Chimeric and humanized anti-human CTLA4 monoclonal antibodies and uses thereof
11629188 · 2023-04-18
Assignee
Inventors
Cpc classification
C07K2317/72
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
C07K2317/94
CHEMISTRY; METALLURGY
A61K2039/507
HUMAN NECESSITIES
C07K2317/732
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K16/2878
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
Abstract
This invention relates to compositions of chimeric and humanized antibodies that bind to the human CTLA4 molecule and their use in cancer immunotherapy and for reduction of autoimmune side effects compared to other immunotherapeutic agents.
Claims
1. A method of treating lung cancer in a subject in need thereof, comprising administering a composition comprising an anti-CTLA4 antibody or an antigen binding fragment thereof to the subject, wherein the anti-CTLA4 antibody or the antigen binding fragment is capable of binding to a human CTLA4 protein and comprises: (a) a light chain variable region comprising: (i) a complementarity determining region (CDR) 1 comprising the amino acid sequence set forth in SEQ ID NO: 21; (ii) a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 36, 37 or 38; and, (iii) a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 23; and, (b) a heavy chain variable region comprising: (i) a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 24; (ii) a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 33, 34 or 35; and, (iii) a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 26.
2. The method of claim 1, wherein: (a) the light chain CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 37 and the heavy chain CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 33; (b) the light chain CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 37 and the heavy chain CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 35; or, (c) the light chain CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 38 and the heavy chain CDR2 comprises the amino acid sequence set forth in SEQ ID NO: 35.
3. The method of claim 1, wherein: (a) the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 62, 63 or 64; and, (b) the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 70, 71 or 72.
4. The method of claim 3, wherein the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 62 and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 71.
5. The method of claim 3, wherein the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 64 and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 71.
6. The method of claim 3, wherein the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 64 and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 72.
7. The method of claim 1, wherein the anti-CTLA4 antibody or the antigen binding fragment is characterized by reduced binding to soluble CTLA4.
8. The method of claim 1, wherein the composition comprises the antigen binding fragment.
9. The method of claim 1, wherein the composition is a pharmaceutical composition comprising a therapeutically effective amount of the anti-CTLA4 antibody or the antigen binding fragment, and a physiologically acceptable carrier or excipient.
10. The method of claim 1, further comprising administering an additional agent selected from the group consisting of an anti-PD-1 antibody and an anti-4-1BB antibody.
11. The method of claim 10, wherein the anti-PD-1 antibody or anti-4-1BB antibody, and the anti-CTLA4 antibody are combined in a single molecule as a bi-specific antibody.
12. The method of claim 1, wherein the composition induces strong deletion of Treg and local T cell activation in tumor microenvironment but minimal systemic T cell activation.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45)
(46) The P values when the different treatment groups are compared are shown below:
(47) TABLE-US-00001 hlg VS αPD1 + L3D10 P value = 0.16 hlg VS αPD1 + hlg P value = 0.0384* hlg VS αPD1 + 10D1 P value = <2e−16*** hlg VS αPD1 + PP4631 P value = 0.16 hlg VS αPD1 + PP4637 P value = 0.00207** αPD1 + L3D10 VS αPD1 + hlg P value = 0.00654** αPD1 + L3D10 VS αPD1 + 10D1 P value = <2e−16*** αPD1 + L3D10 VS αPD1 + PP4631 P value = 0.492 αPD1 + L3D10 VS αPD1 + PP4637 P value = 0.000124*** αPD1 + hlg VS αPD1 + 10D1 P value = <2e−16*** αPD1 + hlg VS αPD1 + PP4631 P value = 0.0579 αPD1 + hlg VS αPD1 + PP4637 P value = 0.409 αPD1 + 10D1 VS αPD1 + PP4631 P value = <2e−16*** αPD1 + 10D1 VS αPD1 + PP4637 P value = <2e−16*** αPD1 + PP4631 VS αPD1 + PP4637 P value = 0.000446***
(48)
(49)
(50)
(51)
(52)
(53)
(54)
(55)
(56)
(57)
(58)
(59)
(60)
(61)
(62)
(63)
(64)
(65)
(66)
(67)
(68)
(69)
DEFINITIONS
(70) As used herein, the term “antibody” is intended to denote an immunoglobulin molecule that possesses a “variable region” antigen recognition site. The term “variable region” is intended to distinguish such domain of the immunoglobulin from domains that are broadly shared by antibodies (such as an antibody Fc domain). The variable region comprises a “hypervariable region” whose residues are responsible for antigen binding. The hypervariable region comprises amino acid residues from a “Complementarity Determining Region” or “CDR” (i.e., typically at approximately residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and at approximately residues 27-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain; ref. 44) and/or those residues from a “hypervariable loop” (i.e., residues 26-32 (L1), 50-52 (L2) and 91-96 (L3) in the light chain variable domain and 26-32 (H1), 53-55 (H2) and 96-101 (H3) in the heavy chain variable domain; Ref. 45). “Framework Region” or “FR” residues are those variable domain residues other than the hypervariable region residues as herein defined. The term antibody includes monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, synthetic antibodies, chimeric antibodies, camelized antibodies, single chain antibodies, disulfide-linked Fvs (sdFv), intrabodies, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id and anti-anti-Id antibodies to antibodies of the invention). In particular, such antibodies include immunoglobulin molecules of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass.
(71) As used herein, the term “antigen binding fragment” of an antibody refers to one or more portions of an antibody that contain the antibody's Complementarity Determining Regions (“CDRs”) and optionally the framework residues that comprise the antibody's “variable region” antigen recognition site, and exhibit an ability to immunospecifically bind antigen. Such fragments include Fab′, F(ab′).sub.2, Fv, single chain (ScFv),and mutants thereof, naturally occurring variants, and fusion proteins comprising the antibody's “variable region” antigen recognition site and a heterologous protein (e.g., a toxin, an antigen recognition site for a different antigen, an enzyme, a receptor or receptor ligand, etc.). As used herein, the term “fragment” refers to a peptide or polypeptide comprising an amino acid sequence of at least 5 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least 80 contiguous amino acid residues, at least 90 contiguous amino acid residues, at least 100 contiguous amino acid residues, at least 125 contiguous amino acid residues, at least 150 contiguous amino acid residues, at least 175 contiguous amino acid residues, at least 200 contiguous amino acid residues, or at least 250 contiguous amino acid residues.
