRY; METALLURGY
C07C13/47
CHEMISTRY; METALLURGY
C12N15/8257
CHEMISTRY; METALLURGY
International classification
C12N15/82
CHEMISTRY; METALLURGY
C07C13/47
CHEMISTRY; METALLURGY
C07C11/21
CHEMISTRY; METALLURGY
Abstract
Provided are enhanced high yield production systems for producing terpenes in plants via the expression of fusion proteins comprising various combinations of geranyl diphosphate synthase large and small subunits and limonene synthases. Also provided are engineered oilseed plants that accumulate monoterpene and sesquiterpene hydrocarbons in their seeds, as well as methods for producing such plants, providing a system for rapidly engineering oilseed crop production platforms for terpene-based biofuels.
Claims
1. A method of producing and accumulating a monoterpene hydrocarbon, a sesquiterpene hydrocarbon, or a combination thereof, in seeds of Camelina, the method comprising the steps of: (a) transforming Camelina with a heterologous DNA construct, wherein said heterologous DNA construct comprises an enzyme-encoding nucleotide sequence encoding all, or a biosynthetically appropriate combination of, enzymes selected from the group consisting of a Mentha geranyl diphosphate synthase, a Mentha limonene synthase, an Arabidopsis farnesyl diphosphate synthase, and a Nicotiana 5-epi-aristolochene synthase, wherein said nucleotide sequence is operably linked for expression to a nucleotide sequence encoding Rubisco plastid transit peptide and to a promoter, wherein said promoter is an oleosin promoter, a napin promoter, or a glycinin promoter; and (b) obtaining a transgenic Camelina plant comprising the DNA construct of step (a), wherein seeds of said transgenic Camelina plant accumulate the monoterpene hydrocarbon limonene, the sesquiterpene hydrocarbon 5-epi-aristolochene, or a combination thereof, wherein the amount of limonene, 5-epi-aristolochene, or combination thereof, is at least 1.0 mg/g dry weight.
2. The method of claim 1, wherein the heterologous DNA construct further comprises a nucleotide sequence encoding an enzyme that catalyzes the biosynthesis of isopentenyl diphosphate and dimethylallyl diphosphate via the non-mevalonate pathway in plastids, wherein said nucleotide sequence further comprises a nucleotide sequence encoding RuBisCo small subunit transit peptide.
3. The method of claim 2, wherein said enzyme encoding nucleotide sequence encodes a 1-deoxy-xylulose 5-phosphate synthase enzyme comprising RuBisCo small subunit transit peptide.
4. The method of claim 3, further comprising expressing a nucleotide sequence encoding a selectable marker or a screenable marker that facilitates identification of transgenic seed, under the control of an operably linked promoter, wherein said promoter is an oleosin promoter, a napin promoter, or a glycinin promoter.
5. The method of claim 1, further comprising recovering said monoterpene hydrocarbon limonene, said sesquiterpene hydrocarbon 5-epi-aristolochene, or combination thereof, from seeds of said transgenic Camelina plant.
6. The transgenic Camelina plant that produces and accumulates the monoterpene hydrocarbon limonene, the sesquiterpene hydrocarbon 5-epi-aristolochene, or a combination thereof, produced by the method of claim 1.
7. A transgenic Camelina plant, cells of which comprise in their genome heterologous enzyme-encoding nucleotide sequences encoding all, or a biosynthetically appropriate combination of, enzymes selected from the group consisting of a Mentha geranyl diphosphate synthase, a Mentha limonene synthase, an Arabidopsis farnesyl diphosphate synthase, and a Nicotiana 5-epi-aristolochene synthase, wherein each of said nucleotide sequences is operably linked for expression to a nucleotide sequence encoding Rubisco plastid transit peptide and to a promoter, wherein said promoter is an oleosin promoter, a napin promoter, or a glycinin promoter, wherein said nucleotide sequences are coexpressed, and wherein said transgenic Camelina plant accumulates the monoterpene hydrocarbon limonene, the sesquiterpene hydrocarbon 5-epi-aristolochene, or a combination thereof, in seeds thereof in an amount of at least 1.0 mg/g dry weight.
8. The transgenic Camelina plant of claim 7, which further coexpresses a nucleotide sequence encoding an enzyme that catalyzes the biosynthesis of isopentenyl diphosphate and dimethylallyl diphosphate via the non-mevalonate pathway in plastids, wherein said nucleotide sequence comprises a nucleotide sequence encoding RuBisCo small subunit transit peptide.
9. The transgenic Camelina plant of claim 8, wherein said enzyme encoding nucleotide sequence encodes a 1-deoxy-xylulose 5-phosphate synthase enzyme comprising RuBisCo small subunit transit peptide.
10. The transgenic Camelina plant of claim 9, further comprising a nucleotide sequence encoding a selectable marker or a screenable marker that facilitates identification of transgenic seed, under the control of an operably linked promoter, wherein said promoter is an oleosin promoter, a napin promoter, or a glycinin promoter.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) A better understanding of the features and advantages of the present invention can be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
DETAILED DESCRIPTION OF THE INVENTION
Definitions
(42) In order that the present disclosure may be more readily understood, certain terms are first defined. Additional definitions are set forth throughout the detailed description.
(43) As used herein and in the appended claims, the singular forms a, an, and the, include plural referents unless the context clearly indicates otherwise. Thus, for example, reference to a molecule includes one or more of such molecules, a reagent includes one or more of such different reagents, reference to an antibody includes one or more of such different antibodies, and reference to the method includes reference to equivalent steps and methods known to those of ordinary skill in the art that could be modified or substituted for the methods described herein.
(44) Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges can independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
(45) The terms about or approximately means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, about can mean within 1 or 2 standard deviations, from the mean value. Alternatively, about can mean plus or minus a range of up to 20%, preferably up to 10%, more preferably up to 5%.
(46) As used herein, the terms cell, cells, cell line, host cell, and host cells, are used interchangeably and, encompass animal cells and include plant, invertebrate, non-mammalian vertebrate, insect, algal, and mammalian cells. All such designations include cell populations and progeny. Thus, the terms transformants and transfectants include the primary subject cell and cell lines derived therefrom without regard for the number of transfers.
(47) The phrase conservative amino acid substitution or conservative mutation refers to the replacement of one amino acid by another amino acid with a common property. A functional way to define common properties between individual amino acids is to analyze the normalized frequencies of amino acid changes between corresponding proteins of homologous organisms (Schulz, G. E. and R. H. Schirmer, Principles of Protein Structure, Springer-Verlag). According to such analyses, groups of amino acids can be defined where amino acids within a group exchange preferentially with each other, and therefore resemble each other most in their impact on the overall protein structure (Schulz, G. E. and R. H. Schirmer, Principles of Protein Structure, Springer-Verlag).
(48) Examples of amino acid groups defined in this manner include: a charged/polar group, consisting of Glu, Asp, Asn, Gln, Lys, Arg and His; an aromatic, or cyclic group, consisting of Pro, Phe, Tyr and Trp; and an aliphatic group consisting of Gly, Ala, Val, Leu, Ile, Met, Ser, Thr and Cys.
(49) Within each group, subgroups can also be identified, for example, the group of charged/polar amino acids can be sub-divided into the sub-groups consisting of the positively-charged sub-group, consisting of Lys, Arg and His; the negatively-charged sub-group, consisting of Glu and Asp, and the polar sub-group consisting of Asn and Gln. The aromatic or cyclic group can be sub-divided into the sub-groups consisting of the nitrogen ring sub-group, consisting of Pro, His and Trp; and the phenyl sub-group consisting of Phe and Tyr. The aliphatic group can be sub-divided into the sub-groups consisting of the large aliphatic non-polar sub-group, consisting of Val, Leu and Ile; the aliphatic slightly-polar sub-group, consisting of Met, Ser, Thr and Cys; and the small-residue sub-group, consisting of Gly and Ala.
(50) Examples of conservative mutations include substitutions of amino acids within the sub-groups above, for example, Lys for Arg and vice versa such that a positive charge can be maintained; Glu for Asp and vice versa such that a negative charge can be maintained; Ser for Thr such that a free OH can be maintained; and Gln for Asn such that a free NH.sub.2 can be maintained.
(51) The term expression as used herein refers to transcription and/or translation of a nucleotide sequence within a host cell. The level of expression of a desired product in a host cell may be determined on the basis of either the amount of corresponding mRNA that is present in the cell, or the amount of the desired polypeptide encoded by the selected sequence. For example, mRNA transcribed from a selected sequence can be quantified by Northern blot hybridization, ribonuclease RNA protection, in situ hybridization to cellular RNA or by PCR. Proteins encoded by a selected sequence can be quantified by various methods including, but not limited to, e.g., ELISA, Western blotting, radioimmunoassays, immunoprecipitation, assaying for the biological activity of the protein, or by immunostaining of the protein followed by FACS analysis.
(52) Expression control sequences are regulatory sequences of nucleic acids, or the corresponding amino acids, such as promoters, leaders, enhancers, introns, recognition motifs for RNA, or DNA binding proteins, polyadenylation signals, terminators, internal ribosome entry sites (IRES), secretion signals, subcellular localization signals, and the like, that have the ability to affect the transcription or translation, or subcellular, or cellular location of a coding sequence in a host cell. Exemplary expression control sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990).
(53) A gene is a sequence of nucleotides which code for a functional gene product. Generally, a gene product is a functional protein. However, a gene product can also be another type of molecule in a cell, such as RNA (e.g., a tRNA or an rRNA). A gene may also comprise expression control sequences (i.e., non-coding) sequences as well as coding sequences and introns. The transcribed region of the gene may also include untranslated regions including introns, a 5-untranslated region (5-UTR) and a 3-untranslated region (3-UTR).
(54) The term heterologous refers to a nucleic acid or protein which has been introduced into an organism (such as a plant, animal, or prokaryotic cell), or a nucleic acid molecule (such as chromosome, vector, or nucleic acid construct), which are derived from another source, or which are from the same source, but are located in a different (i.e. non native) context.
(55) The term homologous refers to a nucleic acid or protein which is naturally occurring within an organism (such as a plant, animal, or prokaryotic cell) and is in its native context or location, or a nucleic acid molecule (such as chromosome, vector, or nucleic acid construct) which is derived from the same source, and which is in its native context.
(56) The term homologous can also refer to the relationship between two proteins that possess a common evolutionary origin, including proteins from superfamilies (e.g., the immunoglobulin superfamily) in the same species of animal, as well as homologous proteins from different species of animal (for example, myosin light chain polypeptide, etc.; see Reeck et al., (1987) Cell, 50:667). Such proteins (and their encoding nucleic acids) have sequence homology, as reflected by their sequence similarity, whether in terms of percent identity or by the presence of specific residues or motifs and conserved positions.
(57) The term homology describes a mathematically based comparison of sequence similarities which is used to identify genes or proteins with similar functions or motifs. The nucleic acid and protein sequences of the present invention can be used as a query sequence to perform a search against public databases to, for example, identify other family members, related sequences or homologs. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences homologous to nucleic acid molecules of the invention. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to protein molecules of the invention.
(58) To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and BLAST) can be used.
(59) As used herein, the term increase or the related terms increased, enhance or enhanced refers to a statistically significant increase. For the avoidance of doubt, the terms generally refer to at least a 10% increase in a given parameter, and can encompass at least a 20% increase, 30% increase, 40% increase, 50% increase, 60% increase, 70% increase, 80% increase, 90% increase, 95% increase, 97% increase, 99% or even a 100% increase over the control value.
(60) The term isolated, when used to describe a protein or nucleic acid, means that the material has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would typically interfere with research, diagnostic or therapeutic uses for the protein or nucleic acid, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. In some embodiments, the protein or nucleic acid will be purified to at least 95% homogeneity as assessed by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain. Isolated protein includes protein in situ within recombinant cells, since at least one component of the protein of interest's natural environment will not be present. Ordinarily, however, isolated proteins and nucleic acids will be prepared by at least one purification step.
(61) As used herein, identity means the percentage of identical nucleotide or amino acid residues at corresponding positions in two or more sequences when the sequences are aligned to maximize sequence matching, i.e., taking into account gaps and insertions. Identity can be readily calculated by known methods, including but not limited to those described in (Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48: 1073 (1988). Methods to determine identity are designed to give the largest match between the sequences tested. Moreover, methods to determine identity are codified in publicly available computer programs.
(62) Optimal alignment of sequences for comparison can be conducted, for example, by the local homology algorithm of Smith & Waterman, by the homology alignment algorithms, by the search for similarity method or, by computerized implementations of these algorithms (GAP, BESTFIT, PASTA, and TFASTA in the GCG Wisconsin Package, available from Accelrys, Inc., San Diego, Calif., United States of America), or by visual inspection. See generally, (Altschul, S. F. et al., J. Molec. Biol. 215: 403-410 (1990) and Altschul et al. Nuc. Acids Res. 25: 3389-3402 (1997)).
(63) One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in (Altschul, S., et al., NCBI NLM NIH Bethesda, Md. 20894; & Altschul, S., et al., J. Mol. Biol. 215: 403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold.
(64) These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always; 0) and N (penalty score for mismatching residues; always; 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when the 27 cumulative alignment score falls off by the quantity X from its maximum achieved value, the cumulative score goes to zero or below due to the accumulation of one or more negative-scoring residue alignments, or the end of either sequence is reached. The BLAST algorithm parameters W. T. and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, a cutoff of 100, M=5, N=4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix.
(65) In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences. One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a test nucleic acid sequence is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid sequence to the reference nucleic acid sequence is in one embodiment less than about 0.1, in another embodiment less than about 0.01, and in still another embodiment less than about 0.001.
(66) The term terpene refers to any organic derived molecule formed directly from one or more isoprene, (C.sub.5H.sub.8) units. The term hemiterpenes refers to any cyclic or acyclic terpene containing one isoprene units. The term monoterpene refers to any cyclic or acyclic terpene containing two isoprene units. The term sesquiterpene refers to any cyclic or acyclic terpene containing three isoprene units. Terpenes and terpenoids are the primary constituents of the essential oils of many types of plants and flowers. Exemplary terpenes are provided for example in CRC Handbook of Terpenoids: Acyclic, Monocyclic, Bicyclic, Tricyclic, and Tetracyclic Terpenoids (1989) by S. Dev. ISBN 9780849336119; HANDBOOK OF TERPENOIDS, VOLUME 1 by DEV S. and NAGASAMPAGI ISBN: 0849336112; Chapter 13. Terpenoids and steroids of Annu. Rep. Prog. Chem., Sect. B: Org. Chem., 1985, 82, 353-375 by J. R. Hanson and in Degenhardt et al., Phytochemistry (2009) 70 1621-1637, all of which are incorporated by reference in their entirety. Representative exemplary terpenes are provided by way of illustration, but not limitation, in
(67) The term oilseed plant or oil crop refers to plants that produce seeds or fruit with a high oil content, e.g., greater than about 10%. Exemplary oil seed or oil crop plants include, for example, plants of the genus Camelina, coconut, cotton, peanut, rapeseed (canola), safflower, sesame, soybean, wheat, flax, sunflower, olive, corn, palm, sugarcane, castor bean, switchgrass, Miscanthus, and Jatropha.
(68) The terms operably linked, operatively linked, or operatively coupled as used interchangeably herein, refer to the positioning of two or more nucleotide sequences or sequence elements in a manner which permits them to function in their intended manner. In some embodiments, a nucleic acid molecule according to the invention includes one or more DNA elements capable of opening chromatin and/or maintaining chromatin in an open state operably linked to a nucleotide sequence encoding a recombinant protein. In other embodiments, a nucleic acid molecule may additionally include one or more DNA or RNA nucleotide sequences chosen from: (a) a nucleotide sequence capable of increasing translation; (b) a nucleotide sequence capable of increasing secretion of the recombinant protein outside a cell; (c) a nucleotide sequence capable of increasing the mRNA stability, and (d) a nucleotide sequence capable of binding a trans-acting factor to modulate transcription or translation, where such nucleotide sequences are operatively linked to a nucleotide sequence encoding a recombinant protein. Generally, but not necessarily, the nucleotide sequences that are operably linked are contiguous and, where necessary, in reading frame. However, although an operably linked DNA element capable of opening chromatin and/or maintaining chromatin in an open state is generally located upstream of a nucleotide sequence encoding a recombinant protein; it is not necessarily contiguous with it. Operable linking of various nucleotide sequences is accomplished by recombinant methods well known in the art, e.g. using PCR methodology, by ligation at suitable restrictions sites or by annealing. Synthetic oligonucleotide linkers or adaptors can be used in accord with conventional practice if suitable restriction sites are not present.
(69) The term organism that naturally produces monoterpenes refers to any plant, algae, or fungi that produces detectable levels of any terpene. Representative examples of plants that naturally produce terpenes include for example, Pinus taeda, loblolly pine, Pinaceae, forest, Juniperus virginiana, cedar, Cupressaceae, tree, Magnolia grandiflora, magnolia, Magnoliaceae, flower and fruit, Umbellularia californica, California bay laurel, Lauraceae, branches with fruit, Cinnamomum camphora, camphor tree, Lauraceae, branch with flowers, Cananga odorata, ylang-ylang, Annonaceae, branch with flower, Citrus limon, lemon, Rutaceae, branch with fruits, Bursera gummifera, Burseraceae, tree, Rosa damascena, rose, Rosaceae, plant with flower, Pelargonium sp., geranium, Geraniaceae, plant with flowers, Cannabis sativa, marijuana, Cannabaceae, plants, Mentha piperita, peppermint, Lamiaceae, plant with flowers, Lavandula officinalis, lavender, Lamiaceae, flowers, Salvia officinalis, sage, Lamiaceae, plants with flowers, Eucalyptus kondinensis, Myrtaceae, trees, Eucalyptus globulus, Myrtaceae, flowers, Anethum graveolens, dill, Apiaceae, plants and fruits, Coriandrum sativum, coriander, cilantro, Apiaceae, plant and inflorescences, Chrysactinia mexicana, Asteraceae, plant with flowers, Artemisia sp., sage brush, Asteraceae, pasture with plants, Ambrosia bidentata, ragweed, Asteraceae, plants in bloom, Reboulia hemisphaerica, liverwort, Salvia leucophylla, Lamiaceae, allelopathic zones in the chaparral, Pyrethrum sp., Asteraceae, plants in field and harvest (irregular monoterpenes).
(70) The terms polynucleotide, nucleotide sequence and nucleic acid are used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. These terms include a single-, double- or triple-stranded DNA, genomic DNA, cDNA, RNA, DNA-RNA hybrid, or a polymer comprising purine and pyrimidine bases, or other natural, chemically, biochemically modified, non-natural or derivatized nucleotide bases. The backbone of the polynucleotide can comprise sugars and phosphate groups (as may typically be found in RNA or DNA), or modified or substituted sugar or phosphate groups. In addition, a double-stranded polynucleotide can be obtained from the single stranded polynucleotide product of chemical synthesis either by synthesizing the complementary strand and annealing the strands under appropriate conditions, or by synthesizing the complementary strand de novo using a DNA polymerase with an appropriate primer. A nucleic acid molecule can take many different forms, e.g., a gene or gene fragment, one or more exons, one or more introns, mRNA, tRNA, rRNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs, uracyl, other sugars and linking groups such as fluororibose and thioate, and nucleotide branches. As used herein, a polynucleotide includes not only naturally occurring bases such as A, T, U, C, and G, but also includes any of their analogs or modified forms of these bases, such as methylated nucleotides, internucleotide modifications such as uncharged linkages and thioates, use of sugar analogs, and modified and/or alternative backbone structures, such as polyamides.
(71) A promoter is a DNA regulatory region capable of binding RNA polymerase in a cell and initiating transcription of a downstream (3 direction) coding sequence. As used herein, the promoter sequence is bounded at its 3 terminus by the transcription initiation site and extends upstream (5 direction) to include the minimum number of bases or elements necessary to initiate transcription at levels detectable above background. A transcription initiation site (conveniently defined by mapping with nuclease S1) can be found within a promoter sequence, as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase. Prokaryotic promoters contain Shine-Dalgarno sequences in addition to the 10 and 35 consensus sequences.