(72) Human, chimeric or humanized antibodies are particularly preferred for in vivo use in humans, however, murine antibodies or antibodies of other species may be advantageously employed for many uses (for example, in vitro or in situ detection assays, acute in vivo use, etc.).
(73) A “chimeric antibody” is a molecule in which different portions of the antibody are derived from different immunoglobulin molecules such as antibodies having a variable region derived from a non-human antibody and a human immunoglobulin constant region. Chimeric antibodies comprising one or more CDRs from a non-human species and framework regions from a human immunoglobulin molecule can be produced using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; International Publication No. WO 91/09967; and U.S. Pat. Nos. 5,225,539, 5,530,101, and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; 46-48), and chain shuffling (U.S. Pat. No. 5,565,332).
(74) The invention particularly concerns “humanized antibodies”. As used herein, the term “humanized antibody” refers to an immunoglobulin comprising a human framework region and one or more CDR's from a non-human (usually a mouse or rat) immunoglobulin. The non-human immunoglobulin providing the CDR's is called the “donor” and the human immunoglobulin providing the framework is called the “acceptor.” Constant regions need not be present, but if they are, they must be substantially identical to human immunoglobulin constant regions, i.e., at least about 85-90%, preferably about 95% or more identical. Hence, all parts of a humanized immunoglobulin, except possibly the CDR's, are substantially identical to corresponding parts of natural human immunoglobulin sequences. A humanized antibody is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin. For example, a humanized antibody would not encompass a typical chimeric antibody, because, e.g., the entire variable region of a chimeric antibody is non-human. One says that the donor antibody has been “humanized,” by the process of “humanization,” because the resultant humanized antibody is expected to bind to the same antigen as the donor antibody that provides the CDR's. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which hypervariable region residues of the recipient are replaced by hypervariable region residues from a non-human species (donor antibody) such as mouse, rat, rabbit or a non-human primate having the desired specificity, affinity, and capacity. In some instances, Framework Region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies may comprise residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin that immunospecifically binds to an Fc.gamma.RIIB polypeptide, that has been altered by the introduction of amino acid residue substitutions, deletions or additions (i.e., mutations).
DETAILED DESCRIPTION
(75) An antibody against human CTLA4 protein, Ipilimumab, has been shown to increase survival of cancer patients, either as the only immunotherapeutic agent or in combination with other therapeutic agents such as, for example without limitation, an anti-PD-1 antibody (13-15). However, the therapeutic effect is associated with significant adverse effects (13-18). There is a great need to develop novel anti-CTLA4 antibodies to achieve better therapeutic effect and/or less autoimmune adverse effect. The inventors have discovered an anti-CTLA4 antibody that, surprisingly, can be used to induce cancer rejection while also reducing autoimmune adverse effects associated with immunotherapy.
(76) Provided herein are antibody compositions of matter and antigen-binding fragments thereof. The invention further concerns the embodiment of such molecules wherein the molecule is a monoclonal antibody, a human antibody, a chimeric antibody or a humanized antibody.
(77) In detail, the invention provides a molecule, comprising an antigen-binding fragment of an antibody that immunospecifically binds to CTLA4, and in particular human CTLA4, preferably expressed on the surface of a live cell at an endogenous or transfected concentration. The invention particularly concerns the embodiment of such a molecule wherein the antigen-binding fragment binds to CTLA4, and wherein the live cell is a T cell.
(78) The present invention relates to antibodies and their antigen-binding fragments that are capable of immunospecifically binding to CTLA4. In some embodiments such molecules are additionally capable of blocking the binding of B7.1 and B7.2 to CTLA4.
(79) The invention further concerns the embodiment of such molecules wherein the molecule is a monoclonal antibody, a human antibody, a chimeric antibody or a humanized antibody. The invention includes the embodiments wherein such antibodies are monospecific, bispecific, trispecific or multispecific.
(80) The invention further concerns the embodiment of such molecules or antibodies which binds to CTLA4, and wherein the antigen-binding fragment thereof comprises six CDRs, wherein the CDRs comprise the CDRs of anti-CTLA4 antibody L3D10. Specifically, the antibody comprises the three light chain and the three heavy chain CDRs of anti-CTLA4 antibody L3D10.
(81) The invention further concerns the embodiment of the above-described antibodies, wherein the antibody is detectably labeled or comprises a conjugated toxin, drug, receptor, enzyme, receptor ligand.
(82) The invention further concerns a pharmaceutical composition comprising a therapeutically effective amount of any of the above-described antibody compositions, and a physiologically acceptable carrier or excipient. Preferably, compositions of the invention comprise a prophylactically or therapeutically effective amount of humanized antibodies of the invention and a pharmaceutically acceptable carrier
(83) In a specific embodiment, the term “pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term “carrier” refers to a diluent, adjuvant (e.g., Freund's adjuvant (complete and incomplete), excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers may be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, may also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions may take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
(84) Generally, the ingredients of compositions of the invention may be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline may be provided so that the ingredients may be mixed prior to administration.
(85) The compositions of the invention may be formulated as neutral or salt forms. Pharmaceutically acceptable salts include, but are not limited to, those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
(86) The invention further concerns the use of the antibody compositions described here and pharmaceutical compositions thereof for the upregulation of immune responses. Up-modulation of the immune system is particularly desirable in the treatment of cancers and chronic infections, and thus the present invention has utility in the treatment of such disorders. As used herein, the term “cancer” refers to a neoplasm or tumor resulting from abnormal uncontrolled growth of cells. As used herein, cancer explicitly includes leukemias and lymphomas. The term refers to a disease involving cells that have the potential to metastasize to distal sites.
(87) Accordingly, the methods and compositions of the invention may also be useful in the treatment or prevention of a variety of cancers or other abnormal proliferative diseases, including (but not limited to) the following: carcinoma, including that of the bladder, breast, colon, kidney, liver, lung, ovary, pancreas, stomach, cervix, thyroid and skin; including squamous cell carcinoma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Berketts lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyoscarcoma; other tumors, including melanoma, seminoma, tetratocarcinoma, neuroblastoma and glioma; tumors of the central and peripheral nervous system, including astrocytoma, neuroblastoma, glioma, and schwannomas; tumors of mesenchymal origin, including fibrosarcoma, rhabdomyosarcoma, and osteosarcoma; and other tumors, including melanoma, xenoderma pegmentosum, keratoactanthoma, seminoma, thyroid follicular cancer and teratocarcinoma. It is also contemplated that cancers caused by aberrations in apoptosis would also be treated by the methods and compositions of the invention. Such cancers may include, but are not be limited to, follicular lymphomas, carcinomas with p53 mutations, hormone dependent tumors of the breast, prostate and ovary, and precancerous lesions such as familial adenomatous polyposis, and myelodysplastic syndromes. In specific embodiments, malignancy or dysproliferative changes (such as metaplasias and dysplasias), or hyperproliferative disorders, are treated or prevented by the methods and compositions of the invention in the ovary, bladder, breast, colon, lung, skin, pancreas, or uterus. In other specific embodiments, sarcoma, melanoma, or leukemia is treated or prevented by the methods and compositions of the invention.
(88) In another embodiment of the invention, the antibody compositions and antigen binding fragments thereof can be used with other anti-tumor therapies, including but not limited to, current standard and experimental chemotherapies, hormonal therapies, biological therapies, immunotherapies, radiation therapies, or surgery. In some embodiments, the molecules of the invention may be administered in combination with a therapeutically or prophylactically effective amount of one or more agents, therapeutic antibodies or other agents known to those skilled in the art for the treatment and/or prevention of cancer, autoimmune disease, infectious disease or intoxication. Such agents include for example, any of the above-discussed biological response modifiers, cytotoxins, antimetabolites, alkylating agents, antibiotics, or anti-mitotic agents, as well as immunotherapeutics.
(89) In preferred embodiment of the invention, the antibody compositions and antigen binding fragments thereof can be used with other anti-tumor immunotherapies. In such an embodiment the molecules of the invention are administered in combination with molecules that disrupt or enhance alternative immunomodulatory pathways (such as TIM3, TIM4, OX40, CD40, GITR, 4-1-BB, B7-H1, PD-1, B7-H3, B7-H4, LIGHT, BTLA, ICOS, CD27 or LAG3) or modulate the activity of effecter molecules such as cytokines (e.g., IL-4, IL-7, IL-10, IL-12, IL-15, IL-17, GF-beta, IFNg, Flt3, BLys) and chemokines (e.g., CCL21) in order to enhance the immunomodulatory effects. Specific embodiments include a bi-specific antibody comprising the anti-CTLA4 antibody compositions described herein and anti-PD-1 (pembrolizumab (Keytruda) or Nivolumab (Opdivo)), anti-B7-H1 (atezolizumab (Tecentriq) or durvalumab), anti-B7-H3, anti-B7-H4, anti-LIGHT, anti-LAG3, anti-TIM3, anti-TIM4 anti-CD40, anti-OX40, anti-GITR, anti-BTLA, anti-CD27, anti-ICOS or anti-4-1BB. In yet another embodiment, the molecules of the invention are administered in combination with molecules that activate different stages or aspects of the immune response in order to achieve a broader immune response. In more preferred embodiment, the antibody compositions and antigen binding fragments thereof are combined with anti-PD-1 or anti-4-1BB antibodies, without exacerbating autoimmune side effects.
(90) Another embodiment of the invention includes a bi-specific antibody that comprises an antibody that binds to CTLA4 bridged to an antibody that binds another immune stimulating molecules. Specific embodiments include a bi-specific antibody comprising the anti-CTLA4 antibody compositions described herein and anti-PD-1, anti-B7-H1, anti-B7-H3, anti-B7-H4, anti-LIGHT, anti-LAG3, anti-TIM3, anti-TIM4 anti-CD40, anti-OX40, anti-GITR, anti-BTLA, anti-CD27, anti-ICOS or anti-4-1BB. The invention further concerns of use of such antibodies for the treatment of cancer.
(91) Methods of administering the antibody compositions of the invention include, but are not limited to, parenteral administration (e.g., intradermal, intramuscular, intraperitoneal, intravenous and subcutaneous), epidural, and mucosal (e.g., intranasal and oral routes). In a specific embodiment, the antibodies of the invention are administered intramuscularly, intravenously, or subcutaneously. The compositions may be administered by any convenient route, for example, by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local.
(92) Yet another embodiment of the invention concerns monitoring the blocking effects of anti-CTLA4 antibodies in vivo by monitoring the expression levels of B7.1 and B7.2 on immune cells such as antigen presenting cells (APCs). CTLA4 is expressed predominately among the Treg where it suppresses autoimmune diseases by down-regulating B7-1 and B7-2 expression on APCs such as dendritic cells. Therefore, upregulation of B7 molecules, B7.1 and B7.2, can be as readouts for the in vivo blockade of B7-CTLA4 interactions. In a specific embodiment, peripheral or intra-tumoral immune cells are removed from the subject before and after anti-CTLA4 treatment and assayed ex vivo for a reduction in the level of B7.1 and/or B7.2 on the surface of the immune cell, wherein the presence of blocking anti-CTLA4 antibodies prevents B7.1/B7.2 binding by endogenous CTLA4, which in turn prevents the downregulation of B7.1 and B7.2, resulting in a net increase in B7.1/B7.2 expression. In a preferred embodiment the level of B7.1 and B7.1 is measured on antigen presenting cells. In a most preferred embodiment the level of B7.1 and B7.1 is measured on dendritic cells.
(93) In a further embodiment, the change (reduction) in B7.1 and B7.2 on immune cells following anti-CTLA4 treatment is used as a biomarker for measuring the biological activity of anti-CTLA4 antibodies in vivo and monitoring patent responses to anti-CTLA4 treatment by measuring the level B7.1 and/or B7.2 expression on immune cells, and comparing the level of expression before and after treatment. In a preferred embodiment the level of B7.1 and/or B7.2 expression is monitored over time during a course of anti-CTLA4 therapy.
EXAMPLES
Example 1. Generation of Chimeric Anti-CTLA4 Antibody
(94) Using human CTLA4 gene knock-in mice and hu-PBL-Scid mice, it was previously demonstrated that mouse anti-human CTLA4 antibodies reduced tumor growth, and identify L3D10 as the most effective among the panel of mAbs tested. However, none of the antibodies obtained was able to achieve complete tumor rejection, even when used at relatively high doses of (>10 mg/kg) and before formation of palpable tumors (as early on day 2) after tumor cell challenge (19-21).