(72) A large number of promoters, including constitutive, inducible and repressible promoters, from a variety of different sources are well known in the art. Representative sources include for example, viral, mammalian, insect, plant, yeast, and bacterial cell types, and suitable promoters from these sources are readily available, or can be made synthetically, based on sequences publicly available on line or, for example, from depositories such as the ATCC as well as other commercial or individual sources. Promoters can be unidirectional (i.e., initiate transcription in one direction) or bi-directional (i.e., initiate transcription in either a 3 or 5 direction). Non-limiting examples of promoters active in plants include, for example nopaline synthase (nos) promoter and octopine synthase (ocs) promoters carried on tumor-inducing plasmids of Agrobacterium tumefaciens and the caulimovirus promoters such as the Cauliflower Mosaic Virus (CaMV) 19S or 35S promoter (U.S. Pat. No. 5,352,605), CaMV 35S promoter with a duplicated enhancer (U.S. Pat. Nos. 5,164,316; 5,196,525; 5,322,938; 5,359,142; and 5,424,200), the Figwort Mosaic Virus (FMV) 35S promoter (U.S. Pat. No. 5,378,619), the cassava vein mosaic virus (U.S. Pat. No. 7,601,885). These promoters and numerous others have been used in the creation of constructs for transgene expression in plants or plant cells. Other useful promoters are described, for example, in U.S. Pat. Nos. 5,391,725; 5,428,147; 5,447,858; 5,608,144; 5,614,399; 5,633,441; 6,232,526; and 5,633,435, all of which are incorporated herein by reference.
(73) The term purified as used herein refers to material that has been isolated under conditions that reduce or eliminate the presence of unrelated materials, i.e., contaminants, including native materials from which the material is obtained. For example, a purified protein is preferably substantially free of other proteins or nucleic acids with which it is associated in a cell. Methods for purification are well-known in the art. As used herein, the term substantially free is used operationally, in the context of analytical testing of the material. Preferably, purified material substantially free of contaminants is at least 50% pure; more preferably, at least 75% pure, and more preferably still at least 95% pure. Purity can be evaluated by chromatography, gel electrophoresis, immunoassay, composition analysis, biological assay, and other methods known in the art. The term substantially pure indicates the highest degree of purity, which can be achieved using conventional purification techniques known in the art.
(74) The term sequence similarity refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin. However, in common usage and in the instant application, the term homologous, when modified with an adverb such as highly, may refer to sequence similarity and may or may not relate to a common evolutionary origin.
(75) In specific embodiments, two nucleic acid sequences are substantially homologous or substantially similar when at least about 85%, and more preferably at least about 90% or at least about 95% of the nucleotides match over a defined length of the nucleic acid sequences, as determined by a sequence comparison algorithm known such as BLAST, FASTA, DNA Strider, CLUSTAL, etc. An example of such a sequence is an allelic or species variant of the specific genes of the present invention. Sequences that are substantially homologous may also be identified by hybridization, e.g., in a Southern hybridization experiment under, e.g., stringent conditions as defined for that particular system.
(76) In particular embodiments of the invention, two amino acid sequences are substantially homologous or substantially similar when greater than 90% of the amino acid residues are identical. Two sequences are functionally identical when greater than about 95% of the amino acid residues are similar. Preferably the similar or homologous polypeptide sequences are identified by alignment using, for example, the GCG (Genetics Computer Group, Version 7, Madison, Wis.) pileup program, or using any of the programs and algorithms described above. The program may use the local homology algorithm of Smith and Waterman with the default values: Gap creation penalty=(1+1/k), k being the gap extension number, Average match=1, Average mismatch=0.333.
(77) As used herein, a transgenic plant is one whose genome has been altered by the incorporation of heterologous genetic material, e.g. by transformation as described herein. The term transgenic plant is used to refer to the plant produced from an original transformation event, or progeny from later generations or crosses of a transgenic plant, so long as the progeny contains the heterologous genetic material in its genome.
(78) The term transformation or transfection refers to the transfer of one or more nucleic acid molecules into a host cell or organism. Methods of introducing nucleic acid molecules into host cells include, for instance, calcium phosphate transfection, DEAE-dextran mediated transfection, microinjection, cationic lipid-mediated transfection, electroporation, scrape loading, ballistic introduction, or infection with viruses or other infectious agents.
(79) Transformed, transduced, or transgenic, in the context of a cell, refers to a host cell or organism into which a recombinant or heterologous nucleic acid molecule (e.g., one or more DNA constructs or RNA, or siRNA counterparts) has been introduced. The nucleic acid molecule can be stably expressed (i.e. maintained in a functional form in the cell for longer than about three months) or non-stably maintained in a functional form in the cell for less than three months i.e. is transiently expressed. For example, transformed, transformant, and transgenic cells have been through the transformation process and contain foreign nucleic acid. The term untransformed refers to cells that have not been through the transformation process.
(80) The practice of the present invention will employ, unless otherwise indicated, conventional techniques of chemistry, molecular biology, microbiology, recombinant DNA and immunology, which are within the capabilities of a person of ordinary skill in the art. Such techniques are explained in the literature. See, for example, J. Sambrook, E. F. Fritsch, and T. Maniatis, 1989, Molecular Cloning: A Laboratory Manual, Second Edition, Books 1-3, Cold Spring Harbor Laboratory Press; Ausubel, F. M. et al. (1995 and periodic supplements; Current Protocols in Molecular Biology, ch. 9, 13, and 16, John Wiley & Sons, New York, N.Y.); B. Roe, J. Crabtree, and A. Kahn, 1996, DNA Isolation and Sequencing: Essential Techniques, John Wiley & Sons; J. M. Polak and James O'D. McGee, 1990, In Situ Hybridization: Principles and Practice; Oxford University Press; M. J. Gait (Editor), 1984, Oligonucleotide Synthesis: A Practical Approach, Irl Press; D. M. J. Lilley and J. E. Dahlberg, 1992, Methods of Enzymology: DNA Structure Part A: Synthesis and Physical Analysis of DNA Methods in Enzymology, Academic Press; Buchanan et al., Biochemistry and Molecular Biology of Plants, Courier Companies, USA, 2000; Miki and Iyer, Plant Metabolism, 2.sup.nd Ed. D. T. Dennis, D H Turpin, D D Lefebrve, D G Layzell (eds) Addison Wesly, Langgmans Ltd. London (1997); and Lab Ref: A Handbook of Recipes, Reagents, and Other Reference Tools for Use at the Bench, Edited Jane Roskams and Linda Rodgers, 2002, Cold Spring Harbor Laboratory, ISBN 0-87969-630-3. Each of these general texts is herein incorporated by reference.
(81) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention belongs. Although any methods, compositions, reagents, cells, similar or equivalent to those described herein can be used in the practice or testing of the invention, the preferred methods and materials are described herein.
(82) The publications discussed above are provided solely for their disclosure before the filing date of the present application. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention.
(83) All publications and references, including but not limited to patents and patent applications, cited in this specification are herein incorporated by reference in their entirety as if each individual publication or reference were specifically and individually indicated to be incorporated by reference herein as being fully set forth. Any patent application to which this application claims priority is also incorporated by reference herein in its entirety in the manner described above for publications and references.
(84) Overview
(85) The present invention includes methods, DNA constructs, and transgenic plants that exhibit enhanced rates of terpene production and improved terpene content. In one aspect such methods and transgenic plants are created through the over expression of fusion proteins comprising either the GPP synthase large and small subunits, and limonene synthase, or one or more of these subunits fused to limonene synthase. In certain embodiments the enzymes are expressed with plastids of seed tissues.
(86) Accordingly, in one aspect the current invention includes a method for the production of a terpene, comprising the steps of:
(87) transforming a plant cell with a first nucleotide sequence encoding a fusion protein comprising a geranyl diphosphate synthase small subunit fused in frame to a geranyl diphosphate synthase large subunit, operatively linked to a first set of expression control sequences that drive expression of the geranyl diphosphate fusion protein in the plant cell;
(88) transforming a plant cell with a second nucleotide sequence encoding a limonene synthase, operatively linked to a second set of expression control sequences that drive expression of the limonene synthase in the plant cell;
(89) wherein the fusion protein and limonene synthase are expressed primarily in the plant cell plastids.
(90) In another aspect, the invention includes a method for the production of a monoterpene, comprising the step of:
(91) transforming a plant cell with a first nucleotide sequence encoding a fusion protein comprising a geranyl diphosphate synthase small subunit or a geranyl diphosphate synthase large subunit fused in frame to a limonene synthase, operatively linked to a first set of expression control sequences that drive expression of the geranyl diphosphate fusion protein in the plant cell;
(92) wherein the fusion protein is expressed primarily in the plant cell plastids.
(93) In certain embodiments of either of these methods the fusion protein is expressed primarily in the seeds of the plant.
(94) I. Exemplary Geranyl Diphosphate Synthase Genes
(95) In any of these methods, fusion proteins, DNA constructs, and transgenic organisms, the terms geranyl diphosphate synthase or GDP synthase or GDS refers to all naturally-occurring and synthetic genes encoding a geranyl diphosphate synthase large or small subunit. In one aspect, the geranyl diphosphate synthase is from a plant. In one aspect the geranyl diphosphate synthase is from plant that naturally produces terpenes.
(96) Representative species and Gene bank accession numbers for various species of geranyl diphosphate synthase large and small subunits are listed below in Table D1.
(97) TABLE-US-00001 TABLED1 Exemplarygeranyldiphosphatesynthasessmallsubunits SEQ GeneBank ID Organism Sequence AccessionNo. NO: Menthax MAINLSHINSKTCFPLKTRSDLSRSSSARCMPTA AF182827 1 piperita AAAAFPTIATAAQSQPYWAAIEADIERYLKKSI TIRPPETVFGPMHHLTFAAPATAASTLCLAACE LVGGDRSQAMAAAAAIHLVHAAAYVHEHLPL TDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGF ELLAGSVDPARTDDPDRILRVIIEISRAGGPEGM ISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHA CGAACGAILGGAAEEEIQKLRNFGLYQGTLRG MMEMKNSHQLIDENIIGKLKELALEELGGFHG KNAELMSSLVAEPSLYAA Antirrhinum MAHGLTHFNTKSGLFPSITKSKTTRPSTRP AAS82859.1 2 majus VILAMTRTQTYRATIESDIESYLKKAIPIR APESVFEPMHHLTFAAPRTSASALCVAACE LVGGDRSDAMAAAAAVHLMHVAAYTHENLP LTDGPMSKSEIQHKFDPNIELLTGDGIIPF GLELMARSMDPTRNNPDRILRAIIELTRVM GSEGIVEGQYHELGLNQLNDLELIEYVCKK KEGTLHACGAACGAILGGCDEDKIEKLRRF GLYVGTVQGLLGKNRSGFEGRIKELKELAV KELESFGGEKIELIRGVFELEHSLAGV Ricinus MAGALPYIPGNPVGRGVFRRSFGYGRGGAL XP_002532570.1 3 communis FSRRPVACVMSNSSKIDYWTCINADIETHL KEAIPVRPPVVVFEPMHHLTFAAPRSFAPA LCIAACELVGGSRDQALAAASALRLMIAAA FTHENIPLTDRPRPSARPMFHHTFGPNIEL LTGDGMIPFAFELLAQLNNPAQDNSDRILR VMIEISRAMGSQGMVEGQYNEFQYDQSVGD ELFHVAWLRDVCKKKEGASHACAGACGAIL GGGNEEEIEKLRRYGLYVGTIQGIYNKVEG NEEWSLKEVNKLRDLALKELKDFNEEEKVR AICSLVEN Populus SYWTSVNDEIDAHLKQAIPIRPPLSVFEPM XP_002322072.1 4 trichocarpa HHLTFAAPRTTAPALCIAACELVGGNRDQA MAAASALRLMHAAALTHEHILSTGNRARIG HSFGSNIELLTGDGMVPFGLELLAKSDDLT QNNSERILRVIIEITQAMGSQGMALGQYNQ FQHGQSDYIDHVCKKKEGELHSCAGAVGAI LGGGTEEEIEKLRRYGLYVGLMQGVLSNWV ERKEEVSMEKVLNELENLALKELEGF Hevea MAGALSSTIHGNLIARAVSSSNPKHPLFSH BAF98300.1 5 brasiliensis RPMVVAMSTDQSYWSSVNADLDTHLKQAIP IRQPLAVFEPMRHLILSAPQTSAPALCIAA CELVGGHRNQAMAAASALRLVHASASTHEN LPLTDRPRPMPRTRPTLYGPNIELLIADGI IPYGFELLARDDDAAENNSNRVLRAIIEIS RAMGSQGVIEGQYNESQYEESEGEEIFHVG WLQNVCRKKEGTLHACAGACGAILGGGSED EIEKLRRYGLYVGMVQGILSKVDERKEWPV KEVNKLRDLALKELKDFNQAKVKTISILVE TRFCNL Humulus MSRTHENHHVPTSTSIVVSASITADIEAHL ACQ90681.1 6 lupulus KQSITLKPPLSVHEPMYNLVFSAPPNSAPS LCVAACELVGGHRSKAIAAASALRLLHAAN FTHEHLPLTDSPSPSPVIHNSYDPSIQLLM PDAILPLGFELLAQSYNPAQNNSDRVLRVI VEFARAFGSKGILDGQYRQRVVSISNGDEV DNAERVDCSGREKEGKMHACAAACGAILGD ANEEETEKLRTFGLYVGMIQGYSIKFMRER EEEKEAERTIKELRNLALKELEHFHGRKLE PISSFIYCL Glycinemax MLGALLLNANFKIHFSLISCQARVPLPVKP ABY90133.1 7 APLRMPSPHYPHWASLQADIEAHLKQTIPL KEPLEVFEPMLHLAFSAPRTTVPALCLAAC ELVGGHRQQAMAAASALLLNLANAHAHEHL TDGPMYGPNIELLTGDGIVPFGFELLARPD GPASASPERVLRVMIEISRAVGSVGLQDAQ YVKKTLWDGGEEVQNVESMQRFVLEKRDGG LHACGAASGAILGGGSEDQIERLRNFGFHV GMMRGMLQMGFMEKHVQEERHLALKELQFF MDRDVHVISSFIY
(98) TABLE-US-00002 TABLED2 Exemplarygeranyldiphosphatesynthaseslargesubunits SEQ GeneBank ID Organism Sequence AccessionNo. NO: Menthax MSALVNPVAKWPQTIGVKDVHGGRRRRSRS AAF08793.1 8 piperita TLFQSHPLRTEMPFSLYFSSPLKAPATFSV SAVYTKEGSEIRDKDPAPSTSPAFDFDGYM LRKAKSVNKALEAAVQMKEPLKIHESMRYS LLAGGKRVRPMLCIAACELVGGDESTAMPA ACAVEMIHTMSLMHDDLPCMDNDDLRRGKP TNHMAFGESVAVLAGDALLSFAFEHVAAAT KGAPPERIVRVLGELAVSIGSEGLVAGQVV DVCSEGMAEVGLDHLEFIHHHKTAALLQGS VVLGAILGGGKEEEVAKLRKFANCIGLLFQ VVDDILDVTKSSKELGKTAGKDLVADKTTY PKLIGVEKSKEFADRLNREAQEQLLHFHPH RAAPLIALANYIAYRDN Mentha MSALVNPVAKWPQTIGIKDVHGGRRRRSRS ABR15420.1 9 haplocalyx TLFLSHPLRTEMPFSLYFSSPLKAPATFSV var. SAVYTKEGSEIRDKDPAPSTSPAFDFDGYM piperascens LRKAKSVNKALEAAVQMKEPLKIHESMRYS LLAGGKRVRPMLCIAACELVGGDESTAMPA ACAVEMIHTMSLMHDDLPCMDNDDLRRGKP TNHMAFGESVAVLAGDALLSFAFEHVAAAT KGAPPERIVRVLGELAVSVGSEGLVAGQVV DVCSEGMAEVGLDHLEFIHHHKTAALLQGS VVLGAILGGGNEEEVAKLRKFANCIGLLFQ VVDDILDVTKSSKELGKKAGKDLVADKTTY PKLIGVEKSMEFADRLNREAQEQLLHFHPH RAAPLIALANYIAYRDN Catharanthus MRSNLCHPLKNQLPISFFLSGTIRKPIFSC CAA63486.1 10 roseus SRLSISAIITKEQTQEESESKSKKEVAFSS SSSFDFKAYMIGKANSVNKALEDAVLVREP LKIHESMRYSLLAGGKRVRPMLCIAACELF GGTESVAMPSACAVEMIHTMSLMHDDLPCM DNDDLRRGKPTNHKVFGEDVAVLAGDALLA FAFEHIATATKGVSSERIVRVVGELAKCIG SEGLVAGQVVDVCSEGIADVGLEHLEFIHI HKTAALLEGSVVLGAIVGGANDEQISKLRK FARCIGLLFQVVDDILDVTKSSQELGKTAG KDLVADKVTYPKLLGIDKSREFAEKLNREA QEQLAEFDPEKAAPLIALANYIAYRDN Picrorhiza MSLVNSITWSQTSSILNIQSNISKKLTPFS AAW66658.1 11 kurrooa ILPHPLTNNLPISLFPNPKSNISNSNTPLS AILTKDQKPQNPPTTPTFDFKSYMLQKADS VNKALDDSIPLTEPLKIQESMRYSLLAGGK RIRPMLCIAACELVGGDESTAMPAACAVEM VHTMSLMHDDLPCMDNDDLRRGKPTNHKVF TEDVAVLAGDAMLAFSFEHVASLTKGVCSE RIVRVIYELAKCVGCEGLVAGQVVDICSEG MDEVGLEHLEFIHLNKTAALLEGSVVLGAI LGGGSDEEVEKLRNFARCIGLLFQVVDDIL DVTKSSKELGKTAGKDLVADKTTYPKLIGI EKSKEFAERLNREAKEHLAGFDQNKAAPLI ALADYIAYRDN Ipomoeasp. MSLANPSTTWAKTHSFCGRFRSRSLIRNNE BAI47571.1 12 Kenyan FSINLSSFPTSIRKPLYYHSCSAILTKEQT GVPQEESESESEKKPAAAKLDFTAYVLGKA KSVNKALEGAVLVKEPLRIHESMRYSLLAG GKRIRPMLCIAACELVGGDEETAMPAACAV EMIHTMSLMHDDLPCMDNDDLRRGKPTNHK VYGEDVAVLAGDALLAFAFEHIATATKGAS SEKIVRVVGELAKSIGAEGLVAGQVVDICS EGISNVGLEHLEFIHLHKTAALLEGSVVLG AILGGGTEEEIAKLRKFARNIGLLFQVVDD ILDVTKSSKELGKTAGKDLVADKVTYPKLL GIQKSREFAEQLNNEAQAQLSGFDQEKAAP LIALANYIAYRDN Scoparia MSLVNPVSTWPNPTRSSVFRPKPAILNTTH BAA86285.1 13 dulcis LPISFLFAGKPISAVLTKEYSHQTSSTFDF KKYMLEKASSVNKALESAVSLKEPLKIHES MRYSLLAGGKRVRPMLCLAACELVGGHPST AMPAACSIEMIHTMSLMHDDLPCMDNDHLR RGHPTNHIVFGEDVAVLAGDALLAYSFEYL ATATEGVLPERIVRVIAELAKCIRSEGLLA GQVVDICSEGVSEIGLEHLEYIHLHKTAAL LEGSVVLGAILGGGNDEEVERLRKFARCIG LLFQVVDDILDVTKTSVELGKTAGKDLVAD KTTYPKLIGIEKSREFAEKLNREAQEQLVG FDSDKAAPLIALANYIAYREN Antirrhinum MSLVNPITTWSTTTTSKSPKNVQTTTRSRS AAS82860.1 14 majus IILPHKISLFPSNPKSKSKTHLRFSISSIL TKNPQESSQKTSKDPTFTLDFKTYMLEKAS SVNKALEQAVLLKEPLKIHESMRYSLLAGG KRVRPMLCIAACELVGGLESTAMPSACAVE MIHTMSLIHDDLPCMDNDDLRRGKPTNHKI YGEDVAVLAGDALLAFSFEHVAKSTKGVSS DRIVRVIGELAKCIGSEGLVAGQVVDISSE GMTEVGLEHLEFIHVHKTAALLEASVVLGA IVGGADDEDVEKLRKFARCIGLLFQVVDDI LDVTKSSQELGKTAGKDLVADKTTYPKLLG IEKSREFAEKLNREAQEQLEGFDSVKAAPL IALANYIAYRDN Arabidopsis MLFTRSVARISSKFLRNRSFYGSSQSLASHRFAII NM_001036406.2 15 thaliana PDQGHSCSDSPHKGYVCRTTYSLKSPVFGGFSH QLYHQSSSLVEEELDPFSLVADELSLLSNKLREM VLAEVPKLASAAEYFFKRGVQGKQFRSTILLLM ATALNVRVPEALIGESTDIVTSELRVRQRGIAEIT EMIHVASLLHDDVLDDADTRRGVGSLNVVMG NKMSVLAGDFLLSRACGALAALKNTEVVALLA TAVEHLVTGETMEITSSTEQRYSMDYYMQKTY YKTASLISNSCKAVAVLTGQTAEVAVLAFEYGR NLGLAFQLIDDILDFTGTSASLGKGSLSDIRHGVI TAPILFAMEEFPQLREVVDQVEKDPRNVDIALE YLGKSKGIQRARELAMEHANLAAAAIGSLPETD NEDVKRSRRALIDLTHRVITRNK Chlamydomon MSLKHALRQAGGLISAVASSSSSTGAVSLF XP_001691069.1 16 asreinhardtii LNGALDVRPALHRLFLTAAVPQGYIQTWAE VHDRRVEPFSVVQQEVDVVSERLRHSVTTG IPALKTAAEYFFRRGIEGKRLRPTLALLMS SALSPAAPSPEYLQVDTRPAAEHPHEMRRR QQRLAEIAELIHVASLLHDDVIDDAQTRRG VLSLNTSVGNKTAILAGDFLLARASVTLAS LRNSEIVELMSQVLEHLVSGEIMQMTATSE QLLDLEHYLAKTYCKTASLMANSSRSVAVL AGAAPEVCDMAWSYGRHLGIAFQVVDDLLD LTGSSSVLGKPALNDMRSGLATAPVLFAAQ EEPALQALILRRFKHDGDVTKAMSLIERTQ GLRRAEELAAQHAKAAADMIRCLPTAQSDH AEIAREALIQITHRVLTRKK
(99) It is well established that the genetic code is degenerate and that some amino acids have multiple codons, and accordingly, multiple polynucleotides can encode the geranyl diphosphate synthases of the invention. Moreover, the polynucleotide sequence can be manipulated for various reasons. Examples include, but are not limited to, the incorporation of preferred codons to enhance the expression of the polynucleotide in various organisms (see generally Nakamura et al., Nuc. Acid. Res. (2000) 28 (1): 292). In addition, silent mutations can be incorporated in order to introduce, or eliminate restriction sites, remove cryptic splice sites, or manipulate the ability of single stranded sequences to form stem-loop structures: (see, e.g., Zuker M., Nucl. Acid Res. (2003); 31(13): 3406-3415). In addition, expression can be further optimized by including consensus sequences at and around the start codon.