(95) Since the mouse antibodies were of IgG1 subclass that does not have strong antibody-dependent cellular cytotoxicity (ADCC), and since ADCC maybe involved in tumor rejection, the Fc of the mAb was modified in several ways, to achieve better immunotherapeutic effect. First, mouse IgG1, which is weak in ADCC, was replaced to produce a chimeric antibody with human IgG1, which has strong ADCC activity. Second, based on known art in the literatures (22), three mutations (S298A, E333A and K334A) were introduced in the CH to increase ADCC activity. Third, three mutations (M252Y, S254T and T256E) were introduced to increase the half-life of the antibody in vivo (23). The design of the new chimeric antibody is depicted in
(96) To engineer the antibody, the variable regions of L3D10 hybridoma were first identified through DNA sequencing using standard methods known in the art. The nucleotide sequences were translated into amino acids listed in SEQ ID NO: 1 and SEQ ID NO: 2. The normal human IgG1 Fc sequence and the mutant Fc sequence are disclosed in SEQ ID NO: 3 and SEQ ID NO: 4, respectively. The amino acid and codon optimized nucleotide sequences of heavy and light chain sequences are disclosed in SEQ ID NOS: 5-8.
(97) DNA corresponding to SEQ ID NO: 5 and SEQ ID NO: 7 were synthesized and inserted into expression vectors, and the vectors were transfected with the designed sequence into HEK293 cells. Briefly, HEK293 cells were seeded in a shake flask one day before transfection, and were grown using serum-free chemically defined media. The DNA expression constructs were transiently transfected into 0.5 liter of suspension HEK293 cells using standard operating procedure for transient transfection. After 20 hours, cells were sampled to obtain the viability and viable cell count, and titer was measured (Octet QKe, ForteBio). Additional readings were taken throughout the transient transfection production runs. The culture was harvested at day 5. The conditioned media for L3D10 was harvested and clarified from the transient transfection production run by centrifugation and filtration. The supernatant was run over a Protein A column and eluted with a low pH buffer. Filtration using a 0.2 μm membrane filter was performed before aliquoting. After purification and filtration, the protein concentration was calculated from the OD280 and the extinction coefficient. A total of 43.2 mg of Ig proteins were obtained from one round of transfection.
Example 2. Chimeric L3D10 Antibody Binding Sites Only Partially Overlap with 10D1
(98) In the clinic, the anti-CTLA4 antibody, Ipilimumab, has been shown to improve the survival of cancer patients but induce significant autoimmune adverse effect. In order to evaluate the comparative binding sites of the chimeric L3D10 antibody and 10D1, binding to CTLA4 and the ability of the antibodies to compete for binding to CTLA4 were compared. While both antibodies bind to immobilized CTLA4 proteins at comparable efficiency (
Example 3. More Efficient Blockade CTLA4:B7.1 and CTLA4:B7.2 Interactions by Chimeric L3D10 Antibody than by 10D1
(99) It has been reported that anti-human CTLA4 mAb, 10D1, can block B7-CTLA4 interaction if soluble B7-1 and B7-2 was used to interact with immobilized CTLA4 (49). Since B7-1 and B7-2 function as cell surface co-stimulatory molecules, we evaluated the ability of anti-CTLA4 antibodies to block the B7-CTLA4 interaction using immobilized B7-1 and B7-2. Using a competitive ELISA assay format, the abilities of L3D10 and 10D1 to block binding of the CTLA4 fusion protein, CTLA4-Ig, to both plate-immobilized- and cell membrane-expressed B7.1 and B7.2. For these experiments a chimeric anti-human CTLA4-mAb with an affinity (2.3 nM) that is similar to 10D1 (4 nM) (49) was used. For the plate immobilized assays, B7.1 Fc or B7.2Fc were coated onto the ELISA plate at 1 μg/ml over night at 4° C. or 2 hours at 37° C. Biotinylated CTLA4-Fc were mixed with given concentrations of either B7.1-Fc, 10D1 or chimeric L3D10. The amounts of the CTLA4-Fc bound to B7.1 on the plate is determined using horse-radish peroxidase-conjugated streptavidin. As shown in
(100) For the cell membrane protein binding experiments, when B7.1 is expressed on the surface of CHO cells, L3D10 blocks binding of CTLA4-Fc but 10D1 from two different material lots did not, even when used at 512 μg/ml (
(101) A potential caveat is that biotinylation may have affected binding of 10D1 to CTLA4-Fc. To address this issue, we compared binding of L3D10 and 10D1 to biotinylated CTLA4-Fc used in the blocking studies. As shown in
Example 4. Chimeric L3D10 Antibody is More Efficient than Unmodified L3D10 in Causing Tumor Rejection
(102) It was previously reported that mouse L3D10 failed to cause complete remission of MC38 tumors, even though significant delays were observed (19, 20). To determine if chimeric L3D10 can cause complete remission in syngeneic mice, 1×10.sup.6 MC38 tumor cells were transplanted into syngeneic C57BL/6 mice. One week later, when the tumor reaches around 5 mm in diameter, mice were treated with either control IgG or chimeric L3D10 mAb at a dose that is only half of what was used in the previous studies with the mouse L3D10. As shown in
Example 5. Chimeric L3D10 Antibody has Equivalent Activity as 10D1 in Causing Tumor Rejection
(103) The availability of human CTLA4 gene knockin mice (20) provided with an unprecedented opportunity to test biological activity of the chimeric anti-human CTLA-4 antibody with clinically used anti-CTLA-4 mAb, 10D1. In this humanized mouse model, a CTLA4 gene encoding a product with 100% identity to human CTLA-4 protein is expressed under the control of endogenous mouse Ctla4 locus When the anti-tumor activity of the chimeric L3D10 and 10D1 were directly compared in the MC38 tumor model in human CTLA4-knockin mice, it is clear that both antibodies were comparable in causing tumor rejection, whereas the tumors grew progressively in IgG control group.
(104) An interesting question is whether anti-CTLA-4 mAbs need to interact with all CTLA-4 (i.e. achieve target saturation) in order to exert immunotherapeutic effect. F1 mice from CTLA4.sup.h/h and CTLA4.sup.m/m mice expresses both mouse and human CTLA-4 protein in a co-dominant manner. Interestingly, as shown in
(105) Previous studies have demonstrated that anti-mouse Ctla-4 mAbs cannot induce rejection of melanoma cell line B16-F1 without combination with other therapeutic modalities. Therefore, the anti-tumor effect of the chimeric L3D10 and 10D1 antibodies was also tested using this more challenging B16 tumor model in the human CTLA4 knockin mice. As shown in
Example 6: CTLA4 Blocking In Vivo
(106) CTLA4 is expressed predominately among the Treg where it suppresses autoimmune diseases by down-regulating B7-1 and B7-2 expression on dendritic cells (50). Since targeted mutation of Ctla4 (50) and treatment with blocking anti-CTLA4 mAb (51) upregulated expression of B7-1 and B7-2 on dendritic cells, it has been suggested that physiological function of CTLA4 on Treg is to down-regulate B7 on DC. Therefore, upregulation of B7 was used as a readout for the in vivo blockade of B7-CTLA4 interactions and developed an assay using T cells from the Ctla4.sup.h/h mice which had homozygous knockin of the human CTLA4 gene.
(107) As outlined in
(108) CTLA4 humanized mice that express the CTLA4 gene with 100% identify to human CTLA4 protein under the control of endogenous mouse Ctla4 locus has been described (20). The homozygous knock-in mice (CTLA4.sup.h/h) were backcrossed to C57BL/6 background for at least 10 generations. Heterozygous mice (CTLA4.sup.h/m) were produced by crossing the CTLA4.sup.h/h mice with WT BALB/c mice.
(109) To test clinically proven therapeutic anti-CTLA4 mAb, 10D1, we injected very high doses of anti-CTLA4 mAb (500 μg/mouse, which is roughly 25 mg/kg or 8-times the highest dose used in the clinic) into Ctla4.sup.h/h or Ctla4.sup.m/h mice and harvested spleen cells to measure levels of B7-1 and B7-2 on Cd11c.sup.hi DC at 24 hours after injection (
(110) To further confirm the specificity of the in vivo assay, we tested if L3D10 can upregulate B7 in Ctla4.sup.m/h mice in which mouse and human CTLA4 are expressed co-dominantly. Since at least 50% of the CTLA4 does not bind to anti-human CTLA4 antibodies, it is expected that they would be less potent in blocking B7-CTLA4 interaction. Indeed, neither antibody caused upregulation of B7-1 and B7-2 on DC from Ctla4.sup.m/h mice (
(111) The complete lack of blockade by L3D10 in the Ctla4.sup.m/h mice suggests that CTLA4 encoded by the mouse allele, which does not bind to L3D10 (
(112) However, despite these apparent differences in blocking activity, both L3D10 and 10D1 display strong anti-tumor activity against the MC38 model in chimeric CTLA4.sup.m/h mice, as shown in
Example 7: Anti-Tumor Effects are Associated with Intra-Tumoral Treg Depletion
(113) Immune regulation in vivo results from a balance between immune cell activation and immune checkpoints. In particular, regulatory T cells (Tregs) are a subpopulation of T cells which regulate the immune system, maintain tolerance to self-antigens, and abrogate autoimmune disease. Recent studies have demonstrated that therapeutic efficacy of anti-mouse CTLA4 mAb is affected by the Fc subclass and host Fc receptor, which in turn affect antibody-dependent cytotoxicity of Treg selectively within tumor microenvironment (52, 53). As differential CTLA4 blocking activity in vivo does not appear to translate to differences in anti-tumor activity, we attempted to establish the mechanism of action(s) by which the anti-tumor occurs and looked at Tregs within the tumor microenvironment. To do this, we sacrificed MC38 tumor-bearing mice before the rejections were completed (
(114) To substantiate this observation, we tested the therapeutic effect of the two anti-CTLA4 mAbs in the Ctla4.sup.m/h mice in which the anti-human CTLA4 mAbs can bind to at maximal of 50% of CTLA4 molecules and in which neither antibody can block B7-CTLA4 interaction to achieve upregulation of B7 on dendritic cells (
Example 8. Evaluation of Blocking Activities of Commonly Used Anti-Mouse CTLA4 mAbs 9H10 and 9D9
(115) The concept that CTLA4 is a cell-intrinsic negative regulator for T cell regulation was proposed based on stimulatory effect of both intact and Fab of two anti-mouse CTLA4 mAbs (30, 31), 4F10 and 9H10, although no data were presented to demonstrate that these antibodies block B7-CTLA4 interaction. More recently, a third anti-mouse CTLA4 mAb, 9D9, was reported to have therapeutic effect in tumor bearing mice and cause local depletion of Treg in tumor microenvironment (52). We therefore set out to test all three commercially available anti-mouse CTLA4 mAbs that had been shown to induce tumor rejection for their ability to block B7-CTLA4 interaction under physiologically relevant configurations. As a first test, we used increasing amounts of anti-CTLA4 mAbs (up to 2,000 fold molar excess over CTLA4-Fc) to block binding of biotinylated CTLA4-Fc to plate-immobilized B7-1 and B7-2. As shown in
(116) Taken together, we have demonstrated that clinically proven therapeutic anti-human CTLA4 mAb (10D1) and two anti-mouse CTLA4 mAbs (9H10 and 4F10) confers immunotherapeutic effect without blocking B7-CTLA4 interaction under physiologically relevant conditions. Furthermore, such blockade was not necessary for tumor rejection even for the mAb (L3D10) that can potently block B7-CTLA4 interaction. Since the therapeutic effect is substantially the same for antibodies with 1000-fold differences in blocking B7-CTLA4 interaction, such blockade does not contribute to cancer therapeutic effect of the anti-CTLA4 mAbs. These data refute the hypothesis that anti-CTLA4 mAb confers immunotherapeutic effect through checkpoint blockade (55). By refuting the prevailing hypothesis, our data suggest that the therapeutic effect of anti-CTLA4 mAb cannot be optimized by improving the blocking activities of the anti-CTLA4 mAbs. In this context, it is particular interest to note that Tremelimumab, which is superior in blocking B7-CTLA4 interaction (56), did not reach clinical endpoint in a phase III clinical trial (57). Meanwhile, by demonstrating strong correlation between tumor rejection of local Treg depletion and by refuting the involvement of blockade of B7-CTLA4 interaction in tumor immunity, our work favor the hypothesis that local deletion of Treg within the tumor environment is the main mechanism for therapeutic anti-CTLA4 mAb, and hence suggest new approaches to develop next generation of anti-CTLA4 mAb for cancer immunotherapy.