(100) Such codon optimization can be completed by standard analysis of the preferred codon usage for the host organism in question, and the synthesis of an optimized nucleic acid via standard DNA synthesis. A number of companies provide such services on a fee for services basis and include for example, DNA2.0, (CA, USA) and Operon Technologies. (CA, USA).
(101) The geranyl diphosphate synthase subunits may be in their native form, i.e., as different apo forms, or allelic variants as they appear in nature, which may differ in their amino acid sequence, for example, by proteolytic processing, including by truncation (e.g., from the N- or C-terminus or both) or other amino acid deletions, additions, insertions, substitutions.
(102) Naturally-occurring chemical modifications including post-translational modifications and degradation products of the geranyl diphosphate synthase subunits, are also specifically included in any of the methods of the invention including for example, pyroglutamyl, iso-aspartyl, proteolytic, phosphorylated, glycosylated, reduced, oxidatized, isomerized, and deaminated variants of the geranyl diphosphate synthase.
(103) The geranyl diphosphate synthase subunits which may be used in any of the methods, DNA constructs, and plants of the invention may have amino acid sequences which are substantially homologous, or substantially similar to any of the native geranyl diphosphate synthase sequences, for example, to any of the native geranyl diphosphate synthase gene sequences listed in Tables D1 and D2.
(104) Alternatively, the geranyl diphosphate synthase may have an amino acid sequence having at least 30% preferably at least 40, 50, 60, 70, 75, 80, 85, 90, 95, 98, or 99% identity with a geranyl diphosphate synthase listed in Tables D1 or D2.
(105) In certain aspects, the geranyl diphosphate synthase small subunit for use in any of the methods and plants of the present invention is at least 80% identical to the mature geranyl diphosphate synthase (shown without the native transit peptide below) small subunit from Menthapiperita:
(106) TABLE-US-00003 (SEQIDNO:17) MQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLA ACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPVSKPAIQ HKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAG GPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAIL GGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALE ELGGFHGKNAELMSSLVAEPSLYAA.
(107) In certain aspects, the geranyl diphosphate synthase large subunit for use in any of the methods and plants of the present invention is at least 80% identical to the mature geranyl diphosphate synthase (shown without the native transit peptide below) large subunit from Menthapiperita:
(108) TABLE-US-00004 (SEQIDNO:18) MFDFDGYMLRKATSVNTALEAAVEMKEPLKIHESMRYSLLAGGKRVRPI LCIAACELVGGDETTAMPAACAVEMIHTMSLMHDDLPCMDNDDLRRGK PTNHKVFGESTAVLAGDALLSFAFEHVAATTRGAPTERIVRVLGELAVSI GSEGLVAGQVVDICSEGMAEVGLEHLEYIHHHKTAALLQGSVVLGAILG GGGEEEVARLRKFANCIGLLFQVVDDILDVTKSSKELGKTAGKDLVADKT TYPKLIGVEKSKEFADRLKREAVEQLLHFHPHRAAPLIALANYIAYRDN.
(109) Additionally in some embodiments, the geranyl diphosphate synthase subunits and fusion proteins thereof can include modified forms in which the native transit peptide has been removed, or replaced with another synthetic, or naturally occurring, transit peptide sequence.
(110) Such transit sequences are joined to the coding sequence of an expressed gene, and are removed post-translationally from the initial translation product. Various transit peptides which function as described herein are well known in the art, and are described in, for example, Johnson et al. The Plant Cell (1990) 2:525-532; Sauer et al. EMBO J. (1990) 9:3045-3050; Mueckler et al. Science (1985) 229:941-945; Von Heijne, Eur. J. Biochem. (1983) 133:17-21; Yon Heijne, J. Mol. Biol. (1986) 189:239-242; Iturriaga et al. The Plant Cell (1989) 1:381-390; McKnight et al., Nucl. Acid Res. (1990) 18:4939-4943; Matsuoka and Nakamura, Proc. Natl. Acad. Sci. USA (1991) 88:834-838. Such transit peptides can be identified in the primary amino acid sequences of the preproteins by those ordinarily skilled in the art. For example, see Colby et al. (1993) J. Biol. Chem. 268(31):23016-23024, for the transit peptide sequence of limonene synthase.
(111) In certain embodiments, the transit peptide may comprise the pea RuBisCO small subunit transit peptide:
(112) TABLE-US-00005 (SEQIDNO:19) (MASMISSSAVTTVSRASTVQSAAVAPFGGLKSMTGFPVKKVNTDITSI TSNGGRVKC).
II. Exemplary Limonene Synthase Genes
(113) In any of these methods, fusion proteins, DNA constructs, and transgenic organisms, the term limonene synthase, or LS refers to all naturally-occurring and synthetic genes encoding a limonene synthase. One of skill in the art will appreciate that such limonene synthases may exist in two forms; The (S) or () forms producing the ()-(4S)-limonene enantiomer and the (R) or (+) forms producing the (+)-(4R)-limonene enantiomer. In one aspect, the limonene synthase is from a plant. In one aspect the limonene synthase is from plant that naturally produces terpenes. In certain embodiments, the limonene synthase is the () or (S) form. In certain embodiments, the limonene synthase is the (+) or (R) form.
(114) Representative species and Gene bank accession numbers for various species of are listed below in Table D3.
(115) TABLE-US-00006 TABLED3 Exemplarylimonenesynthases GeneBank SEQ Organism Sequence AccessionNo. IDNO: Menthax MALKVFSGAMQMPIPSKLTTYLQPSHLNSS ABW86881.1 20 piperita PKLLSNTKGTSRSRLRVSCSSSQLTTERRS GNYNPSRWDVDFIQTLHSDYKDEKHARRAS ELVTLVKMELEKETDQIRQLELIDDLQRMG LSDHFQNEFKEILSSVYLDHGYYKNPDPKE ERDLYSTSLAFRLLREHGFQVAQEVFDSFK NEEGEFKESLSDDTRGLLQLYEASFLLTEG ETTLESAREFATKFLEERVNEGGGDENLLT RIAYSLEIPLHWRIKRPNAPVWIDSYRKRP NMNPVVLDLAILDLNIVQAHFQQELKESFR WWRNTGFVEKLPFARDRLVECYFWNTGIIE PRQHASARIMMGKVNALITVIDDIYDVYGT LEELEHFTDLIRRWDIDSIDQLPDYMQLCF LALNNFVDETSYDVMKEKGVNVIPYLRQSW VDLADKYMVEARWFYGGHKP SLEEYLENSWMSISGPCMLTHIFFRVTDSF TKETVDSLYK YHDLVRWSSFVLRLADDLGTSVEEVSRGDV PKSLQCYMSDYNASEAEARKHVKWLIAEVW KKMNAERVSKDSPFGKDFIGCAVDLGRMAQ LMYHNGDGHGTQHPIIHQQMTATLFEPFA Cannabis MQCIAFHQFASSSSLPIWSSIDNRFTPKTS ABI21837.1 21 sativa ITSISKPKPKLKSKSNLKSRSRSSTCYSIQ CTVVDNPSSTITNNSDRRSANYGPPIWSFD FVQSLPIQYKGESYTSRLNKLEKDVKRMLI GVENSLAQLELIDTIQRLGISYRFENEIIS ILKEKFTNNNDNPNPNYDLYATALQFRLLR QYGFEVPQEIFNNFKNHKTGEFKANISNDI MGALGLYEASFHGKKGESILEEARIFTTKC LKKYKLMSSSNNNNMTLISLLVNHALEMPL QWRITRSEAKWFIEEIYERKQDMNPTLLEF AKLDFNMLQSTYQEELKVLSRWWKDSKLGE KLPFVRDRLVECFLWQVGVRFEPQFSYFRI MDTKLYVLLTIIDDMHDIYGTLEELQLFTN ALQRWDLKELDKLPDYMKTAFYFTYNFTNE LAFDVLQEHGFVHIEYFKKLMVELCKHHLQ EAKWFYSGYKPTLQEYVENGWLSVGGQVIL MHAYFAFTNPVTKEALECLKDGHPNIVRHA SIILRLADDLGTLSDELKRGDVPKSIQCYM HDTGASEDEAREHIKYLISESWKEMNNEDG NINSFFSNEFVQVCQNLGRASQFIYQYGDG HASQNNLSKERVLGLIITPIPM Mentha MALKVFSVATQMAIPSKLTRCLQPSHLKSS AAD50304.1 22 longifolia PKLLSSTNSSSRSRLRVYCSSSQLTTERRS GNYNPSRWDVEFIQSLHSDYEEDKHAIRAS ELVTLVKMELEKETDHIRQLELIDDLQRMG LSDHFQNEFKEILSSIYLDHHYYKNPFPKE ERDLYSTSLAFRLLREHGFQVAQEVFDSFK NEEGEFKESLSDDTRGLLQLYEASFLLTEG ETTLESAREFATKFLEERVNEGGVDGDLLT RIAYSLDIPLHWRIKRPNAPAWIEWYRKRP DMNPVVLELAILDLNIVQAQFQEELKESFR WWRNTGFVEKLPFARDRLVECYFWNTGIIE PRQHASARIMMGKVNALITVIDDIYDVYGT LEELEQFTDLIRRWDINSIDQLPDYMQLCF LALNNFVDDTSYDVMKEKGVNVIPYLRQSW VDLADKYMVEARWFYGGHKP SLEEYLENSWQSISGPCMLTHIFFRVTDSF TKETVDSLYK YHDLVRWSSFVLRLADDLGTSVEEVSRGDV PKSLQCYMSDYNASEAEARKHVKWLIAEVW KKMNAERVSKDSPFGKDFIGCAADLGRMAQ LMYHNGDGHGTQHPIIHQQMTRTLFEPFA Picea MSPVSAIPLAYKLCLPRSLISSSRELNPLH ABA86248.1 23 sitchensis ITIPNLGMCRRGKSMAPASMSMILTAAVSD DDRVQRRRGNYHSNLWDDDFIQSLSTPYGE PSYRESAERLKGEIKKMFRSMSKEDEELIT PLNDLIQRLWMVDSVERLGIDRHFKNEIKS ALDYVYSYWNEKGIGCGRDSVVADLNSTAL GFRTLRLHGYNVSSEVLKVFEDQNGQFACS PSKTEGEIRSALNLYRASLIAFPGEKVMED AEIFSSRYLKEAVQKIPDCSLSQEIAYALE YGWHTNMPRLEARNYMDVFG HPSSPWLKKNKTQYMDGEKLLELAKLEFNI FHSLQQEELQYISRWWKDSGLPKLAFSRHR HVEYYTLGSCIATDPKHRAFRLGFVKTCHL NTVLDDIYDTFGTMDEIELFTEAVRRWDPS ETESLPDYMKGVYMVLYEALTEMAQEAEKT QGRDTLNYARKAWEIYLDSYIQEAKWIASG YLPTFQEYFE NGKISSAYRAAALTPILTLDVPLPEYILKG IDFPSRFNDLASSFLRLRGDTRCYKADRAR GEEASCISCYMKDNPGSTEEDALNHINSMI NEIIKELNWELLRPDSNIPMPARKHAFDIT RALHHLYKYRDGFSVATKETKSLVSRMVLE PVTL Perilla 1MYTGVIMHMAIPIKPAHYLHNSGRSYASQL AAK06663.1 24 frutescensvar. CGFSSTSTRAAIARLPLCLRFRCSLQASDQ frutescens RRSGNYSPSFWNADYILSLNNHYKEESRHM KRAGELIVQVKMVMGKETDPVVQLELIDDL HKLALSHHFEKEIKEILFNISIYDHKIMVE RDLYSTALAFRLLRQYGFKVPQEVFDCFKN DNGEFKRSLSSDTKGLLQLYEASFLLTEGE MTLELAREFATIFLQEKLNDKTIDDDDDAD TNLISCVRHSLDIPIHWRIQRPNASWWIDA YKRRSHMNPLVLELAKLDLNIFQAQFQQEL KQDLGWWKNTCLAEKLPFTRDRLVECYFWC TGIIQPLQHENARVTLAKVNALITTLDDIY DVYGTLEELELFTEAIRRWDVSSIDHLPNY MQLCFLALNNFVDDTAYDVMKEKDINIIPY LRKSWLDLAETYLVEAKWFYSGHKPNMEEY LNNAWISISGPVMLCHVFFRVTDSITRETV ESLFKYHDLIRYSSTILRLADDLGTSLEEV SRGDVPKSIQCYMNDNNASEEEARRHVRWL IAETWKKINEEVWSADSPFCKDFIACAADM GRMAQFMYHNGDGHGIQNPQIHQQMTDILF EQWL Rosmarinus MFTIMTSMAIPMKPVKHVHNFAARRDPKLR ABD77416.1 25 officinalis LASPTCWRQSCSLKLTTDYPCDQLQSTRRS GNYKPTLWDFERIQSLNSVYTEEKYTTRAS ELVVQVKKLLLLESNWFLQLELIDDLQKLG VSYRFNHEINQILNRIYLEQKYCNNSERDL YSTALAFRLLRQHGLKVSQDVFDFFKNDEG EFEPNLGDNTKGLLQLYEASFLLTEGEMSL EQARVFSTNLLQKKLDDGIMDEYLSSLVRR SLELPLHWSVQRPNSRWLIDAYTNRSDVNP ILIELAKLDFNIVQASYHEELKEVSRWWKE TELAEKLPFARDRVVENYIWNVGLLFQPQY GYPRIMTTKLFILITVIDDVFDVYGTLEET ELFKKAILSWDVEVLDQLPNYMQICYMALD SFINEMAYHVLKEQGVLIIQDLRKFWADLC VAYAKEAEWYHTGHKPTMEEYIDVAWISIS AHLILAHVFFLITNPIGKEAAESLRNYDDI IRNSAMILRLADDLGTSSYEMQRGDVPKAV ECYMNEMGASVEEAREHVKC MIREAWMKTSAERFKESPFSKDFIRSAADL GRHAQYMYQHGDGHGIRNPQMEERISTLIF QPID Citrus MSSCINPSTLVTSVNAFKCLPLATNKAAIR BAF73932.1 26 jambhiri IMAKYKPVQCLISAKYDNLTVDRRSANYQP SIWDHDFLQSLNSNYTDEAYKRRAEELRGK VKIAIKDVIEPLDQLELIDNLQRLGLAHRF ETEIRNILNNIYNNNKDYNWRKENLYATSL EFRLLRQHGYPVSQEVFNGFKDDQGGFICD DFKGILSLHEASYYSLEGESIMEEAWQFTS KHLKEVMISKNMEEDVFVAEQAKRALELPL HWKVPMLEARWFIHIYERREDKNHLLLELA KMEFNTLQAIYQEELKEISGWWKDTGLGEK LSFARNRLVASFLWSMGIAFEPQFAYCRRV LTISIALITVIDDIYDVYGTLDELEIFTDA VERWDINYALKHLPGYMKMCFLALYNFVNE FAYYVLKQQDFDLLLSIKNAWLGLIQAYLV EAKWYHSKYTPKLEEYLENGLVSITGPLII TISYLSGTNPIIKKELEFLESNPDIVHWSS KIFRLQDDLGTSSDEIQRGDVPKSIQCYMH ETGASEEVARQHIKDMMRQM WKKVNAYTADKDSPLTGTTTEFLLNLVRMS HFMYLHGDGHGVQNQETIDVGFTLLFQPIP LEDKHMAFTA SPGTKG (R)OR(+)SYNTHASES Toona MASHVLASLRSASARISTRLQSRSCILATA BAH03282.1 27 sinensis TSFSNGFVSASLVQSMSTTTQCDESVARRS (+synthase) ANYEPPIWTYDYVQSLRNPYAGGSYAKRIE KLKGDVRVMLQKLVDLDPLHQLEFIDTLQR LGVSYHYQEGIKGILDTVYNNYMQKQESLY AVALGFRLFRQHGYHIPADIFSSFRDDKGN LKSCLGDDCRGILALYEAAHLLVEEERDIF YEIVNFTTAYLKEYVKHDNDEYLSALVNHS LEIPLHWRVLRLEARWFIGAYERAPNTHPI LLEFAKLDFNDVQATHQEDLKFMSRWWKNT GLDREKMNFARDRIVQNVLWSLGIIFEPQF AYCRRMSVKAYAFITLIDDVYDVYGTLDEL ELFTDAVDRWDATAIEKLPDYMKPIFRTLY TSINDMALDARKDRGVDTRPFLHKAWSTLF NYYLMEAKWFSNGYMPTYKEYMDIAWFSVG GPVMIVHSYCAIANPATKENMEFFQEYYDI IRLCSTILRFKDDMGTSSDELKRGDNPKSI QCYMHESGVSEKEARQHLGNLITETWMKVN KNRAENPHLSDVYMGIAINMARMALCMYQF GDGHAVEAHSKDRVLSLLINPIPCP Citruslimon MSSCINPSTLVTSVNAFKCLPLATNKAAIR Q8L5K3.1 28 IMAKYKPVQCLISAKYDNLTVDRRSANYQP SIWDHDFLQSLNSNYTDEAYKRRAEELRGK VKIAIKDVIEPLDQLELIDNLQRLGLAHRF ETEIRNILNNIYNNNKDYNWRKENLYATSL EFRLLRQHGYPVSQEVFNGFKDDQGGFICD DFKGILSLHEASYYSLEGESIMEEAWQFTS KHLKEVMISKNMEEDVFVAEQAKRALELPL HWKVPMLEARWFIHIYERREDKNHLLLELA KMEFNTLQAIYQEELKEISGWWKDTGLGEK LSFARNRLVASFLWSMGIAFEPQFAYCRRV LTISIALITVIDDIYDVYGTLDELEIFTDA VERWDINYALKHLPGYMKMCFLALYNFVNE FAYYVLKQQDFDLLLSIKNAWLGLIQAYLV EAKWYHSKYTPKLEEYLENGLVSITGPLII TISYLSGTNPIIKKELEFLESNPDIVHWSS KIFRLQDDLGTSSDEIQRGDVPKSIQCYMH ETGASEEVARQHIKDMMRQMWKKVNAYTAD KDSPLTGTTTEFLLNLVRMSHFMYLHGDGH GVQNQETIDVGFTLLFQPIPLEDKHMAFTA SPGTKG Ricinus MEIVFSSSLSSTLTVTKILRSPRHATTGNM EEF46639.1 29 communis QDYSRFPLFFTIASRSNASQAKHRRSANYH PTIWDPKAIECLRTPYTYDGVHGARLQKLK DEVRSLLTTFTKEPCGQLKLIDSMQRLGVS YHFREEIEEILNLVELDSDSDLYTTALHFR LLRQHGFTISKEVFEKFRNEDGKFKDSLKE DILGLLSLYDASYLGMHGEHILEEAKDFST EQLKSLLGRSQGDIVTYQVKQALDVPLHWR MQRIENRNYINIYQKEDTNNLALLELAKLD YNLVQSVYQIELKELARWWIALGFREKLHF SRDRLMENYLWSMGMIFEPHFSKCRIYLTK FICILSSIDDMYDIYGSLDELELFTSALKR WDPMALEELPDYMKICYLAILNFASELVYD VLKEEGLYTLPFIRDEWVKLCQAYLVEARW FNSGYTPTFDEYLENAWISVGGHEAIVHAC ALLGHTSTEDFQNFLKHGFELIYWSSLLVR LNDDLGTSQAEIKRGDVVKSIQCYMIEKGV SEKEAKDHVKGLISHAWKVLNEESVKCSLS RSFVNVCLNMTRTAQCIFQYGDGIGTSIGV TKDRLEFLIVKPIL
(116) It is well established that the genetic code is degenerate and that some amino acids have multiple codons, and accordingly, multiple polynucleotides can encode the limonene synthase of the invention. Moreover, the polynucleotide sequence can be manipulated for various reasons. Examples include, but are not limited to, the incorporation of preferred codons to enhance the expression of the polynucleotide in various organisms (see generally Nakamura et al., Nuc. Acid. Res. (2000) 28 (1): 292). In addition, silent mutations can be incorporated in order to introduce, or eliminate restriction sites, remove cryptic splice sites, or manipulate the ability of single stranded sequences to form stem-loop structures: (see, e.g., Zuker M., Nucl. Acid Res. (2003); 31(13): 3406-3415). In addition, expression can be further optimized by including consensus sequences at and around the start codon.
(117) Such codon optimization can be completed by standard analysis of the preferred codon usage for the host organism in question, and the synthesis of an optimized nucleic acid via standard DNA synthesis. A number of companies provide such services on a fee for services basis and include for example, DNA2.0, (CA, USA) and Operon Technologies. (CA, USA).
(118) The limonene synthase may be in its native form, i.e., as different apo forms, or allelic variants as they appear in nature, which may differ in their amino acid sequence, for example, by proteolytic processing, including by truncation (e.g., from the N- or C-terminus or both) or other amino acid deletions, additions, insertions, substitutions.
(119) Naturally-occurring chemical modifications including post-translational modifications and degradation products of the limonene synthase, are also specifically included in any of the methods of the invention including for example, pyroglutamyl, iso-aspartyl, proteolytic, phosphorylated, glycosylated, reduced, oxidatized, isomerized, and deaminated variants of the limonene synthase.
(120) The limonene synthase which may be used in any of the methods, fusion proteins, DNA constructs, and plants of the invention may have amino acid sequences which are substantially homologous, or substantially similar to any of the native limonene synthase sequences, for example, to any of the native limonene synthase gene sequences listed in Table D3.
(121) Alternatively, the limonene synthase may have an amino acid sequence having at least 30% preferably at least 40, 50, 60, 70, 75, 80, 85, 90, 95, 98, or 99% identity with a limonene synthase listed in Table D3. In certain embodiments, the limonene synthase for use in any of the methods and plants of the present invention is at least 80% identical to the mature limonene synthase from Menthapiperita (shown both with and without the native transit peptide):
(122) TABLE-US-00007 (SEQIDNO:30) MALKVFSGAMQMPIPSKLTTYLQPSHLNSSPKLLSNTKGTSRSRLRVSCS SSQLTTERRSGNYNPSRWDVDFIQTLHSDYKDEKHARRASELVTLVKME LEKETDQIRQLELIDDLQRMGLSDHFQNEFKEILSSVYLDHGYYKNPDPK EERDLYSTSLAFRLLREHGFQVAQEVFDSFKNEEGEFKESLSDDTRGLLQ LYEASFLLTEGETTLESAREFATKFLEERVNEGGGDENLLTRIAYSLEIP LHWRIKRPNAPVWIDSYRKRPNMNPVVLDLAILDLNIVQAHFQQELKESF RWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALIT VIDDIYDVYGTLEELEHFTDLIRRWDIDSIDQLPDYMQLCFLALNNFVDE TSYDVMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGGHKPSLEEYLEN SWMSISGPCMLTHIFFRVTDSFTKETVDSLYKYHDLVRWSSFVLRLADDL GTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKMNA ERVSKDSPFGKDFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTAT LFEPFA. (SEQIDNO:31) MQLTTERRSGNYNPSRWDVDFIQTLHSDYKDEKHARRASELVTLVKME LEKETDQIRQLELIDDLQRMGLSDHFQNEFKEILSSVYLDHGYYKNPDP KEERDLYSTSLAFRLLREHGFQVAQEVFDSFKNEEGEFKESLSDDTR GLLQLYEASFLLTEGETTLESAREFATKFLEERVNEGGGDENLLTRIAY SLEIPLHWRIKRPNAPVWIDSYRKRPNMNPVVLDLAILDLNIVQAHFQQ ELKESFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMM GKVNALITVIDDIYDVYGTLEELEHFTDLIRRWDIDSIDQLPDYMQLCFL ALNNFVDETSYDVMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGG HKPSLEEYLENSWMSISGPCMLTHIFFRVTDSFTKETVDSLYKYHDLV RWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARK HVKWLIAEVWKKMNAERVSKDSPFGKDFIGCAVDLGRMAQLMYHNG DGHGTQHPIIHQQMTATLFEPFA.
(123) Additionally in some embodiments, the limonene synthase, and fusion proteins thereof, can include modified forms in which the native transit peptide has been removed, or replaced with another synthetic, or naturally occurring, transit peptide sequence derived from another well characterized chloroplast localized proteins. Such transit sequences are joined to the coding sequence of an expressed gene, and are removed post-translationally from the initial translation product. Various transit peptides which function as described herein are well known in the art, and are described in, for example, Johnson et al. The Plant Cell (1990) 2:525-532; Sauer et al. EMBO J. (1990) 9:3045-3050; Mueckler et al. Science (1985) 229:941-945; Von Heijne, Eur. J. Biochem. (1983) 133:17-21; Yon Heijne, J. Mol. Biol. (1986) 189:239-242; Iturriaga et al. The Plant Cell (1989) 1:381-390; McKnight et al., Nucl. Acid Res. (1990) 18:4939-4943; Matsuoka and Nakamura, Proc. Natl. Acad. Sci. USA (1991) 88:834-838. Such transit peptides can be identified in the primary amino acid sequences of the preproteins by those ordinarily skilled in the art. For example, see Colby et al. (1993) J. Biol. Chem. 268(31):23016-23024, for the transit peptide sequence of limonene synthase.
(124) In certain embodiments, the transit peptide may comprise the pea RuBisCO small subunit transit peptide:
(125) TABLE-US-00008 (SEQIDNO:32) (MASMISSSAVTTVSRASTVQSAAVAPFGGLKSMTGFPVKKVNTDITSI TSNGGRVKC),
as shown fused to the 5 region of the LS gene below:
(126) TABLE-US-00009 (SEQIDNO:33) MASMISSSAVTTVSRASTVQSAAVAPFGGLKSMTGFPVKKVNTDITSI TSNGGRVKCMDPQLTTERRSGNYNPSRWDVDFIQTLHSDYKDEKHA RRASELVTLVKMELEKETDQIRQLELIDDLQRMGLSDHFQNEFKEILS SVYLDHGYYKNPDPKEERDLYSTSLAFRLLREHGFQVAQEVFDSFKN EEGEFKESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEERVN EGGGDENLLTRIAYSLEIPLHWRIKRPNAPVWIDSYRKRPNMNPVVLDL AILDLNIVQAHFQQELKESFRWWRNTGFVEKLPFARDRLVECYFWNTG IIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEHFTDLIRRWDID SIDQLPDYMQLCFLALNNFVDETSYDVMKEKGVNVIPYLRQSWVDLA DKYMVEARWFYGGHKPSLEEYLENSWMSISGPCMLTHIFFRVTDSF TKETVDSLYKYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQC YMSDYNASEAEARKHVKWLIAEVWKKMNAERVSKDSPFGKDFIGC AVDLGRMAQLMYHNGDGHGTQHPIIHQQMTATLFEPFA
IV. Auxiliary Enzymes
(127) In certain embodiments of any of the methods, fusion proteins, transgenic plants and DNA constructs disclosed herein, the invention includes the further expression, or introduction of further synthetic enzymes to promote the formation of distinct classes of terpenes. Representative exemplary enzymes include for example, the enzymes listed in Table D4.
(128) TABLE-US-00010 TABLE D4 Exemplary Auxiliary Enzymes GeneBank Type of Species Name Accession No. Synthase Mentha piperita farnesyl AAK63847.1 Prenyl- diphosphate transferases: synthase Salvia officinalis Sabinene AAC26018.1 monoterpene synthase synthases Arabidopsis Sabinene BAA95770.1 monoterpene thaliana synthase synthases Picea sitchensis Pinene AAP72020.1 monoterpene synthase synthases Aspergillus oryzae Anstolochene XP_001825789 sesquiterpene RIB40 synthase synthases Helianthus annuus Cadinene ACA33926.1 sesquiterpene synthase synthases Solanum Vetispiradiene AAG09950.1 sesquiterpene lycopersicum synthase synthases
(129) Those of skill in the art will appreciate that the foregoing list represents only representative exemplary enzymes that could be additionally expressed with the GDP synthase and limonene fusion proteins to enhance the relative production of a specific terpene, or class of terpene, for example to increase the relative production of specific sesquiterpene terpenes.
(130) V. Fusion Proteins
(131) In certain embodiments, the invention includes fusion proteins of either the GDP synthase large and small subunits, or one or more of these subunits fused to limonene synthase. In certain embodiments these fusion proteins may increase the relative enzymatic specific activity and/or efficiency of terpene synthesis.
(132) Examples of such fusion proteins include, i) the fusion of the GDP synthase large subunit to the GDP synthase small subunit; ii) the fusion GDP synthase large subunit to limonene synthase; iii) the fusion of the GDP synthase small subunit to limonene synthase. It will be appreciated that any of such fusion proteins can be arranged in a number of different of relative orientations. Specific embodiments contemplated herein include:
(133) 5 TP-GDP synthase (large subunit)-GDP synthase (small subunit) 3
(134) 5 TP-GDP synthase (small subunit)-GDP synthase (large subunit) 3
(135) 5 TP-GDP synthase (large subunit)-limonene synthase 3
(136) 5 TP-GDP synthase (small subunit)-limonene synthase 3
(137) 5 TP-limonene synthase-GDP synthase (large subunit) 3
(138) 5 TP-limonene synthase-GDP synthase (small subunit) 3
(139) 5 TP-limonene synthase-GDP synthase (large subunit)-GDP synthase (small subunit) 3
(140) 5 TP-limonene synthase-GDP synthase (small subunit)-GDP synthase (large subunit) 3
(141) 5 TP-GDP synthase (large subunit)-GDP synthase (small subunit)-limonene synthase 3
(142) 5 TP-GDP synthase (small subunit)-GDP synthase (large subunit)-limonene synthase 3
(143) 5 TP-GDP synthase (large subunit)-limonene synthase-GDP synthase (small subunit) 3
(144) 5 TP-GDP synthase (small subunit)-limonene synthase-GDP synthase (large subunit) 3
(145) Where - represents an optional linker, and TP represents a transit peptide.
(146) It will be appreciated that a flexible molecular linker (or spacer) optionally may be interposed between, and covalently join, any of the transit peptides, GPP synthase subunits and limonene synthases disclosed herein. Any such fusion protein may be used in any of the methods, proteins, polynucleotides and host cells of the present invention.
(147) Exemplary Fusion Protein Sequences Include:
(148) 5 TP-GDP Synthase (Small Subunit)-GDP Synthase (Large Subunit) 3.
(149) The construct shown includes a 10 amino acid linker (SSNNLGIEGR (SEQ ID NO:34)), with the native transit peptide sequences removed from the GDS large and small subunits, and with a 5 transit peptide from the pea RuBisCO small subunit.
(150) TABLE-US-00011 (SEQIDNO:34) MASMISSSAVTTVSRASTVQSAAVAPFGGLKSMTGFPVKKVNTDITSI TSNGGRVKCMDPQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTF AAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLP LTDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTD DPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYG EMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQL IDENIIGKLKELALEELGGFHGKNAELMSSLVAEPSLYAASSNNLGIE GRFDFDGYMLRKATSVNTALEAAVEMKEPLKIHESMRYSLLAGGKR VRPILCIAACELVGGDETTAMPAACAVEMIHTMSLMHDDLPCMDND DLRRGKPTNHKVFGESTAVLAGDALLSFAFEHVAATTRGAPTERIVR VLGELAVSIGSEGLVAGQVVDICSEGMAEVGLEHLEYIHHHKTAALL QGSVVLGAILGGGGEEEVARLRKFANCIGLLFQVVDDILDVTKSSKE LGKTAGKDLVADKTTYPKLIGVEKSKEFADRLKREAVEQLLHFHPHR AAPLIALANYIAYRDN
5 TP-Limonene Synthase-GDP Synthase (Small Subunit)-GDP Synthase (Large Subunit) 3
(151) The construct shown includes a 9 amino acid linker (SGGSGGSGG (SEQ ID NO:36)), linking the limonene synthase to the GDS (small subunit), with the native transit peptide sequences removed from the GDS subunit and limonene synthase, and with the transit peptide from the pea RuBisCO small subunit added to the N-terminus of limonene synthase.
(152) TABLE-US-00012 (SEQIDNO:37) MASMISSSAVTTVSRASTVQSAAVAPFGGLKSMTGFPVKKVNTDITSI TSNGGRVKCMDPQLTTERRSGNYNPSRWDVDFIQTLHSDYKDEKHA RRASELVTLVKMELEKETDQIRQLELIDDLQRMGLSDHFQNEFKEILS SVYLDHGYYKNPDPKEERDLYSTSLAFRLLREHGFQVAQEVFDSFK NEEGEFKESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEERVN EGGGDENLLTRIAYSLEIPLHWRIKRPNAPVWIDSYRKRPNMNPVVLD LAILDLNIVQAHFQQELKESFRWWRNTGFVEKLPFARDRLVECYFWNT GIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEHFTDLIRRWDI DSIDQLPDYMQLCFLALNNFVDETSYDVMKEKGVNVIPYLRQSWVD LADKYMVEARWFYGGHKPSLEEYLENSWMSISGPCMLTHIFFRVTD SFTKETVDSLYKYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKS LQCYMSDYNASEAEARKHVKWLIAEVWKKMNAERVSKDSPFGKD FIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTATLFEPFASGGS GGSGGMQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATA ASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPV SKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIE ISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAAC GAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKEL ALEELGGFHGKNAELMSSLVAEPSLYAASSNNLGIEGRFDFDGYMLR KATSVNTALEAAVEMKEPLKIHESMRYSLLAGGKRVRPILCIAACELV GGDETTAMPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHKV FGESTAVLAGDALLSFAFEHVAATTRGAPTERIVRVLGELAVSIGSE GLVAGQVVDICSEGMAEVGLEHLEYIHHHKTAALLQGSVVLGAILGG GGEEEVARLRKFANCIGLLFQVVDDILDVTKSSKELGKTAGKDLVADK TTYPKLIGVEKSKEFADRLKREAVEQLLHFHPHRAAPLIALANYIAYRDN
5 TP-GDP Synthase (Small Subunit)-GDP Synthase (Large Subunit)-Limonene Synthase
(153) The construct shown also includes a 9 amino acid linker (SGGSGGSGG (SEQ ID NO:36)) linking GDS (large) to limonene synthase. Here the native transit peptide sequences have been removed from the GDS large and small subunits, and limonene synthase, and the 5 transit peptide from the pea RuBisCO small subunit added to the N-terminus.
(154) TABLE-US-00013 (SEQIDNO:38) MASMISSSAVTTVSRASTVQSAAVAPFGGLKSMTGFPVKKVNTDITSI TSNGGRVKCMDPQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFA APATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLT DGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDP DRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYG EMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQL IDENIIGKLKELALEELGGFHGKNAELMSSLVAEPSLYAASSNNLGIE GRFDFDGYMLRKATSVNTALEAAVEMKEPLKIHESMRYSLLAGGKR VRPILCIAACELVGGDETTAMPAACAVEMIHTMSLMHDDLPCMDND DLRRGKPTNHKVFGESTAVLAGDALLSFAFEHVAATTRGAPTERIVR VLGELAVSIGSEGLVAGQVVDICSEGMAEVGLEHLEYIHHHKTAALL QGSVVLGAILGGGGEEEVARLRKFANCIGLLFQVVDDILDVTKSSKE LGKTAGKDLVADKTTYPKLIGVEKSKEFADRLKREAVEQLLHFHPHR AAPLIALANYIAYRDNSGGSGGSGGMQLTTERRSGNYNPSRWDVDFI QTLHSDYKDEKHARRASELVTLVKMELEKETDQIRQLELIDDLQRMGL SDHFQNEFKEILSSVYLDHGYYKNPDPKEERDLYSTSLAFRLLREHGF QVAQEVFDSFKNEEGEFKESLSDDTRGLLQLYEASFLLTEGETTLES AREFATKFLEERVNEGGGDENLLTRIAYSLEIPLHWRIKRPNAPVWID SYRKRPNMNPVVLDLAILDLNIVQAHFQQELKESFRWWRNTGFVEK LPFARDRLVECYFWNTGIIEPRQHASAREVIMGKVNALITVIDDIYDVYG TLEELEHFTDLIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYDVMKEK GVNVIPYLRQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWMSISG PCMLTHIFFRVTDSFTKETVDSLYKYHDLVRWSSFVLRLADDLGTSVE EVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKMNAERVS KDSPFGKDFIGCAVDLGRMAQLMYHNGDGHGTQHPIIHQQMTATLFEPFA
VI. DNA Constructs
(155) In some embodiments, the DNA constructs, and expression vectors of the invention include separate expression vectors each including either the isolated geranyl diphosphate synthase or limonene synthase, or the previously described fusion proteins thereof.
(156) In one aspect the DNA constructs and expression vectors for the GDS and limonene fusion proteins comprise polynucleotide sequences encoding any of the previously described fusion proteins operatively coupled to a promoter, transit peptide sequence and transcriptional terminator for efficient expression in the organism of interest. In one aspect of any of these expression vectors, the geranyl diphosphate synthase is codon optimized for expression in the organism of interest.
(157) In some embodiments, the geranyl diphosphate synthase DNA constructs and expression vectors of the invention further comprise polynucleotide sequences encoding one or more of the following elements i) a selectable marker gene to enable antibiotic selection, ii) a screenable marker gene to enable visual identification of transformed cells, and iii) T-element DNA sequences to enable Agrobacterium tumefaciens mediated transformation. Exemplary expression cassettes are described in the Examples.
(158) In certain embodiments, the DNA constructs and expression vectors for the limonene synthase, comprise polynucleotide sequences encoding any of the previously described limonene synthase, genes (Table D2) operatively coupled to a promoter, and transcriptional terminator for efficient expression in the organism of interest. In one aspect of any of these expression vectors, the limonene synthase is codon optimized for expression in the photosynthetic organism of interest. In one aspect the limonene synthase gene encodes a limonene synthase of Menthapiperita.