(117) Finally, accumulating genetic data in the mice suggest that the original concept (30, 31) that CTLA4 negatively regulates T cell activation and that such regulation was achieved through SHP-2 (58, 59) may need to be revisited (60). Thus, while the severe autoimmune diseases in the Ctla4.sup.−/− mice have been used to support the notion of CTLA4 as a cell-intrinsic negative regulator for T cell activation (61, 62), at least three lines of genetic data have since emerged that are not consistent with this view. First, lineage-specific deletion of the Ctla4 gene in Treg but not in the effector T cells is sufficient to recapitulate the autoimmune phenotype observed in mice with germline deletion of the Ctla4 gene (50). These data suggest that the autoimmunity in the Ctla4.sup.−/− mice was not due to lack of cell-intrinsic negative regulator CTLA4 in effector T cells. Second, in chimera mice consisting of both WT and Ctla4.sup.−/− T cells, the autoimmune phenotype was prevented by co-existence of WT T cells (63). These data again strongly argue that autoimmune diseases were not caused by lack of cell-intrinsic negative regulator. The lack of cell-intrinsic negative regulator effect is also demonstrated by the fact that in the chimera mice, no preferential expansion of Ctla4.sup.−/− T cells was observed during viral infection (64). Third, T-cell specific deletion of Shp2, which was proposed to be mediating negative regulation of CTLA4 (58, 59), turned out to reduce rather than enhance T cell activation (65). In the context of these genetic data reported since the proposal of CTLA4 as negative regulator for T cell activation, our data reported herein call for a reappraisal of CTLA4 checkpoint blockade in cancer immunotherapy.
Example 9. Chimeric L3D10 Demonstrates Reduced Immune Adverse Events when Used in Combination with Other Immunotherapeutic Antibodies
(118) Recent clinical studies have revealed that combination therapy between anti-PD-1 and anti-CTLA4 mAb further increase the survival of end-stage melanoma patients. However, 55% of the patients that received the combination therapy developed grades 3 and 4 immune related adverse events (irAEs). It is therefore critical to develop antibodies with less toxicity. We have developed an in vivo model that recapitulates the irAEs associated with the combination therapy of anti-CTLA-4 and anti-PD-1 mAbs observed in the clinic. In this model we treated human CTLA4 gene knockin mice (CTLA4.sup.h/h) during the perinatal period with high doses of anti-PD-1 and anti-CTLA-4 mAbs. We found that while the young mice tolerate treatment of individual mAbs, combination therapy with anti-PD-1 and 10D1 causes severe irAE with multiple organ inflammation, anemia and, as shown in
(119) To further examine to relative toxicity of chimeric L3D10 compared to 10D1 when administered in combination with anti-PD-1, we looked at the pathalogical effects in the CTLA4.sup.h/h knockin mice at 42 days after administration. As shown in
(120) To explore the potential mechanism of anemia in the 10D1-treated mice, we tested if 10D1+PD-1 treatment induces anti-red blood cell antibodies. As shown in
(121) To further determine the toxicology of L3D10 vs 10D1 in combination with anti-PD-1, we performed histological analysis of the heart (
Example 10: L3D10 has Reduced Binding for Soluble CTLA4
(122) L3D10 and 10D1 display similar binding patterns for plate immobilized CTLA4 (
(123) We have demonstrate that anti-CTLA-4 mAb induce robust tumor injection in heterozygous Ctla4.sup.h/m mice in which only 50% of CTLA-4 molecules can bind to anti-human CTLA-4 mAbs. To determine if engagement of 50% of CTLA-4 is sufficient to induce irAE, we treated the Ctla4.sup.h/m mice with anti-PD-1+10D1. As shown in
(124) In vivo activity demonstrates that the L3D10 antibody retains its anti-tumor activity but displays reduced autoimmune adverse effect observed with other immunotherapeutic antibodies such as 10D1, indicating it is possible to enhance anti-tumor activity without exacerbating autoimmune adverse events. Accordingly, autoimmune side effects are not a necessary price for cancer immunity and that it is possible to uncouple these two activities. Characterization of L3D10 demonstrated that its ability to block the interaction of CTLA4 with B7.1 and B7.2 is more effective than by 10D1 and that this relates to a difference in the CTLA4 binding site between the antibodies. Furthermore, L3D10 was fused to a modified human IgG1 Fc domain that has mutations conferring strong ADCC activity that enhances the therapeutic effect of the antibody. Further characterization demonstrates that L3D10 and 10D1 bind to immobilized CTLA4 with a similar binding profile. However, L3D10 demonstrates much lower binding affinity to soluble CTLA4 than 10D1. Taken together, our data demonstrate that antibody L3D10 has great potential for clinical use in treating cancer patients with less severe adverse events.
Example 11. Humanization of L3D10
(125) The humanization process begins by generating a homology modeled antibody 3D structure and creating a profile of the parental antibody based on structure modeling. Acceptor frameworks to utilize were identified based on the overall sequence identity across the framework, matching interface position, similarly classed CDR canonical positions, and presence of N-glycosylation sites that would have to be removed. One light chain (LC) and one heavy chain (HC) framework were selected for the humanization design.
(126) Humanized antibodies were designed by creating multiple hybrid sequences that fuse select parts of the parental antibody sequence with the human framework sequences, including grafting of the CDR sequences into the acceptor frameworks. The predicted CDR sequences of the of parent antibody L3D10 are provided as SEQ ID NOS: 21-26 as indicated in Table 1A below:
(127) TABLE-US-00002 TABLE 1A The predicted CDR sequences of the parental antibody L3D10 Antibody Chain CDR SEQ ID NO Variable Light 1 21 2 22 3 23 Variable Heavy 1 24 2 25 3 26
(128) Using the 3D model, these humanized sequences were methodically analyzed by eye and computer modeling to isolate the sequences that would most likely retain antigen binding. The goal was to maximize the amount of human sequence in the final humanized antibodies while retaining the original antibody specificity.
(129) Three humanized light chains (LC1, LC2 and LC3) and three humanized heavy chains (HC1, HC2 and HC3) were designed based on the selected acceptor frameworks. Each of the three HC or three LC sequences were from the same germline, with different back mutations to the murine parental sequence as shown in
(130) TABLE-US-00003 TABLE 1B CDR2 sequences of the humanized antibody variable regions. Antibody Sequence CDR2 Sequence SEQ ID NO HC1 YIWYDGNTNFHPSLKSR 33 HC2 YIWYDGNTNFHSSLKSR 34 HC3 YIWYDGNTNFHSPLKSR 35 LC1 AATNLQS 36 LC2 AATNLQD 37 LC3 AATSLQS 38
(131) The light and heavy humanized chains can now be combined to create variant fully humanized antibodies. All possible combinations of humanized light and heavy chains were tested for their expression level and antigen binding affinity to identify antibodies that perform similar to the parental antibody.