(159) In some embodiments, the limonene synthase DNA constructs and expression vectors of the invention further comprise polynucleotide sequences encoding one or more of the following elements i) a selectable marker gene to enable antibiotic selection, ii) a screenable marker gene to enable visual identification of transformed cells, and iii) T-element DNA sequences to enable Agrobacterium tumefaciens mediated transformation. Exemplary expression cassettes are described in the Examples.
(160) In another embodiment, the DNA constructs, and expression vectors of the invention include expression vectors comprising nucleic acid sequences encoding i) the GDS large and small subunit fusion protein and ii) a limonene synthase gene. Exemplary expression cassettes are described in the Examples.
(161) Those of skill in the art will appreciate that the foregoing descriptions of expression cassettes represents only illustrative examples of expression cassettes that could be readily constructed, and is not intended to represent an exhaustive list of all possible DNA constructs or expression cassettes that could be constructed.
(162) Moreover expression vectors suitable for use in expressing the claimed DNA constructs in plants, and methods for their construction are generally well known, and need not be limited. These techniques, including techniques for nucleic acid manipulation of genes such as subcloning a subject promoter, or nucleic acid sequences encoding a gene of interest into expression vectors, labeling probes, DNA hybridization, and the like, and are described generally in Sambrook, et al., Molecular CloningA Laboratory Manual (2nd Ed.), Vol. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., 1989, which is incorporated herein by reference. For instance, various procedures, such as PCR, or site directed mutagenesis can be used to introduce a restriction site at the start codon of a heterologous gene of interest. Heterologous DNA sequences are then linked to a suitable expression control sequences such that the expression of the gene of interest are regulated (operatively coupled) by the promoter. DNA constructs comprising an expression cassette for the gene of interest can then be inserted into a variety of expression vectors. Such vectors include expression vectors that are useful in the transformation of plant cells. Many other such vectors useful in the transformation of plant cells can be constructed by the use of recombinant DNA techniques well known to those of skill in the art as described above.
(163) Exemplary expression vectors for expression in protoplasts or plant tissues include pUC 18/19 or pUC 118/119 (GIBCO BRL, Inc., MD); pBluescript SK (+/) and pBluescript KS (+/) (STRATAGENE, La Jolla, Calif.); pT7Blue T-vector (NOVAGEN, Inc., WI); pGEM-3Z/4Z (PROMEGA Inc., Madison, Wis.), and the like vectors, such as is described herein Exemplary vectors for expression using Agrobacterium tumefaciens-mediated plant transformation include for example, pBin 19 (CLONETECH), Frisch et al, Plant Mol. Biol., 27:405-409, 1995; pCAMBIA 1200 and pCAMBIA 1201 (Center for the Application of Molecular Biology to International Agriculture, Canberra, Australia); pGA482, An et al, EMBO J., 4:277-284, 1985; pCGN1547, (CALGENE Inc.) McBride et al, Plant Mol. Biol., 14:269-276, 1990, and the like vectors, such as is described herein.
(164) Expression Control Sequences:
(165) DNA constructs will typically include expression control sequences comprising promoters to drive expression of the limonene synthase and geranyl diphosphate synthase within the plastids of the photosynthetic organism. Promoters may provide ubiquitous, cell type specific, constitutive promoter or inducible promoter expression. Basal promoters in plants typically comprise canonical regions associated with the initiation of transcription, such as CAAT and TATA boxes. The TATA box element is usually located approximately 20 to 35 nucleotides upstream of the initiation site of transcription. The CAAT box element is usually located approximately 40 to 200 nucleotides upstream of the start site of transcription. The location of these basal promoter elements result in the synthesis of an RNA transcript comprising nucleotides upstream of the translational ATG start site. The region of RNA upstream of the ATG is commonly referred to as a 5 untranslated region or 5 UTR. It is possible to use standard molecular biology techniques to make combinations of basal promoters, that is, regions comprising sequences from the CAAT box to the translational start site, with other upstream promoter elements to enhance or otherwise alter promoter activity or specificity. In some aspects promoters may be altered to contain enhancer DNA to assist in elevating gene expression. As is known in the art certain DNA elements can be used to enhance the transcription of DNA. These enhancers often are found 5 to the start of transcription in a promoter that functions in eukaryotic cells, but can often be inserted upstream (5) or downstream (3) to the coding sequence. In some instances, these 5 enhancer DNA elements are introns. Among the introns that are particularly useful as enhancer DNA are the 5 introns from the rice actin 1 gene (see U.S. Pat. No. 5,641,876), the rice actin 2 gene, the maize alcohol dehydrogenase gene, the maize heat shock protein 70 gene (U.S. Pat. No. 5,593,874), the maize shrunken 1 gene, the light sensitive 1 gene of Solanum tuberosum, and the heat shock protein 70 gene of Petunia hybrida (U.S. Pat. No. 5,659,122).
(166) Depending upon the host cell system utilized, any one of a number of suitable promoters can be used. Promoter selection can be based on expression profile and expression level. The following are representative non-limiting examples of promoters that can be used in the expression cassettes.
(167) Constitutive Expression:
(168) Constitutive promoters typically provide for the constant and substantially uniform production of proteins in all tissues. Exemplary constitutive promoters include for example, the core promoter of the Rsyn7 (U.S. patent application Ser. No. 08/661,601), the core CaMV 35S promoter (Odell et al. (1985) Nature 313:810-812); rice actin (McElroy et al. (1990) Plant Cell 2:163-171); ubiquitin (Christensen et al. (1989) Plant Mol. Biol. 12:619-632 and Christensen et al. (1992) Plant Mol. Biol. 18:675-689); pEMU (Last et al. (1991) Theor. Appl. Genet. 81:581-588); MAS (Velten et al. (1984) EMBO J. 3:2723-2730); ALS promoter (U.S. patent application Ser. No. 08/409,297), and the like. Other constitutive promoters include, for example, U.S. Pat. Nos. 5,608,149; 5,608,144; 5,604,121; 5,569,597; 5,466,785; 5,399,680; 5,268,463; and 5,608,142.
(169) Tissue Specific Expression:
(170) Tissue-specific promoters include those described in Yamamoto et al. (1997) Plant J. 12(2):255-265; Kawamata et al. (1997) Plant Cell Physiol. 38(7):792-803; Hansen et al. (1997) Mol. Gen. Genet. 254(3):337-343; Russell et al. (1997) Transgenic Res. 6(2):157-168; Rinehart et al. (1996) Plant Physiol. 112(3):1331-1341; Van Camp et al. (1996) Plant Physiol. 112(2):525-535; Canevascini et al. (1996) Plant Physiol. 112(2):513-524; Yamamoto et al. (1994) Plant Cell Physiol. 35(5):773-778; Lam (1994) Results Probl. Cell Differ. 20:181-196; Orozco et al. (1993) Plant Mol. Biol. 23(6):1129-1138; Matsuoka et al. (1993) Proc. Natl. Acad. Sci. U.S.A. 90(20):9586-9590; and Guevara-Garcia et al. (1993) Plant J. 4(3):495-505. Root specific promoters include, for example, those disclosed in Hire, et al (1992) Plant Mol. Biology, 20(2): 207-218; Keller and Baumgartner, (1991) The Plant Cell, 3(10): 1051-1061; Sanger et al. (1990) Plant Mol. Biology, 14(3): 433-443; Miao et al. (1991) The Plant Cell, 3(1): 11-22; Bogusz et al. (1990) The Plant Cell, 2(7): 633-641. Seed-preferred promoters includes both seed-specific promoters (those promoters active during seed development) as well as seed-germinating promoters (those promoters active during seed germination). Such promoters include Cim1 (cytokinin-induced message); cZ19B1 (maize 19 KDa zein); milps (myo-inositol-1-phosphate synthase); celA (cellulose synthase); end1 (Hordeum verlgase mRNA clone END1); and imp3 (myo-inositol monophosphate-3). For dicots, particular promoters include phaseolin, napin, -conglycinin, soybean lectin, and the like. For monocots, particular promoters include maize 15 Kd zein, 22 KD zein, 27 kD zein, waxy, shrnmken 1, shrunken 2, globulin 1, etc. In certain embodiments the DNA constructs, transgenic plants and methods use the oleosin promoter and/or napin promoter.
(171) Inducible Expression:
(172) Chemically Inducible PR-la Promoter. The double 35S promoter in pCGN1761ENX can be replaced with any other promoter of choice that will result in suitably high expression levels. By way of example, one of the chemically regulatable promoters described in U.S. Pat. Nos. 5,614,395 and 5,880,333 can replace the double 35S promoter. The promoter of choice is preferably excised from its source by restriction enzymes, but can alternatively be PCR-amplified using primers that carry appropriate terminal restriction sites. The selected target gene coding sequence can be inserted into this vector, and the fusion products (i.e., promoter-gene-terminator) can subsequently be transferred to any selected transformation vector, including those described below. Various chemical regulators can be employed to induce expression of the selected coding sequence in the plants transformed according to the presently disclosed subject matter, including the benzothiadiazole, isonicotinic acid, salicylic acid and Ecdysone receptor ligands compounds disclosed in U.S. Pat. Nos. 5,523,311, 5,614,395, and 5,880,333 herein incorporated by reference.
(173) Transcriptional Terminators:
(174) A variety of transcriptional terminators are available for use in the DNA constructs of the invention. These are responsible for the termination of transcription beyond the transgene and its correct polyadenylation.
(175) Appropriate transcriptional terminators are those that are known to function in the relevant plant system. Representative plant transcriptional terminators include the CaMV 35S terminator, the tml terminator, the nopaline synthase terminator (NOS ter), and the pea rbcS E9 terminator. In certain embodiments, the inventions utilize the oleosin terminator and/or napin terminator. With regard to RNA polymerase III terminators, these terminators typically comprise a 52 run of 5 or more consecutive thymidine residues. In one embodiment, an RNA polymerase III terminator comprises the sequence TTTTTTT. These can be used in both monocotyledons and dicotyledons.
(176) Transit Peptide (TP) Sequences:
(177) Various transit peptides which function as described herein are well known in the art, and are described in, for example, Johnson et al. The Plant Cell (1990) 2:525-532; Sauer et al. EMBO J. (1990) 9:3045-3050; Mueckler et al. Science (1985) 229:941-945; Von Heijne, Eur. J. Biochem. (1983) 133:17-21; Yon Heijne, J. Mol. Biol. (1986) 189:239-242; Iturriaga et al. The Plant Cell (1989) 1:381-390; McKnight et al., Nucl. Acid Res. (1990) 18:4939-4943; Matsuoka and Nakamura, Proc. Natl. Acad. Sci. USA (1991) 88:834-838. Such transit peptides can be identified in the primary amino acid sequences of the preproteins by those ordinarily skilled in the art. For example, see Colby et al. (1993) J. Biol. Chem. 268(31):23016-23024, for the transit peptide sequence of limonene synthase. In certain embodiments, the transit peptide sequence form the RuBisCO small subunit transit peptide is used.
(178) Sequences for the Enhancement or Regulation of Expression:
(179) Numerous sequences have been found to enhance the expression of an operatively lined nucleic acid sequence, and these sequences can be used in conjunction with the nucleic acids of the presently disclosed subject matter to increase their expression in transgenic plants.
(180) Various intron sequences have been shown to enhance expression, particularly in monocotyledonous cells. For example, the introns of the maize Adbl gene have been found to significantly enhance the expression of the wild-type gene under its cognate promoter when introduced into maize cells. Intron 1 was found to be particularly effective and enhanced expression in fusion constructs with the chloramphenicol acetyltransferase gene. In the same experimental system, the intron from the maize bronzes gene had a similar effect in enhancing expression. Intron sequences have been routinely incorporated into plant transformation vectors, typically within the non-translated leader.
(181) A number of non-translated leader sequences derived from viruses are also known to enhance expression, and these are particularly effective in dicotyledonous cells. Specifically, leader sequences from Tobacco Mosaic Virus (TMV, the W-sequence), Maize Chlorotic Mottle Virus (MCMV), and Alfalfa Mosaic Virus (AMY) have been shown to be effective in enhancing expression.
(182) Selectable Markers:
(183) For certain target species, different antibiotic or herbicide selection markers can be included in the DNA constructs of the invention. Selection markers used routinely in transformation include the npt II gene (Kan), which confers resistance to kanamycin and related antibiotics, the bar gene, which confers resistance to the herbicide phosphinothricin, the hph gene, which confers resistance to the antibiotic hygromycin, the dhfr gene, which confers resistance to methotrexate, and the EPSP synthase gene, which confers resistance to glyphosate (U.S. Pat. Nos. 4,940,935 and 5,188,642).
(184) Screenable Markers:
(185) Screenable markers may also be employed in the DNA constructs of the present invention, including for example the -glucuronidase or uidA gene (the protein product is commonly referred to as GUS), isolated from E. coli, which encodes an enzyme for which various chromogenic substrates are known; an R-locus gene, which encodes a product that regulates the production of anthocyanin pigments (red color) in plant tissues; a -lactamase gene, which encodes an enzyme for which various chromogenic substrates are known (e.g., PADAC, a chromogenic cephalosporin); a xylE gene, which encodes a catechol dioxygenase that can convert chromogenic catechols; an -amylase gene; a tyrosinase gene which encodes an enzyme capable of oxidizing tyrosine to DOPA and dopaquinone which in turn condenses to form the easily-detectable compound melanin; a -galactosidase gene, which encodes an enzyme for which there are chromogenic substrates; a luciferase (lux) gene, which allows for bioluminescence detection; an aequorin gene, which may be employed in calcium-sensitive bioluminescence detection; or a gene encoding for green fluorescent protein (PCT Publication WO 97/41228). Screenable markers also include fluorescent proteins, such as DsRed, that facilitate identification of transgenic seed. Expression of such screenable markers can be under the control of a seed-specific promoter.
(186) The R gene complex in maize encodes a protein that acts to regulate the production of anthocyanin pigments in most seed and plant tissue. Maize strains can have one, or as many as four, R alleles which combine to regulate pigmentation in a developmental and tissue specific manner. Thus, an R gene introduced into such cells will cause the expression of a red pigment and, if stably incorporated, can be visually scored as a red sector. If a maize line carries dominant alleles for genes encoding for the enzymatic intermediates in the anthocyanin biosynthetic pathway (C2, A1, A2, Bz1 and Bz2), but carries a recessive allele at the R locus, transformation of any cell from that line with R will result in red pigment formation. Exemplary lines include Wisconsin 22 which contains the rg-Stadler allele and TR112, a K55 derivative which has the genotype r-g, b, Pl. Alternatively, any genotype of maize can be utilized if the Cl and R alleles are introduced together.
(187) In some aspects, screenable markers provide for visible light emission or fluorescence as a screenable phenotype. Suitable screenable markers contemplated for use in the present invention include firefly luciferase, encoded by the lux gene. The presence of the lux gene in transformed cells may be detected using, for example, X-ray film, scintillation counting, fluorescent spectrophotometry, low-light video cameras, photon counting cameras or multiwell luminometry. It also is envisioned that this system may be developed for population screening for bioluminescence, such as on tissue culture plates, or even for whole plant screening.
(188) Many naturally fluorescent proteins including red and green fluorescent proteins and mutants thereof, from jelly fish and coral are commercially available (for example from CLONTECH, Palo Alto, Calif.) and provide convenient visual identification of plant transformation.
(189) VII. Methods of Transformation
(190) Techniques for transforming a wide variety of plant species are well known and described in the technical and scientific literature. See, for example, Weising et al, (1988) Ann. Rev. Genet., 22:421-477. As described herein, the DNA constructs of the present invention typically contain a marker gene which confers a selectable phenotype on the plant cells. For example, the marker may encode biocide resistance, particularly antibiotic resistance, such as resistance to kanamycin, G418, bleomycin, hygromycin, or herbicide resistance, such as resistance to chlorsulfuron or Basta. Such selective marker genes are useful in protocols for the production of transgenic plants.
(191) DNA constructs can be introduced into the genome of the desired plant host by a variety of conventional techniques. For example, the DNA construct may be introduced directly into the DNA of the plant cell using techniques such as electroporation and microinjection of plant cell protoplasts. Alternatively, the DNA constructs can be introduced directly to plant tissue using biolistic methods, such as DNA micro-particle bombardment. In addition, the DNA constructs may be combined with suitable T-DNA flanking regions and introduced into a conventional Agrobacterium tumefaciens host vector. The virulence functions of the Agrobacterium tumefaciens host will direct the insertion of the construct and adjacent marker into the plant cell DNA when the cell is infected by the bacteria.
(192) Microinjection techniques are known in the art and well described in the scientific and patent literature. The introduction of DNA constructs using polyethylene glycol precipitation is described in Paszkowski et al, (1984) EMBO J., 3:2717-2722. Electroporation techniques are described in Fromm et al, (1985) Proc. Natl. Acad. Sci. USA, 82:5824. Biolistic transformation techniques are described in Klein et al, (1987) Nature 327:70-7. The full disclosures of all references cited are incorporated herein by reference.
(193) A variation involves high velocity biolistic penetration by small particles with the nucleic acid either within the matrix of small beads or particles, or on the surface (Klein et al, (1987) Nature, 327:70-73,). Although typically only a single introduction of a new nucleic acid segment is required, this method particularly provides for multiple introductions.
(194) Agrobacterium tumefaciens-meditated transformation techniques are well described in the scientific literature. See, for example Horsch et al, (1984) Science, 233:496-498, and Fraley et al, (1983) Proc. Natl. Acad. Sci. USA, 90:4803.
(195) More specifically, a plant cell, an explant, a meristem or a seed is infected with Agrobacterium tumefaciens transformed with the segment. Under appropriate conditions known in the art, the transformed plant cells are grown to form shoots, roots, and develop further into plants. The nucleic acid segments can be introduced into appropriate plant cells, for example, by means of the Ti plasmid of Agrobacterium tumefaciens. The Ti plasmid is transmitted to plant cells upon infection by Agrobacterium tumefaciens, and is stably integrated into the plant genome (Horsch et al, (1984) Science, 233:496-498; Fraley et al, (1983) Proc. Nat'l. Acad. Sci. U.S.A., 80:4803.
(196) Ti plasmids contain two regions essential for the production of transformed cells. One of these, named transfer DNA (T DNA), induces tumor formation. The other, termed virulent region, is essential for the introduction of the T DNA into plants. The transfer DNA region, which transfers to the plant genome, can be increased in size by the insertion of the foreign nucleic acid sequence without its transferring ability being affected. By removing the tumor-causing genes so that they no longer interfere, the modified Ti plasmid can then be used as a vector for the transfer of the gene constructs of the invention into an appropriate plant cell, such being a disabled Ti vector.
(197) All plant cells which can be transformed by Agrobacterium and whole plants regenerated from the transformed cells can also be transformed according to the invention so as to produce transformed whole plants which contain the transferred foreign nucleic acid sequence. There are various ways to transform plant cells with Agrobacterium, including: (1) co-cultivation of Agrobacterium with cultured isolated protoplasts, (2) co-cultivation of cells or tissues with Agrobacterium, or (3) transformation of seeds, apices or meristems with Agrobacterium. Method (1) requires an established culture system that allows culturing protoplasts and plant regeneration from cultured protoplasts. Method (2) requires (a) that the plant cells or tissues can be transformed by Agrobacterium and (b) that the transformed cells or tissues can be induced to regenerate into whole plants. Method (3) requires micropropagation.
(198) In the binary system, to have infection, two plasmids are needed: a T-DNA containing plasmid and a vir plasmid. Any one of a number of T-DNA containing plasmids can be used, the only requirement is that one be able to select independently for each of the two plasmids. After transformation of the plant cell or plant, those plant cells or plants transformed by the Ti plasmid so that the desired DNA segment is integrated can be selected by an appropriate phenotypic marker. These phenotypic markers include, but are not limited to, antibiotic resistance, herbicide resistance or visual observation. Other phenotypic markers are known in the art and may be used in this invention.
(199) The present invention embraces use of the claimed DNA constructs in transformation of any plant, including both dicots and monocots. Transformation of dicots is described in references above. Transformation of monocots is known using various techniques including electroporation (e.g., Shimamoto et al, (1992) Nature, 338:274-276; ballistics (e.g., European Patent Application 270,356); and Agrobacterium (e.g., Bytebier et al, (1987) Proc. Nat'l Acad. Sci. USA, 84:5345-5349).
(200) Transformed plant cells which are derived by any of the above transformation techniques can be cultured to regenerate a whole plant which possesses the desired transformed phenotype. Such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium typically relying on a biocide and/or herbicide marker which has been introduced together with the nucleotide sequences. Plant regeneration from cultured protoplasts is described in Evans et al, Handbook of Plant Cell Culture, pp. 124-176, MacMillan Publishing Company, New York, 1983; and Binding, Regeneration of Plants, Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985. Regeneration can also be obtained from plant callus, explants, organs, or parts thereof. Such regeneration techniques are described generally by Klee et al, Ann. Rev. Plant Phys., 38:467-486, 1987. Additional methods for producing a transgenic plant useful in the present invention are described in U.S. Pat. Nos. 5,188,642; 5,202,422; 5,384,253; 5,463,175; and 5,639,947. The methods, compositions, and expression vectors of the invention have use over a broad range of types of plants, including the creation of transgenic plant species belonging to virtually any species.
(201) Selection:
(202) Typically DNA is introduced into only a small percentage of target cells in any one experiment. In order to provide an efficient system for identification of those cells receiving DNA and integrating it into their genomes one may employ a means for selecting those cells that are stably transformed. One exemplary embodiment of such a method is to introduce into the host cell, a marker gene which confers resistance to some normally inhibitory agent, such as an antibiotic or herbicide. Examples of antibiotics which may be used include the aminoglycoside antibiotics neomycin, kanamycin, G418 and paromomycin, or the antibiotic hygromycin. Resistance to the aminoglycoside antibiotics is conferred by aminoglycoside phosphostransferase enzymes such as neomycin phosphotransferase II (NPT II) or NPT I, whereas resistance to hygromycin is conferred by hygromycin phosphotransferase.
(203) Potentially transformed cells then are exposed to the selective agent. In the population of surviving cells will be those cells where, generally, the resistance-conferring gene has been integrated and expressed at sufficient levels to permit cell survival. Cells may be tested further to confirm stable integration of the exogenous DNA. Using the techniques disclosed herein, greater than 40% of bombarded embryos may yield transformants.
(204) One example of a herbicide which is useful for selection of transformed cell lines in the practice of the invention is the broad spectrum herbicide glyphosate. Glyphosate inhibits the action of the enzyme EPSPS, which is active in the aromatic amino acid biosynthetic pathway. Inhibition of this enzyme leads to starvation for the amino acids phenylalanine, tyrosine, and tryptophan and secondary metabolites derived thereof. U.S. Pat. No. 4,535,060 describes the isolation of EPSPS mutations which confer glyphosate resistance on the Salmonella typhimurium gene for EPSPS, aroA. The EPSPS gene was cloned from Zea mays and mutations similar to those found in a glyphosate resistant aroA gene were introduced in vitro. Mutant genes encoding glyphosate resistant EPSPS enzymes are described in, for example, PCT Publication WO 97/04103. The best characterized mutant EPSPS gene conferring glyphosate resistance comprises amino acid changes at residues 102 and 106, although it is anticipated that other mutations will also be useful (PCT Publication WO 97/04103). Furthermore, a naturally occurring glyphosate resistant EPSPS may be used, e.g., the CP4 gene isolated from Agrobacterium encodes a glyphosate resistant EPSPS (U.S. Pat. No. 5,627,061).
(205) To use the bar-bialaphos or the EPSPS-glyphosate selective systems, tissue is cultured for 0-28 days on nonselective medium and subsequently transferred to medium containing from 1-3 mg/l bialaphos or 1-3 mM glyphosate as appropriate. While ranges of 1-3 mg/l bialaphos or 1-3 mM glyphosate will typically be preferred, it is believed that ranges of 0.1-50 mg/l bialaphos or 0.1-50 mM glyphosate will find utility in the practice of the invention. Bialaphos and glyphosate are provided as examples of agents suitable for selection of transformants, but the technique of this invention is not limited to them.
(206) Another herbicide which constitutes a desirable selection agent is the broad spectrum herbicide bialaphos. Bialaphos is a tripeptide antibiotic produced by Streptomyces hygroscopicus and is composed of phosphinothricin (PPT), an analogue of L-glutamic acid, and two L-alanine residues. Upon removal of the L-alanine residues by intracellular peptidases, the PPT is released and is a potent inhibitor of glutamine synthase (GS), a pivotal enzyme involved in ammonia assimilation and nitrogen metabolism. Synthetic PPT, the active ingredient in the herbicide Liberty also is effective as a selection agent. Inhibition of GS in plants by PPT causes the rapid accumulation of ammonia and death of the plant cells.
(207) The organism producing bialaphos and other species of the genus Streptomyces also synthesizes an enzyme phosphinothricin acetyl transferase (PAT) which is encoded by the bar gene in Streptomyces hygroscopicus and the pat gene in Streptomyces viridochromogenes. The use of the herbicide resistance gene encoding phosphinothricin acetyl transferase (PAT) is referred to in DE 3642 829 A, wherein the gene is isolated from Streptomyces viridochromogenes. In the bacterial source organism, this enzyme acetylates the free amino group of PPT preventing auto-toxicity. The bar gene has been cloned and expressed in transgenic tobacco, tomato, potato, Brassica and maize (U.S. Pat. No. 5,550,318). In previous reports, some transgenic plants which expressed the resistance gene were completely resistant to commercial formulations of PPT and bialaphos in greenhouses.
(208) It further is contemplated that the herbicide dalapon, 2,2-dichloropropionic acid, may be useful for identification of transformed cells. The enzyme 2,2-dichloropropionic acid dehalogenase (deh) inactivates the herbicidal activity of 2,2-dichloropropionic acid and therefore confers herbicidal resistance on cells or plants expressing a gene encoding the dehalogenase enzyme (U.S. Pat. No. 5,780,708).
(209) Alternatively, a gene encoding anthranilate synthase, which confers resistance to certain amino acid analogs, e.g., 5-methyltryptophan or 6-methyl anthranilate, may be useful as a selectable marker gene. The use of an anthranilate synthase gene as a selectable marker was described in U.S. Pat. No. 5,508,468 and U.S. Pat. No. 6,118,047.
(210) An example of a screenable marker trait is the red pigment produced under the control of the R-locus in maize. This pigment may be detected by culturing cells on a solid support containing nutrient media capable of supporting growth at this stage and selecting cells from colonies (visible aggregates of cells) that are pigmented. These cells may be cultured further, either in suspension or on solid media. In a similar fashion, the introduction of the C1 and B genes will result in pigmented cells and/or tissues.
(211) The enzyme luciferase may be used as a screenable marker in the context of the present invention. In the presence of the substrate luciferin, cells expressing luciferase emit light which can be detected on photographic or x-ray film, in a luminometer (or liquid scintillation counter), by devices that enhance night vision, or by a highly light sensitive video camera, such as a photon counting camera. All of these assays are nondestructive and transformed cells may be cultured further following identification. The photon counting camera is especially valuable as it allows one to identify specific cells or groups of cells that are expressing luciferase and manipulate cells expressing in real time. Another screenable marker which may be used in a similar fashion is the gene coding for green fluorescent protein (GFP) or a gene coding for other fluorescing proteins such as DSRED (Clontech, Palo Alto, Calif.).
(212) It further is contemplated that combinations of screenable and selectable markers will be useful for identification of transformed cells. In some cell or tissue types a selection agent, such as bialaphos or glyphosate, may either not provide enough killing activity to clearly recognize transformed cells or may cause substantial nonselective inhibition of transformants and nontransformants alike, thus causing the selection technique to not be effective. It is proposed that selection with a growth inhibiting compound, such as bialaphos or glyphosate at concentrations below those that cause 100% inhibition followed by screening of growing tissue for expression of a screenable marker gene such as luciferase or GFP would allow one to recover transformants from cell or tissue types that are not amenable to selection alone. It is proposed that combinations of selection and screening may enable one to identify transformants in a wider variety of cell and tissue types. This may be efficiently achieved using a gene fusion between a selectable marker gene and a screenable marker gene, for example, between an NPTII gene and a GFP gene (WO 99/60129).
(213) Regeneration and Seed Production:
(214) Cells that survive the exposure to the selective agent, or cells that have been scored positive in a screening assay, may be cultured in media that supports regeneration of plants. In an exemplary embodiment, MS and N6 media may be modified by including further substances such as growth regulators. Preferred growth regulators for plant regeneration include cytokines such as 6-benzylamino pelerine, peahen or the like, and abscise acid. Media improvement in these and like ways has been found to facilitate the growth of cells at specific developmental stages. Tissue may be maintained on a basic media with axing type growth regulators until sufficient tissue is available to begin plant regeneration efforts, or following repeated rounds of manual selection, until the morphology of the tissue is suitable for regeneration, then transferred to media conducive to maturation of embroils. Cultures are transferred every 1-4 weeks, preferably every 2-3 weeks on this medium. Shoot development will signal the time to transfer to medium lacking growth regulators.
(215) The transformed cells, identified by selection or screening and cultured in an appropriate medium that supports regeneration, will then be allowed to mature into plants. Developing plantlets were transferred to soilless plant growth mix, and hardened off, e.g., in an environmentally controlled chamber at about 85% relative humidity, 600 pap CO.sub.2, and 25-250 microeinsteins m.sup.2 s.sup.1 of light, prior to transfer to a greenhouse or growth chamber for maturation. Plants are preferably matured either in a growth chamber or greenhouse. Plants are regenerated from about 6 wk to 10 months after a transformant is identified, depending on the initial tissue. During regeneration, cells are grown on solid media in tissue culture vessels. Illustrative embodiments of such vessels are petri dishes and Plant Cons. Regenerating plants are preferably grown at about 19 to 28 C. After the regenerating plants have reached the stage of shoot and root development, they may be transferred to a greenhouse for further growth and testing. Plants may be pollinated using conventional plant breeding methods known to those of skill in the art and seed produced.
(216) Progeny may be recovered from transformed plants and tested for expression of the exogenous expressible gene. Note however, that seeds on transformed plants may occasionally require embryo rescue due to cessation of seed development and premature senescence of plants. To rescue developing embryos, they are excised from surface-disinfected seeds 10-20 days post-pollination and cultured. An embodiment of media used for culture at this stage comprises MS salts, 2% sucrose, and 5.5 g/l agarose. In embryo rescue, large embryos (defined as greater than 3 mm in length) are germinated directly on an appropriate media. Embryos smaller than that may be cultured for 1 wk on media containing the above ingredients along with 10.sup.5M abscisic acid and then transferred to growth regulator-free medium for germination.
(217) Characterization:
(218) To confirm the presence of the exogenous DNA or transgene(s) in the regenerating plants, a variety of assays, known in the art may be performed. Such assays include, for example, molecular biological assays, such as Southern and Northern blotting and PCR; biochemical assays, such as detecting the presence of a protein product, e.g., by immunological means (ELISAs and Western blots) or by enzymatic function; plant part assays, such as leaf or root assays; and also, by analyzing the phenotype of the whole regenerated plant.
(219) DNA Integration, RNA Expression and Inheritance:
(220) Genomic DNA may be isolated from callus cell lines or any plant parts to determine the presence of the exogenous gene through the use of techniques well known to those skilled in the art. Note, that intact sequences will not always be present, presumably due to rearrangement or deletion of sequences in the cell. The presence of DNA elements introduced through the methods of this invention may be determined by polymerase chain reaction (PCR). Using this technique discreet fragments of DNA are amplified and detected by gel electrophoresis. This type of analysis permits one to determine whether a gene is present in a stable transformant, but does not necessarily prove integration of the introduced gene into the host cell genome. Typically, DNA has been integrated into the genome of all transformants that demonstrate the presence of the gene through PCR analysis. In addition, it is not possible using PCR techniques to determine whether transformants have exogenous genes introduced into different sites in the genome, i.e., whether transformants are of independent origin. Using PCR techniques it is possible to clone fragments of the host genomic DNA adjacent to an introduced gene.
(221) Positive proof of DNA integration into the host genome and the independent identities of transformants may be determined using the technique of Southern hybridization. Using this technique specific DNA sequences that were introduced into the host genome and flanking host DNA sequences can be identified. Hence the Southern hybridization pattern of a given transformant serves as an identifying characteristic of that transformant. In addition, it is possible through Southern hybridization to demonstrate the presence of introduced genes in high molecular weight DNA, i.e., confirm that the introduced gene has been integrated into the host cell genome. The technique of Southern hybridization provides information that is obtained using PCR, e.g., the presence of a gene, but also demonstrates integration into the genome and characterizes each individual transformant.
(222) It is contemplated that using the techniques of dot or slot blot hybridization, which are modifications of Southern hybridization techniques, one could obtain the same information that is derived from PCR, e.g., the presence of a gene.
(223) Both PCR and Southern hybridization techniques can be used to demonstrate transmission of a transgene to progeny. In most instances the characteristic Southern hybridization pattern for a given transformant will segregate in progeny as one or more Mendelian genes (Spencer et al., 1992) indicating stable inheritance of the transgene.
(224) Whereas DNA analysis techniques may be conducted using DNA isolated from any part of a plant, RNA will only be expressed in particular cells or tissue types and hence it will be necessary to prepare RNA for analysis from these tissues. PCR techniques, referred to as RT-PCR, also may be used for detection and quantification of RNA produced from introduced genes. In this application of PCR it is first necessary to reverse transcribe RNA into DNA, using enzymes such as reverse transcriptase, and then through the use of conventional PCR techniques amplify the DNA. In most instances PC techniques, while useful, will not demonstrate integrity of the RNA product. Further information about the nature of the RNA product may be obtained by Northern blotting. This technique will demonstrate the presence of an RNA species and give information about the integrity of that RNA. The presence or absence of an RNA species also can be determined using dot or slot blot Northern hybridizations. These techniques are modifications of Northern blotting and will only demonstrate the presence or absence of an RNA species.
(225) It is further contemplated that TAQMAN technology (Applied Biosystems, Foster City, Calif.) may be used to quantitate both DNA and RNA in a transgenic cell.
(226) Gene Expression:
(227) While Southern blotting and PCR may be used to detect the gene(s) in question, they do not provide information as to whether the gene is being expressed. Expression may be evaluated by specifically identifying the protein products of the introduced genes or evaluating the phenotypic changes brought about by their expression.
(228) Assays for the production and identification of specific proteins may make use of physical-chemical, structural, functional, or other properties of the proteins. Unique physical-chemical or structural properties allow the proteins to be separated and identified by electrophoretic procedures, such as native or denaturing gel electrophoresis or isoelectric focusing, or by chromatographic techniques such as ion exchange or gel exclusion chromatography. The unique structures of individual proteins offer opportunities for use of specific antibodies to detect their presence in formats such as an ELISA assay. Combinations of approaches may be employed with even greater specificity such as Western blotting in which antibodies are used to locate individual gene products that have been separated by electrophoretic techniques. Additional techniques may be employed to absolutely confirm the identity of the product of interest such as evaluation by amino acid sequencing following purification. Although these are among the most commonly employed, other procedures may be additionally used.
(229) Assay procedures also may be used to identify the expression of proteins by their functionality, especially the ability of enzymes to catalyze specific chemical reactions involving specific substrates and products. These reactions may be followed by providing and quantifying the loss of substrates or the generation of products of the reactions by physical or chemical procedures. Examples are as varied as the enzyme to be analyzed and may include assays for PAT enzymatic activity by following production of radiolabeled acetylated phosphinothricin from phosphinothricin and .sup.14C-acetyl CoA or for anthranilate synthase activity by following an increase in fluorescence as anthranilate is produced, to name two.
(230) Very frequently the expression of a gene product is determined by evaluating the phenotypic results of its expression. These assays also may take many forms, including but not limited to, analyzing changes in the chemical composition, morphology, or physiological properties of the plant. Chemical composition may be altered by expression of genes encoding enzymes or storage proteins which change amino acid composition and may be detected by amino acid analysis, or by enzymes which change starch quantity which may be analyzed by near infrared reflectance spectrometry. Morphological changes may include greater stature or thicker stalks. Most often changes in response of plants or plant parts to imposed treatments are evaluated under carefully controlled conditions termed bioassays.
(231) Event Specific Transgene Assay:
(232) Southern blotting, PCR and RT-PCR techniques can be used to identify the presence or absence of a given transgene but, depending upon experimental design, may not specifically and uniquely identify identical or related transgene constructs located at different insertion points within the recipient genome. To more precisely characterize the presence of transgenic material in a transformed plant, one skilled in the art could identify the point of insertion of the transgene and, using the sequence of the recipient genome flanking the transgene, develop an assay that specifically and uniquely identifies a particular insertion event. Many methods can be used to determine the point of insertion such as, but not limited to, Genome Walker technology (CLONTECH, Palo Alto, Calif.), Vectorette technology (Sigma, St. Louis, Mo.), restriction site oligonucleotide PCR, uneven PCR (Chen and Wu, 1997) and generation of genomic DNA clones containing the transgene of interest in a vector such as, but not limited to, lambda phage.
(233) Once the sequence of the genomic DNA directly adjacent to the transgenic insert on either or both sides has been determined, one skilled in the art can develop an assay to specifically and uniquely identify the insertion event. For example, two oligonucleotide primers can be designed, one wholly contained within the transgene and one wholly contained within the flanking sequence, which can be used together with the PCR technique to generate a PCR product unique to the inserted transgene. In one embodiment, the two oligonucleotide primers for use in PCR could be designed such that one primer is complementary to sequences in both the transgene and adjacent flanking sequence such that the primer spans the junction of the insertion site while the second primer could be homologous to sequences contained wholly within the transgene. In another embodiment, the two oligonucleotide primers for use in PCR could be designed such that one primer is complementary to sequences in both the transgene and adjacent flanking sequence such that the primer spans the junction of the insertion site while the second primer could be homologous to sequences contained wholly within the genomic sequence adjacent to the insertion site. Confirmation of the PCR reaction may be monitored by, but not limited to, size analysis on gel electrophoresis, sequence analysis, hybridization of the PCR product to a specific radiolabeled DNA or RNA probe or to a molecular beacon, or use of the primers in conjugation with a TAQMAN probe and technology (Applied Biosystems, Foster City, Calif.).
(234) Site Specific Integration or Excision of Transgenes:
(235) It is specifically contemplated by the inventors that one could employ techniques for the site-specific integration or excision of transformation constructs prepared in accordance with the instant invention. An advantage of site-specific integration or excision is that it can be used to overcome problems associated with conventional transformation techniques, in which transformation constructs typically randomly integrate into a host genome and multiple copies of a construct may integrate. This random insertion of introduced DNA into the genome of host cells can be detrimental to the cell if the foreign DNA inserts into an essential gene. In addition, the expression of a transgene may be influenced by position effects caused by the surrounding genomic DNA. Further, because of difficulties associated with plants possessing multiple transgene copies, including gene silencing, recombination and unpredictable inheritance, it is typically desirable to control the copy number of the inserted DNA, often only desiring the insertion of a single copy of the DNA sequence. Site-specific integration can be achieved in plants by means of homologous recombination (see, for example, U.S. Pat. No. 5,527,695, specifically incorporated herein by reference in its entirety). Homologous recombination is a reaction between any pair of DNA sequences having a similar sequence of nucleotides, where the two sequences interact (recombine) to form a new recombinant DNA species. The frequency of homologous recombination increases as the length of the shared nucleotide DNA sequences increases, and is higher with linearized plasmid molecules than with circularized plasmid molecules. Homologous recombination can occur between two DNA sequences that are less than identical, but the recombination frequency declines as the divergence between the two sequences increases.
(236) Introduced DNA sequences can be targeted via homologous recombination by linking a DNA molecule of interest to sequences sharing homology with endogenous sequences of the host cell. Once the DNA enters the cell, the two homologous sequences can interact to insert the introduced DNA at the site where the homologous genomic DNA sequences were located. Therefore, the choice of homologous sequences contained on the introduced DNA will determine the site where the introduced DNA is integrated via homologous recombination. For example, if the DNA sequence of interest is linked to DNA sequences sharing homology to a single copy gene of a host plant cell, the DNA sequence of interest will be inserted via homologous recombination at only that single specific site. However, if the DNA sequence of interest is linked to DNA sequences sharing homology to a multicopy gene of the host eukaryotic cell, then the DNA sequence of interest can be inserted via homologous recombination at each of the specific sites where a copy of the gene is located.