(132) A new tool to calculate humanness scores for monoclonal antibodies (24) were used. This score represents how human-like an antibody variable region sequence looks, which is an important factor when humanizing antibodies. The humanness scores for the parental and humanized antibodies are shown in Tables 2 and 3 below. Based on our method, for heavy chains a score of 79 or above is indicative of looking human-like; for light chains a score of 86 or above is indicative of looking human-like.
(133) TABLE-US-00004 TABLE 2 Humanized light chain information and humanness scores. Full-length (Framework + Framework CDR) Only Chain Name Note Cutoff = 86 Cutoff = 90 L2872 Light chain 71.3 78.2 (Chimeric Parental) L3106 (LC1) Regular humanized 86.5 96.8 L3107 (LC2) Regular humanized 83.6 94.0 L3108 (LC3) Regular humanized 88.8 98.1
(134) TABLE-US-00005 TABLE 3 Humanized heavy chain information and humanness scores. Full-length (Framework + Framework CDR) Only Chain Name Note Cutoff = 79 Cutoff = 84 H2872 Parental 62.0 70.3 (Chimeric Parental) H3106 (HC1) Regular humanized 80.4 90.7 H3107 (HC2) Regular humanized 78.9 89.4 H3108 (HC3) Regular humanized 80.5 93.0
(135) Full-length antibody genes were constructed by first synthesizing the variable region sequences. The sequences were optimized for expression in mammalian cells. These variable region sequences were then cloned into expression vectors that already contain human Fc domains; for the heavy chain, the hIgG1 (M252Y, S254T, T256E, S298A, E333A, K334A) backbone was utilized. In addition, for comparison the variable region of the chimeric parental heavy and light chains were constructed as full-length chimeric chains using the same backbone Fc sequences.
(136) All 9 humanized antibodies underwent 0.01 liter small scale production. The chimeric parental antibody was also scaled-up for direct comparison. Plasmids for the indicated heavy and light chains were transfected into suspension HEK293 cells using chemically defined media in the absence of serum to make the antibodies. Whole antibodies in the conditioned media were purified using MabSelect SuRe Protein A medium (GE Healthcare). The 10 antibodies tested are shown in Table 4 below.
(137) TABLE-US-00006 TABLE 4 Ten antibodies produced transiently in HEK293 cells Heavy Light Yield Antibody name Chain Chain PP # (mg/L) Humanized HC1 + LC1 H3106 L3106 4630 54 Humanized HC1 + LC2 H3106 L3107 4631 50 Humanized HC1 + LC3 H3106 L3108 4632 45 Humanized HC2 + LC1 H3107 L3106 4633 37 Humanized HC2 + LC2 H3107 L3107 4634 44 Humanized HC2 + LC3 H3107 L3108 4635 40 Humanized HC3 + LC1 H3108 L3106 4636 46 Humanized HC3 + LC2 H3108 L3107 4637 55 Humanized HC3 + LC3 H3108 L3108 4638 53 Chimeric Parental H2872 L2872 4629 28
(138) The affinity of 9 humanized antibody combinations and the chimeric parental antibody to the antigen (huCTLA4) was evaluated by Octet. Multi-concentration kinetic experiments were performed on the Octet Red96 system (ForteBio). Anti-hIgG Fc biosensors (ForteBio, #18-5064) were hydrated in sample diluent (0.1% BSA in PBS and 0.02% Tween 20) and preconditioned in pH 1.7 Glycine. The antigen was diluted using a 7-point, 2-fold serial dilution starting at 600 nM with sample diluent. All antibodies were diluted to 10 μg/mL with sample diluent and then immobilized onto anti-hIgG Fc biosensors for 120 seconds. After baselines were established for 60 seconds in sample diluent, the biosensors were moved to wells containing the antigen at a series of concentrations to measure the association. Association was observed for 120 seconds and dissociation was observed for 180 seconds for each protein of interest in the sample diluent. The binding affinities were characterized by fitting the kinetic sensorgrams to a monovalent binding model (1:1 binding). The full kinetic measurements are summarized in Table 5 below.
(139) TABLE-US-00007 TABLE 5 Kinetic measurements of the humanized antibodies and the parental antibody Loading Sample Sample ID ID KD (M) kon(1/Ms) kdis(1/s) Full X{circumflex over ( )}2 Full R{circumflex over ( )}2 PP4629 huCTLA4 2.3E−09 3.5E+05 8.0E−04 0.0033 0.9981 PP4630 huCTLA4 1.3E−08 1.3E+05 1.8E−03 0.0127 0.9848 PP4631 huCTLA4 6.9E−09 2.4E+05 1.6E−03 0.0120 0.9918 PP4632 huCTLA4 1.2E−08 1.6E+05 1.9E−03 0.0109 0.9915 PP4633 huCTLA4 7.1E−09 2.0E+05 1.4E−03 0.0106 0.9933 PP4634 huCTLA4 6.8E−09 2.8E+05 1.9E−03 0.0116 0.9866 PP4635 huCTLA4 8.4E−09 2.4E+05 2.0E−03 0.0077 0.9934 PP4636 huCTLA4 8.7E−09 2.5E+05 2.2E−03 0.0111 0.9905 PP4637 huCTLA4 6.4E−09 3.2E+05 2.1E−03 0.0173 0.9884 PP4638 huCTLA4 8.1E−09 2.9E+05 2.3E−03 0.0122 0.9920
Example 12. Anti-Tumor Activity of the Humanized Anti-CTLA4 Antibodies
(140) Based on the relative binding affinity and humanness scores, we chose 3 antibodies for further evaluation:
(141) PP4631—high affinity and good expression
(142) PP4637—high affinity and good expression
(143) PP4638—slightly lower affinity but highest humanization score
(144) Material for each of these antibodies was produced by transient production in HEK293 cells at the 0.1 liter scale followed by protein A purification. Binding affinity of the purified antibodies was confirmed by Octet analysis as shown in Table 6 below.