(237) DNA can be inserted into the host genome by a homologous recombination reaction involving either a single reciprocal recombination (resulting in the insertion of the entire length of the introduced DNA) or through a double reciprocal recombination (resulting in the insertion of only the DNA located between the two recombination events). For example, if one wishes to insert a foreign gene into the genomic site where a selected gene is located, the introduced DNA should contain sequences homologous to the selected gene. A single homologous recombination event would then result in the entire introduced DNA sequence being inserted into the selected gene. Alternatively, a double recombination event can be achieved by flanking each end of the DNA sequence of interest (the sequence intended to be inserted into the genome) with DNA sequences homologous to the selected gene. A homologous recombination event involving each of the homologous flanking regions will result in the insertion of the foreign DNA. Thus only those DNA sequences located between the two regions sharing genomic homology become integrated into the genome.
(238) Although introduced sequences can be targeted for insertion into a specific genomic site via homologous recombination, in higher eukaryotes homologous recombination is a relatively rare event compared to random insertion events. Thus random integration of transgenes is more common in plants. To maintain control over the copy number and the location of the inserted DNA, randomly inserted DNA sequences can be removed. One manner of removing these random insertions is to utilize a site-specific recombinase system (U.S. Pat. No. 5,527,695). A number of different site specific recombinase systems could be employed in accordance with the instant invention, including, but not limited to, the Cre/lox system of bacteriophage P1 (U.S. Pat. No. 5,658,772, specifically incorporated herein by reference in its entirety), the FLP/FRT system of yeast, the Gin recombinase of phage Mu, the Pin recombinase of E. coli, and the R/RS system of the pSR1 plasmid. The bacteriophage P1 Cre/lox and the yeast FLP/FRT systems constitute two particularly useful systems for site specific integration or excision of transgenes. In these systems, a recombinase (Cre or FLP) will interact specifically with its respective site-specific recombination sequence (lox or FRT, respectively) to invert or excise the intervening sequences. The sequence for each of these two systems is relatively short (34 bp for lox and 47 bp for FRT) and therefore, convenient for use with transformation vectors.
(239) The FLP/FRT recombinase system has been demonstrated to function efficiently in plant cells. Experiments on the performance of the FLP/FRT system in both maize and rice protoplasts indicate that FRT site structure, and amount of the FLP protein present, affects excision activity. In general, short incomplete FRT sites leads to higher accumulation of excision products than the complete full-length FRT sites. The systems can catalyze both intra- and intermolecular reactions in maize protoplasts, indicating its utility for DNA excision as well as integration reactions. The recombination reaction is reversible and this reversibility can compromise the efficiency of the reaction in each direction. Altering the structure of the site-specific recombination sequences is one approach to remedying this situation. The site-specific recombination sequence can be mutated in a manner that the product of the recombination reaction is no longer recognized as a substrate for the reverse reaction, thereby stabilizing the integration or excision event.
(240) In the Cre-lox system, discovered in bacteriophage P1, recombination between lox sites occurs in the presence of the Cre recombinase (see, e.g., U.S. Pat. No. 5,658,772, specifically incorporated herein by reference in its entirety). This system has been utilized to excise a gene located between two lox sites which had been introduced into a yeast genome (Sauer, 1987). Cre was expressed from an inducible yeast GAL1 promoter and this Cre gene was located on an autonomously replicating yeast vector.
(241) Since the lox site is an asymmetrical nucleotide sequence, lox sites on the same DNA molecule can have the same or opposite orientation with respect to each other. Recombination between lox sites in the same orientation results in a deletion of the DNA segment located between the two lox sites and a connection between the resulting ends of the original DNA molecule. The deleted DNA segment forms a circular molecule of DNA. The original DNA molecule and the resulting circular molecule each contain a single lox site. Recombination between lox sites in opposite orientations on the same DNA molecule result in an inversion of the nucleotide sequence of the DNA segment located between the two lox sites. In addition, reciprocal exchange of DNA segments proximate to lox sites located on two different DNA molecules can occur. All of these recombination events are catalyzed by the product of the Cre coding region.
(242) Deletion of Sequences Located within the Transgenic Insert:
(243) During the transformation process it is often necessary to include ancillary sequences, such as selectable marker or reporter genes, for tracking the presence or absence of a desired trait gene transformed into the plant on the DNA construct. Such ancillary sequences often do not contribute to the desired trait or characteristic conferred by the phenotypic trait gene. Homologous recombination is a method by which introduced sequences may be selectively deleted in transgenic plants.
(244) It is known that homologous recombination results in genetic rearrangements of transgenes in plants. Repeated DNA sequences have been shown to lead to deletion of a flanked sequence in various dicot species, e.g. Arabidopsis thaliana and Nicotiana tabacum. One of the most widely held models for homologous recombination is the double-strand break repair (DSBR) model.
(245) Deletion of sequences by homologous recombination relies upon directly repeated DNA sequences positioned about the region to be excised in which the repeated DNA sequences direct excision utilizing native cellular recombination mechanisms. The first fertile transgenic plants are crossed to produce either hybrid or inbred progeny plants, and from those progeny plants, one or more second fertile transgenic plants are selected which contain a second DNA sequence that has been altered by recombination, preferably resulting in the deletion of the ancillary sequence. The first fertile plant can be either hemizygous or homozygous for the DNA sequence containing the directly repeated DNA which will drive the recombination event.
(246) The directly repeated sequences are located 5 and 3 to the target sequence in the transgene. As a result of the recombination event, the transgene target sequence may be deleted, amplified or otherwise modified within the plant genome. In the preferred embodiment, a deletion of the target sequence flanked by the directly repeated sequence will result.
(247) Alternatively, directly repeated DNA sequence mediated alterations of transgene insertions may be produced in somatic cells. Preferably, recombination occurs in a cultured cell, e.g., callus, and may be selected based on deletion of a negative selectable marker gene, e.g., the periA gene isolated from Burkholderia caryolphilli which encodes a phosphonate ester hydrolase enzyme that catalyzes the hydrolysis of glyceryl glyphosate to the toxic compound glyphosate (U.S. Pat. No. 5,254,801).
(248) VIII. Transgenic Organisms
(249) In certain embodiments, the invention contemplates a transgenic organism comprising within its genome:
(250) a first nucleotide sequence encoding a fusion protein comprising a geranyl diphosphate synthase small subunit fused in frame to a geranyl diphosphate synthase large subunit, operatively linked to a first set of expression control sequences that drive expression of the geranyl diphosphate fusion protein in the plant cell;
(251) a second nucleotide sequence encoding a limonene synthase, operatively linked to a second set of expression control sequences that drive expression of the limonene synthase in the plant cell;
(252) wherein the fusion protein and limonene synthase are expressed primarily in the plant cell plastids.
(253) In certain embodiments, the invention contemplates a transgenic organism comprising within its genome:
(254) a first nucleotide sequence encoding a fusion protein comprising a geranyl diphosphate synthase small subunit or a geranyl diphosphate synthase large subunit fused in frame to a limonene synthase, operatively linked to a first set of expression control sequences that drive expression of the geranyl diphosphate fusion protein in the plant cell;
(255) wherein the fusion protein is expressed primarily in the plant cell plastids.
(256) The transgenic organisms therefore contain one or more DNA constructs as defined herein as a part of the organism, the DNA constructs having been introduced by transformation of the organism.
(257) In certain embodiments, the geranyl diphosphate synthase small subunit comprises an amino acid sequence selected from Table D1. In certain embodiments, the geranyl diphosphate synthase large subunit comprises an amino acid sequence selected from Table D2. In certain embodiments, the limonene synthase comprises an amino acid sequence selected from Table D3.
(258) In one aspect such transgenic organisms are characterized by having a terpene content which is at least about 10% higher, at least about 20% higher, at least about 30% higher, at least about 40% higher, at least about 60% higher, at least about 80% higher, or at least about 100% higher than corresponding wild type organism.
(259) In another aspect such transgenic organisms are characterized by having a monoterpene content of at least 1 mg/g dry weight, or about 1.2 mg/g dry weight, or about 1.4 mg/g dry weight, or about 1.6 mg/g dry weight, or about 1.8 mg/g dry weight, or about 2.0 mg/g dry weight, or greater then about or about 2.0 mg/g dry weight of seed.
(260) In some embodiments of these transgenic organisms the monoterpene produced is selected from the group consisting of limonene, gamma-terpinene and alpha phellandrene, p-cymene, ascaridole and pulegone. In some embodiments the monoterpene is primarily limonene. In some embodiments the monoterpene is a mixture of any of the monoterpenes disclosed herein.
(261) In any of these transgenic characteristics, it will be understood that the transgenic organism will be grown using standard growth conditions as disclosed in the Examples, and compared to the equivalent wild type species.
(262) In one aspect of these transgenic organisms, the transgenic organism is a plant. In some embodiments the plant naturally produces a terpene. In some embodiments the transgenic plant is from the genus Camelina. In different aspect, the transgenic plant is selected from Camelina alyssum, Canelina microcarpa, Camelina runelica and Camelina sativa.
(263) In certain embodiments of the transgenic plants, the geranyl diphosphate synthase fusion protein and limonene synthase, are expressed primarily in the seed tissue of the transgenic plant. In this context, the term primarily means that the relative expression of these proteins is at least about 150%, or at least about 200%, or at least about 300%, or at least about 400%, or at least about 500% higher in the seed tissue (on a dry weight by dry weight basis) compared to any other plant tissue, in the mature full developed plant, when grown under standard growth conditions.
(264) In certain embodiments, the transgenic plant further expresses an auxillary enzyme as listed in Table D4.
(265) The following examples describe various aspects of the present invention, and are merely intended to be illustrative rather than limiting of the compounds, compositions, and methods useful therein.
Example 1
Experimental Procedures
(266) Plant Materials:
(267) Wild-type Camelina sativa was grown in the green house at Donald Danforth Plant Science Center. Peppermint Mentha piperita leaves were harvested from a garden in St. Louis, Mo. in September, 2009.
(268) Cloning of Peppermint Geranyl Diphosphate Synthase and Limonene Synthase cDNAs
(269) Total RNA was extracted from peppermint leaves using RNeasy plant mini kit (Qiagen). First-strand cDNAs was synthesized using SuperScript III (Invitrogen). References and nucleotide sequences (Burke et al. (1999) Arch. Biochem. Biophys., 422, 52-60; Alonso et al. (1992) J Biol Chem., 267, 7582-7; Colby et al. (1993) J Biol Chem., 268, 23016-24. NCBI accession numbers: AF182827, AJ249453, EU108697, AW255818) were used to design cloning primers. Geranyl diphosphate synthase small subunit without predicted chloroplast transit peptide has been cloned from the peppermint cDNAs with primers: GSSfC and GSSr4 (Table E1) (
(270) Vector Construction:
(271) Two E. coli plasmid vectors, pNapin (
(272) The GDS sequence with BamHI/NotI sites was amplified by PCR using pET28-GDS (
(273) A pRS binary vector was obtained from Dr. Jan Jaworski, which contains a Discosoma red fluorescent protein (DsRed) as a selection marker, and AscI/MluI restriction enzyme sites between the left border and right border T-DNA repeat sequences. To eliminate a glycinin promoter and a glycinin terminator, pRS was digested by BamHI/HindIII and ligated with oligo nucleotides: fwdBamHIEcoRIHindIII and revHindIIIEcoRIBamHI (Table E1), yielding pRSe2 (
(274) A GDSLS Camelina transformation vector (GDSLS) for cytosolic expression was prepared with pNaMluIOleosin (
(275) Plant Transformation:
(276) The TPGDSTPLS vector (
(277) Camelina transformation was performed using a floral dip method (Lu and Kang (2008) Plant Cell Rep., 27, 273-8.). Camelina plants were inoculated with the Agrobacterium suspension prepared as described above. A flowering Camelina plant was placed into a vacuum desiccator and the inflorescences were immersed into the suspension in a 500 ml beaker. The suspension with the inflorescences was degassed under vacuum for 5 min. The inoculated plants were covered with plastic trays for 24 hours before returned to normal growth in greenhouse. Transgenic fluorescent mature seeds were illuminated by a green LED flashlight, and visually detected using a red-lens screen.
(278) GC-MS Analysis of the Transgenic Seeds
(279) Ten transgenic mature seeds were ground with a glass rod and then soaked overnight in diethyl ether at room temperature, and then shook every 15 minutes for two hours. Fifty nanomoles of iso-butylbenzene were added as internal standard for limonene analysis. The extract was concentrated under nitrogen and analyzed by GC-MS. GC-MS analyses were performed on an Agilent 5975C inert XL MSD equipped with a 7683B injector and a 7890A GC system, under the following conditions: EI, 70 eV; column, Phenomenex ZB-5MSi (32.5 m250 m0.25 m); oven temperature program, 50 C. for 3 min, and then raised to 65 C. at a rate of 5 C. min.sup.1, and then raised again to 75 C. at 1 C. min.sup.1, and then raised to 300 C. at 40 C. min.sup.1, held for 3 min; injector temperature 220 C.; source temperature 230 C.; interface temperature 250 C.; carrier gas, He; flow rate 1.0 ml/min; splitless injection; injected volume, 1.0 L. Limonene accumulation was calculated using authentic limonene standard (Sigma). Other monoterpenes were identified by comparison of their EI-MS spectra with those of the NIST library (V 2.0).
(280) The expressed and purified E. coli recombinant GDS, GSL, GSS and LS were observed on SDS-PAGE (
(281) The limonene content of the T3 homozygous seeds ranged from 1.8 to 3 mg/g seeds (
(282) T-DNA insertion was confirmed by PCR analyses of total DNA of T2 leaves (
(283) TABLE-US-00014 TABLEE1 Primersequences SEQ ID Name Sequence NO: GSSfC GGATCCTTTCATATGCAGCCGTACTGGGCC 39 GCCAT GSSr4 TTGCGGCCGCTGAAGGATCCGAATAGCTCTA 40 AGCC GSLfC GGATCCTTTCATATGTTCGATTTCGACGGA 41 TACATGCTC GSLr2 TTGCGGCCGCGAGAGGAGGAAGATGGAATCA 42 ATTGTC GSSr10aa CCGGCCCTCGATGCCGAGATTGTTGGAGCT 43 AGCCGCGTAAAGGCTCGG 10aaGSLfC AGCTCCAACAATCTCGGCATCGAGGGCCGG 44 TTCGATTTCGACGGATACATGCTC LSuf GGATCCAAACATCATAGAAAGAGAGTGGAA 45 GAAAAGGAG LSr TTGCGGCCGCTCATGCAAAGGGCTCGAATAA 46 GGTTG fwdLSfC3 GGATCCTTTCATATGCAACTCACTACCGAA 47 AGACGATCC fwdSacIMluISacI TTCCAAACACACGCGTAAACAACTTTAGCT 48 revSacIMluISacI AAAGTTGTTTACGCGTGTGTTTGGAAAGCT 49 fwdMluIOP TTTACGCGTTAGTGTTTATCTTTCTTGCTTTTC 50 TGAAC revNotIBamHINdeIOP GCGGCCGCAGGATCCTTTGCTAGCCATATG 51 GGTTGAAGGTGAAGTTTAGGGTTTTGC fwdNdeIBamHINotIOT CATATGGCTAGCAAAGGATCCTGCGGCCGC 52 TGAGTAATTCTGATATTAGAGGGAGC revMluIOT TTTACGCGTTTGCTGAAAAATGCCTATTGG 53 CTGATG fwdAscINP TTTGGCGCGCCAAGCTTTCTTCATCGGTGATT 54 GATTCC revNotIBamHINdeINP GCGGCCGCAGGATCCTTTGCTAGCCATATG 55 TCGTGTATGTTTTTAATCTTGTTTGTATTG fwdNdeIBamHINotIGT CATATGGCTAGCAAAGGATCCTGCGGCCGC 56 AGCCCTTTTTGTATGTGCTACC revAscIGT TTTGGCGCGCCAAGTCATGAAGAACCTGA 57 TAAGACGTCTTC RuSfwd GGATCCTTTCATATGGCTTCTATGATATCC 58 TCTTCCGCTGTG RuSrev TTTCTCGAGTTAGTAGGATTCTGGTGTGTG 59 TGCAATGAAACT revBamHIRuTP AGGATCCATGCACTTTACTCTTCCACCATT 60 GCTTG fwdBamHIGDS ATGGATCCTCAGCCGTACTGGGCCGCCAT 61 fwdBamHILS ATGGATCCTCAACTCACTACCGAAAGACGA 62 TCC fwdBamHIEcoRIHindIII GATCAGAATTCGAGCTCAGTCGACA 63 revHindIIIEcoRIBamHI AGCTTGTCGACTGAGCTCGAATTCT 64 rev9aaGSLr2 ACCTCCAGAACCTCCTGAACCTCCAGAATT 65 GTCCCTATAAGCAATATAATTGGC fwd9aaLSfC3 TCTGGAGGTTCAGGAGGTTCTGGAGGTATG 66 CAACTCACTACCGAAAGACGATCC rev9aaLSr ACCTCCAGAACCTCCTGAACCTCCAGATGC 67 AAAGGGCTCGAATAAGGTTG fwd9aaGSSfC TCTGGAGGTTCAGGAGGTTCTGGAGGTATG 68 CAGCCGTACTGGGCCGCCAT FDSf GAATTCTTTCATATGGCGGATCTGAAATCA 69 ACCTTCC FDSr TTGCGGCCGCCTACTTCTGCCTCTTGTAGA 70 TCTTAGCCA fwdBamHIEAS ATGGATCCAGCATCAGCAGCAGTAGCCAAC 71 NtEASrc ATAAGAATGCGGCCGCCAGCTCAAATTTTG 72 ATGGAGTCCAC
Example 2
Biosynthesis and Accumulation of Cyclic Monoterpene Hydrocarbon (4S)-Limonene and the Bicyclic Sesquiterpene Hydrocarbon 5-Epi-Aristolochene in Camelina Seed
(284) This example describes the biosynthesis and accumulation of the cyclic monoterpene hydrocarbon (4S)-limonene and the bicyclic sesquiterpene hydrocarbon 5-epi-aristolochene in camelina seed by expressing appropriate combinations of terpene biosynthetic enzymes.
(285) The phrase biosynthetically appropriate combination of enzymes refers to a combination of terpene biosynthetic enzymes that facilitates the biosynthesis of a monoterpene or sesquiterpene of interest. Such combinations include a combination of: 1) a geranyl diphosphate synthase and a monoterpene synthase that catalyzes the formation of a monoterpene of interest, or 2) a combination of a farnesyl diphosphate synthase and a sesquiterpene synthase that catalyzes the formation of a sesquiterprene of interest. The phrase a biosynthetically appropriate combination of nucleotide sequences refers to nucleotide sequences that encode such biosynthetically appropriate combinations of enzymes.
(286) Numerous monoterpene and sesquiterpene synthases that can be employed in the methods of the present invention to produce monoterpenes and sesquiterpenes of interest are known in the art, and are reviewed in Degenhardt et al. Phytochemistry 70:1621-1637 (2009).
(287) Geranyl diphosphate synthase (peppermint) (Burke C. C., Wildung M. R. and Croteau R. (1999) Proc Natl Acad Sci USA., 96, 13062-7) and (4S)-limonene synthase (peppermint) (Colby, S. M. Alonso, W. R., Katahira, E. J., McGarvey, D. J. & Croteau, R. J. Biol. Chem. 268, 23016-23024 (1993)) as well as farnesyl diphosphate synthase (arabidopsis) (Cunillera, N. et al. J. Biol. Chem. 271, 7774-7780 (1996)) and epi-aristolochene synthase (tobacco) (Wu, S. et al. Plant Physiol. 138, 1322-1333 (2005)) encoding cDNAs were constructed for either plastidic (expression vectors TPGDS TPLS and TPFDS TPEAS) or cytosolic (expression vectors GDS LS and FDS EAS) accumulation of enzymes behind seed-specific promoters (
(288) While this example demonstrates the use of chloroplast transit peptides to target enzymes for the synthesis and accumulation of a monoterpene and a sesquiterpene of interest to plastids, expression of these enzymes in plastids via direct transformation of plastids with necessary coding sequences is also encompassed by the present invention.
(289) Furthermore, while this example employs chloroplast transit peptide sequences, seeds contain a variety of other plastids as well, including, for example, proplastids, etioplasts, chromoplasts, leucoplasts, amyloplasts, and photoheterotrophic plastids. Consequently, plastid transit peptides that target peptides, polypeptides, or proteins to any of these types of plastids in seeds can also be employed in the methods of the present invention.
(290) The geranyl diphosphate synthase from peppermint is a heterodimer, which was expressed as a fusion protein in camelina seed. Each reading frame was placed under the control of either the oleosin (Rowley et al. Biochim. Biophys. Acta 1345, 1-4 (1997)), napin (Josefsson et al. J. Biol. Chem. 262, 12196-12201 (1987)), or glycinin (Nielsen et al. Plant Cell 1, 313-328 (1989)) promoter; any given promoter was used only once in an expression vector to avoid potential gene silencing. The effect of overexpression of the DXS (Estvez et al. Plant Physiol. 124, 95-104 (2000)) (expression vector TPGDS TPLS DXS), a gene encoding the enzyme 1-deoxy-D-xylulose 5-phosphate synthase that is involved in the formation of IPP and DMAPP via the non-mevalonate pathway in plastids, on terpene accumulation was also tested. The vectors contained the gene encoding the red-emitting fluorescent protein (DsRed) (Lu et al. Plant Cell Rep. 27, 273-278 (2008)), which facilitated transgenic seed identification under green light.
(291) Six to seven weeks post floral dip, mature camelina seeds were harvested and fluorescent red, putative transgenic seeds, were extracted and analyzed by GC-MS for the presence of either mono- or sesquiterpenes. GC-MS analysis of TPGDS TPLS plants ((4S)-limonene biosynthetic enzymes directed to the plastid of camelina seed)) indicated that camelina that had been transformed with a geranyl diphosphate synthase cDNA from peppermint and a (4S)-limonene synthase cDNA from peppermint accumulates (4S)-limonene and minor amounts of four other similar monoterpene hydrocarbons in seed, whereas the wild type camelina seed is devoid of monoterpenes (
(292) Multiple transgenic events were achieved and analyzed with each vector construct tested. Typically, fifteen plants were transformed with each expression vector construct. A total of ca. 70-140 DsRed-positive seeds were obtained, representing 0.2-0.8% of total seeds produced in fifteen plants. Initial GC-MS analyses were carried out on extracts of individual Ti seeds. In subsequent generations, ten transgenic (red) seeds from each plant were combined for terpene extraction with subsequent GC-MS analysis. Only seeds from the T3 generation that were homozygous lines (produced >95% red seeds) were used for further analysis. The most productive monoterpene constructs yielded 1.5-3 mg (4S)-limonene per gram seed (TPGDS TPLS; (4S)-limonene biosynthetic enzymes directed to the plastid of camelina seed;
(293) Fusions between prenyltransferases and terpene synthase occur in nature, at least for formation of the diterpenes, the fusicoccins, in the plant pathogenic fungus Phomopsis amygdali (Toyomasu et al. Proc. Natl. Acad. Sci. USA 104, 3084-3088 (2007)). Fusion of farnesyl diphosphate synthase from Artemisia annua and 5-epi-aristolochene synthase from tobacco produced a functional chimera in E. coli. The K.sub.m values were unchanged in the fusion protein when compared to the individual enzymes, however, a more efficient conversion of IPP to 5-epi-aristolochene was achieved with the fusion protein (Brodelius et al. Eur. J. Biochem. 269, 3570-3577 (2002)). The geranyl diphosphate synthase expressed herein in camelina seed was a fusion of heteromonomers (Burke et al. Arch. Biochem. Biophys. 422, 52-60 (2004)). When fusions of geranyl diphosphate synthase and (4S)-limonene synthase were introduced into camelina, seed specific expression resulted in reduced quantities of (4S)-limonene when compared to experiments in which geranyl diphosphate synthase and (4S)-limonene synthase were produced as discrete enzymes (
(294) Since the terpene carbon skeleton can be oxygenated and further modified by addition of sugar moieties (Lcker et al. Plant J. 27, 315-324 (2001)), analyses for the presence of O-glycosylated monoterpene was also performed on camelina control- and transgenic seed. Total glycoside for T5 TPGDS TPLS seed was 1.540.54 mg/g (ca. of total (4S)-limonene accumulated) based on LC-MS/MS using phenyl--D-glucopyranoside as standard. Although the exact position of glycosylation was not determined, the high-resolution mass spectra indicated that mono- and dihydroxylation of the monoterpene skeleton had occurred in camelina seed and facilitated O-glycosylation. Deglycosylation with 1 N HCl at 100 C. for 2 h resulted in formation of monohydroxylated (4S)-limonene and 4-isopropyltoluene (also called cymene, a constituent of oil of cumin and thyme), thereby confirming dihydroxylation of the hexene ring of (4S)-limonene.
(295) Specialized cellular compartments have evolved to store terpenes in plants, such as the subcuticular space between trichome head cells and the cuticle that encloses them in herbaceous plant species (Gershenzon et al. Anal. Biochem. 200, 130-138 (1992)). Due to the high volatility of monoterpenes and the lack of a specialized storage compartment in camelina seed, head-space analysis of developing seed and mature, stored seed was carried out on (4S)-limonene-accumulating transgenic camelina to estimate yield loss due to release to the atmosphere. The amount of total volatile (4S)-limonene emitted during weeks 7 to 13 was calculated as 7.0 and 24.8 g plant.sup.1, which corresponded to 0.24 and 0.84% of accumulated (4S)-limonene in mature seed, respectively (Table 1). Transgenic TPGDS TPLS plants monitored through the T5 generation demonstrated stability in (4S)-limonene accumulation (
(296) TABLE-US-00015 TABLE 1 (4S)-Limonene emission from TPGDS TPLS (plastid) developing camelina plant* TPGDS TPLS plastidic T.sub.4 plant Plant age experiment 1 experiment 2 (weeks) (ng limonene emitted plant.sup.1 hr.sup.1) Wild type 7 0.0 0.0 0.0 8 2.6 0.0 0.0 9 17.2 78.9 0.0 10 10.6 68.6 0.0 11 7.5 0.0 0.0 12 4.0 0.0 0.0 13 0.0 0.0 0.0 mature seed 0.0 0.0 0.0 *The amount of total volatile (4S)-limonene emitted during weeks 7 to 13 was calculated as 7.0 and 24.8 g plant.sup.1, which corresponded to 0.24 and 0.84% of accumulated (4S)-limonene in mature seed, respectively.
(297) Taken together, the results presented herein demonstrate that camelina seed is a suitable synthetic biology platform for the production and accumulation of cyclic hydrocarbons that can function as components of biofuels. The plant is genetically tractable by floral dip, selection of transgenic seed is facilitated by florescence resulting from expression of the gene encoding DsRed in the transformation vector, and transgene expression is stable over at least generations. Importantly, loss of volatile terpenes during seed development and storage is minimal, and acid hydrolysis of terpene O-glucosides that are formed results in aromatic derivatives. These results should therefore be fully extrapolatable to seeds of other oil crops.
(298) Cyclic terpenes are currently being considered as alternatives to diesel (Peralta-Yahya et al. Nat. Commun. 2, Article 483 (2011)). In this example, we demonstrate the production of cyclic mono- and sesquiterpenes as advanced biofuels in a nonfoodstuff oilseed crop. To the best of the inventor's knowledge, it has not been shown that cyclic terpene hydrocarbons can be stably over-produced and accumulated in an oilseed. To achieve industrial feasibility, we expect to increase terpene accumulation by optimizing flux through the biochemical pathway by altering gene dosage of prenyltransferase vs. terpene synthase to balance the difference in steady-state kinetics between these two classes of enzymes.
(299) Materials and Methods
(300) Cloning.
(301) Total RNA was extracted from Mentha piperita (peppermint) and Arabidopsis thaliana (Arabidopsis) leaves using RNeasy plant mini kit (Qiagen). First-strand cDNAs were synthesized using SuperScript III (Invitrogen). Genomic DNA was extracted from Nicotiana tabacum (tobacco) leaves using DNeasy plant mini kit (Qiagen). Geranyl diphosphate synthase small subunit (GSS) and geranyl diphosphate synthase large subunit (GSL) have been cloned from the peppermint cDNAs with primers: GSSfC/GSSr4 and GSLfC/GSLr2, respectively (see Table E1 for primer sequences). A cDNA encoding the geranyl diphosphate synthase fusion protein (GDS) was generated by a 2-stage polymerase chain reaction (PCR) method (Burke et al. Arch. Biochem. Biophys. 422, 52-60 (2004)) using the GSS and GSL clones as templates by Phusion polymerase (New England BioLabs) with primers: GSSfC/GSSr10aa/10aaGSLfC/GSLr2. GDS is comprised of GSS, a 10 amino acid linker (SSNNLGIEGR (SEQ ID NO:72)) and GSL. Limonene synthase (LS) has been cloned from the peppermint cDNAs with primers: LSuf/LSr and fwdLSfC3/LSr. Farnesyl diphosphate synthase (FDS) gene has been cloned from the Arabidopsis cDNA with primers: FDSf/FDSr. The 5-epi-aristolochene synthase (EAS) sequence was amplified from the tobacco DNA with primers: fwdBamHIEAS/NtEASrc.
(302) Transformation Vectors.
(303) The pNaMluIOleosin entry vector (OP-OT) contains a soybean oleosin promoter (OP) and a soybean oleosin terminator (OT). The pNaAscINapin entry vector (NP-GT) contains a rapeseed napin promoter (NP) and a soybean glycinin terminator (GT). A binary vector, pRS, was a kind gift from Dr. Jan Jaworski (Donald Danforth Plant Science Center, MO). The nucleotide sequence was modified as follows: The pRSe2 vector contains a Discosoma red fluorescent protein (DsRed) as a selection marker between the left and right border T-DNA repeat sequences. The pea Rubisco small subunit transit peptide (TP) was inserted into pNaMluIOleosin and pNaAscINapin, yielding pNaMluIOleosinTP (OP-TP-OT) and pNaAscINapinTP (NP-TP-GT) entry vectors, respectively. The cloned sequences of GDS, LS, FDS and EAS were inserted into the entry vectors. The nucleotide sequences of OP-TP-GDS-OT and NP-TP-LS-GT, OP-GDS-OT and NP-LS-GT, OP-FDS-OT and NP-EAS-GT, and OP-TP-FDS-OT and NP-TP-EAS-GT were inserted into pRSe2 and sequenced, yielding TPGDS TPLS (plastid), GDS LS (cytosol), FDS EAS (cytosol), and TPFDS TPEAS (plastid) camelina transformation vectors, respectively.
(304) Fusion proteins of GDS and LS were constructed, which contained a nine amino acid linker (9aa, SGGSGGSGG (SEQ ID NO:35). The nucleotide sequences of OP-GDS-9aa-LS-OT, OP-TP-GDS-9aa-LS-OT, and OP-TP-LS-9aa-GDS-OT were inserted into pRSe2 and sequenced, yielding GDSLS fusion (cytosol), TPGDSLS fusion (plastid), TPLSGDS fusion (plastid) camelina transformation vectors, respectively. The Arabidopsis DXS coding sequence with its own transit peptide was a kind gift from Dr. Ed Cahoon (University of Nebraska-Lincoln, Nebr.). It was ligated into the pRS binary vector, yielding pRSDXS. DXS expression is controlled by a soybean glycinin promoter. The nucleotide sequences of OP-TP-GDS-OT and NP-TP-LS-GT were inserted into pRSDXS and sequenced, yielding a TPGDS TPLS DXS (plastid) camelina transformation vector.
(305) Camelina Plant Transformation.
(306) The generated transformation vectors were transformed into Agrobacterium tumefaciens strain GV3101 (pMP90) using a freeze-thaw method (Weigel et al. CSH Protoc. doi:10.1101/pdb.prot4666 (2006)). Selection of transformed bacteria was carried out on YEP medium containing 10 gl.sup.1 Bacto-peptone, 5 gl.sup.1 yeast extract and 5 gl.sup.1 NaCl at pH 6.8 with 25 mgl.sup.1 rifampicin, 40 mgl.sup.1 gentamicin and 50 mgl.sup.1 kanamycin. The plasmid insertion was confirmed by PCR. Overnight preculture of the transformed bacteria was transferred into a 2 l flask containing 300 ml YEP medium with 50 mgl.sup.1 kanamycin and incubated at 28 C. for 24 hours. Cells were harvested by centrifugation at 4 C. at 5000 g for 10 min, and then resuspended in an infiltration medium consisting of 0.5 Murashige and Skoog medium with vitamins, 50 gl.sup.1 sucrose and 0.05% (v/v) Silwet L77 (Lehle Seeds, Round Rock, Tex.) to a final OD.sub.600 of 1.0 to 1.5.
(307) Wild-type camelina plant was grown in the Donald Danforth Plant Science Center green house. Camelina transformation was performed using a floral dip method (Lu et al. Plant Cell Rep. 27, 273-278 (2008)). Camelina plants were inoculated with the Agrobacterium suspension prepared as described above. One or two flowering camelina plants were placed into a vacuum desiccator and the inflorescences were immersed into the suspension in a 500 ml beaker. The suspension with the inflorescences was degassed under vacuum for 5 min. The inoculated plants were covered with plastic trays for 24 hours before returning to the greenhouse. Mature seeds of the transformed plants were illuminated with a green LED flashlight, and transgenic seeds identified based on their fluorescence visualized by a red-lens screen.
(308) GC-MS Analysis of the Transgenic Seeds.
(309) Ten transgenic mature seeds were ground with a glass rod, soaked overnight in diethyl ether at room temperature, and then finally shaken every 15 min for 2 hr. iso-Butylbenzene and hexadecane were added as an internal standard for (4S)-limonene and 5-epi-aristolochene analyses, respectively. The extract was concentrated under nitrogen and analyzed by GC-MS. GC-MS analyses were performed on an Agilent 7890A GC system equipped with a Phenomenex ZB-5MSi column (32.5 m250 m0.25 m) connected to a 5975C inert XL MSD mass spectrometer. Oven temperature for (4S)-limonene analysis was 50 C. for 3 min, raised to 80 C. at a rate of 10 C. min.sup.1, held for 3 min, raised again to 300 C. at 40 C. min.sup.1, and held for 3 min. Oven temperature for 5-epi-aristolochene analysis was 50 C. for 3 min, raised to 180 C. at a rate of 5 C. min.sup.1, raised to 300 C. at 40 C. min.sup.1, and held for 3 min. The (4S)-limonene and 5-epi-aristolochene concentrations were calculated using (4S)-limonene and valencene as standards (Sigma), respectively. Other monoterpenes and sesquiterpenes were assigned by comparison of their EI-MS spectra with those of the NIST library.
(310) Enzyme Assay from Camelina Mature Seeds.
(311) Total protein extract was prepared from dry mature seeds. Ca. 22 seeds (corresponding to 20 mg) were ground in a 1.5 ml tube with a plastic homogenizer on ice for 3 min in 20 l mg.sup.1 of extraction buffer containing 50 mM Tris-HCl pH 7.5, 100 mM NaCl, 10% (v/v) glycerol, 5 mM 2-mercaptoethanol and a protease inhibitor cocktail (Sigma). The protein extract was centrifuged at 15000 g for 30 min at 4 C. twice. 45 l aliquots of the resulting supernatant were frozen in liquid nitrogen and stored at 80 C.
(312) The enzyme activity of GDS was analyzed as follows: reactions were performed in a total volume of 1 ml adjusted to 50 mM Hepes pH 7.2, 10% (v/v) glycerol, 20 mM MgCl.sub.2, 0.5 mM DTT and with 50 g E. coli recombinant (4S)-limonene synthase purified from pET28-LS BL21(DE3)RIL, 2 nmol IPP, 2 nmol DMAPP and 45 l camelina seed protein extract. The enzyme reaction was initiated by the addition of IPP and DMAPP, overlaid with hexane and incubated at 30 C. for 30 min to 4 hr. The enzyme activity of LS was analyzed as follows: reactions were performed in a total volume of 1 ml adjusted to 50 mM Hepes pH 7.2, 10% (v/v) glycerol, 20 mM MgCl.sub.2, 0.5 mM DTT, 500 mM KCl and with 2 nmol GPP and 45 l camelina seed protein extract. The enzyme reaction was initiated by the addition of GPP, overlaid with hexane and incubated at 30 C. for 1 hr to 8 hr. The reaction was stopped by chilling on ice followed by vigorous mixing. After adding the internal standard, enzymatically produced (4S)-limonene was extracted with hexane 3 times. The combined hexane extract was dehydrated by Na.sub.2SO.sub.4, concentrated and analyzed by GC-MS.
(313) Head-Space Experiment of Volatile (4S)-Limonene.
(314) Each week, the same individual plants of 7- to 13-week-old TPGDS TPLS (plastid) T4 and the same wild type plants were analyzed for terpene emission. A whole potted plant was enclosed in a plastic vacuum dessicator under fluorescent light. Air was aspirated by a small bench top vacuum pump at 2.5 in Hg for 8 hr. Activated charcoal (Sigma, 100-400 mesh) was placed both in the air-in and air-out valves in order to bind volatile compounds. After the incubation, the charcoal was washed with diethyl ether 5 times. After adding internal standard, the combined extract was concentrated under nitrogen gas and analyzed by GC-MS. The (4S)-limonene content was measured from the peak height of an ion of m/z 136. The volatile emission of mature seed on storage was also monitored (number of seeds produced per plant was ca. 1700). The total (4S)-limonene emission during seed development was estimated by integration of each time point from two individual cultivation periods.
(315) LC-MS/MS Glycoside Analysis.
(316) Approximately two grams of camelina seeds were homogenized and extracted with 100% methanol three times. The extracts were combined and evaporated under reduced pressure to dryness. The residue was dissolved in 50% methanol and analyzed by a HPLC (LC-20AD, Shimadzu) in tandem with a 4000 QTRAP mass spectrometer (Applied Biosystems). HPLC separation was carried out on a Phenomenex Gemini-NX c18 column (1502 mm, 5 m) using a linear gradient with a flow rate of 0.3 ml min.sup.1; solvent A was 5 mM ammonium acetate in water, and solvent B was 5 mM ammonium acetate in methanol. The glycosides were identified with precursor ion scan (m/z 161.0) and product ion scan (m/z 391.2) in negative ionization mode. The quantification was performed using phenyl-B-D-glucopyranoside as an internal standard by multiple reactions monitoring (MRM) scan.
(317) The invention being thus described, it will be obvious that the same may be varied in many ways. Such variations are not to be regarded as a departure from the spirit and scope of the invention, and all such modifications as would be obvious to one skilled in the art are intended to be included within the scope of the following claims.
REFERENCES CITED
(318) Alonso W. R., Rajaonarivony J. I., Gershenzon J. and Croteau R. (1992) Purification of 4S-limonene synthase, a monoterpene cyclase from the glandular trichomes of peppermint (Menthapiperita) and spearmint (Mentha spicata). J Biol Chem., 267, 7582-7. Burke C., Klettke K. and Croteau R. (2004) Heteromeric geranyl diphosphate synthase from mint: construction of a functional fusion protein and inhibition by bisphosphonate substrate analogs. Arch. Biochem. Biophys., 422, 52-60. Burke C. C., Wildung M. R. and Croteau R. (1999) Geranyl diphosphate synthase: cloning, expression, and characterization of this prenyltransferase as a heterodimer. Proc Natl Acad Sci USA., 96, 13062-7. Colby S. M., Alonso W. R., Katahira E. J., McGarvey D. J. and Croteau R. (1993) 4S-limonene synthase from the oil glands of spearmint (Mentha spicata). cDNA isolation, characterization, and bacterial expression of the catalytically active monoterpene cyclase. J Biol Chem., 268, 23016-24. Ho S. N., Hunt H. D., Horton R. M., Pullen J. K. and Pease L. R. (1989) Site-directed mutagenesis by overlap extension using the polymerase chain reaction. Gene, 77, 51-9. Lu C. and Kang J. (2008) Generation of transgenic plants of a potential oilseed crop Camelina sativa by Agrobacterium-mediated transformation. Plant Cell Rep., 27, 273-8. Weigel D. and Glazebrook J. (2006) Transformation of Agrobacterium Using the Freeze-Thaw Method. Cold Spring Harb Protoc., doi:10.1101/pdb.prot4666