(145) TABLE-US-00008 TABLE 6 Kinetic measurements of the humanized antibodies and the parental antibody Loading Sample Replicate Sample ID ID KD (M) kon(1/Ms) kdis(1/s) Full X{circumflex over ( )}2 Full R{circumflex over ( )}2 1 PP4631 huCTLA4 7.2E−09 2.3E+05 1.6E−03 0.0274 0.9894 1 PP4637 huCTLA4 7.1E−09 2.7E+05 1.9E−03 0.0294 0.9899 1 PP4638 huCTLA4 9.4E−09 2.3E+05 2.1E−03 0.0211 0.9919 2 PP4631 huCTLA4 7.4E−09 2.3E+05 1.7E−03 0.0191 0.9919 2 PP4637 huCTLA4 8.4E−09 2.6E+05 2.2E−03 0.0248 0.9899 2 PP4638 huCTLA4 1.1E−08 2.1E+05 2.2E−03 0.0150 0.9934
(146) We evaluated the anti-tumor activity of these three humanized antibodies compared to 10D1 and the chimeric L3D10 antibody using the syngeneic MC38 mouse tumor model in human CTLA4-knockin mice described in Example 5 above.
(147) In a another experiment we evaluated the anti-tumor activity of the humanized antibodies PP4631 and PP4637 compared to 10D1 and the chimeric L3D10 antibody using the syngeneic MC38 mouse tumor model in the heterozygous Ctla4.sup.h/m mice described in Example 5 (
(148) The anti-tumor activity of the humanized antibodies compared to 10D1 and the chimeric L3D10 antibody was also demonstrated using the syngeneic B16-F1 melanoma mouse tumor model in human CTLA4-knockin mice as shown in
Example 13. Humanized Clones of L3D10 Maintain Superior Safety Profiles Over 10D1
(149) To test if the superior safety profiles of L3D10 can be maintained after humanization, we compared PP4631 and PP4637 with 10D1 for their adverse effects when used in combination with anti-PD-1. As shown in
(150) Consistent with the defective erythropoiesis described in
Example 14. Binding Characteristics of the Humanized Anti-CTLA4 Antibodies
(151) In order to confirm that the humanized antibodies retained their CTLA4 binding characteristics, we looked at binding to immobilized and plate bound CTLA4. As shown in
(152) We have demonstrated that chimeric L3D10 has a 1000-fold higher blocking activity than 10D1. This raised an interesting possibility that blocking B7-CTLA-4 interactions may explain its lack of irAE. As shown in
(153) Given the proposed role for CTLA-4 in the protection against autoimmune diseases, we proposed reduced binding to soluble CTLA-4 as an underlying mechanism for improved safety profiles. To test this hypothesis, we used the growth weight gain among the female mice that received anti-PD-1+anti-CTLA-4 mAbs during the perinatal period as the basic indicator for irAE. As shown in
Example 15. Processability Evaluation of the Humanized Anti-CTLA4 Antibodies
(154) In order to evaluate the development and manufacturing potential of the three different humanized antibodies, a number of analytical methods were performed to characterize the different antibodies.
(155) TABLE-US-00009 Characteristic Method Production Transient expression in HEK293 cells, followed by 1-step Protein A purification Purity Size exclusion chromatography (SEC) Purity Capillary Electrophoresis (reduced and non-reduced) Non-Glyco Capillary Electrophoresis (reduced) Deamidation Capillary isoelectric focusing (cIEF) and liquid chromatography-mass spectrometry (LC-MS) following DM stress treatment Thermostability Differential Scanning Calorimetry (DSC) Oxidation Peptide mapping Bindinq specificity CHO, 293 blank cell FACS
(156) As an initial assessment, the predicted molecular weights and isoelectric point of the three lead candidate antibodies was calculated based on amino acid sequences. As shown in Table 7, all antibodies were fairly similar, although antibody had a slightly lower PI.
(157) TABLE-US-00010 TABLE 7 Theoretical parameters of the three humanized antibodies Protein Name Theoretical MW (Da) Theoretical PI PP4631 (49647.8 + 23483.1) × 2 = 96614.0 7.9 PP4637 (49644.9 + 23483.1) × 2 = 96611.1 7.65 PP4638 (49644.9 + 23311.9) × 2 = 96568.7 7.9
(158) Product Yield Assessment
(159) In order to assess the productivity of the different antibodies, HEK293 cells were transiently transfected with vectors expressing the heavy and light chains of the different antibodies. These cells were then cultured in shake flasks for 6 days using serum-free medium. After 6 days, the supernatant was collected and the antibodies were purified by one-step Protein A chromatography. As should in Table 8 below, antibodies PP4631 and PP4637 demonstrated similar protein yields whereas antibody PP4638 was produced at a much lower relative yield.
(160) TABLE-US-00011 TABLE 8 Humanized antibody production yield assessment. Antibody Concentration (mg/mL) OD 260/280 Yield (mg/L) PP4631 1.280 0.53 126 PP4637 4.532 0.53 118 PP4638 0.729 0.57 56
(161) In order to assess the purity of the transiently expressed antibodies, samples were analyzed by reducing and non-reducing SDS-PAGE. As shown in
(162) Size Exclusion Chromatography
(163) To further examine the purity and aggregation of the different antibodies following transient expression, we performed size exclusion chromatography of the purified proteins. Briefly, 50 μg of filtered (using 0.22 μm filter) sample was used for SE-HPLC separation using a TOSOH G3000 SWxl 5 μm column. PBS pH 7.4 was used as the mobile phase. As shown in Table 9 below, all the humanized antibodies show >90% purity after protein A purification. Antibodies PP4631 and PP4637 demonstrated similarly low levels of higher molecular weight (MW) aggregates and degradation present with the antibody samples with most of the protein within the main peak. In contrast, antibody PP4638 had higher levels of aggregation and some degradation. The SE-HPLC chromatograms are shown in
(164) TABLE-US-00012 TABLE 9 Size Exclusion Chromatography Antibody Aggregation Main Peak Degradation PP4631 2.6% 97.4% 0 PP4637 3.0% 97.0% 0 PP4638 6.5% 92.4% 1.1%
(165) Capillary Electrophoresis (CE)
(166) Capillary electrophoresis was used to quantitate the amount of protein within the peak bands under both reduced and non-reduced conditions, as well as the amount of unglycosylated heavy chain protein. Briefly, 100 μg of sample was diluted into CE-SDS sample buffer along with lodoacetamide (non-reduced conditions) or P-mercaptoethanol (reduced conditions), along with 2 μL of a 10 kDa standard protein. Samples were then treated for 10 min at 70° C. For separation, PA-800, 50 μm I.D. bare-fused silica capillary was used; running length 20.2 cm; separating voltage 15 kV; OD220 for detection. As shown in Table 10 below, all three proteins demonstrated high levels of purity, consistent with SDS-PAGE, and all were highly glycosylated. The CE-SDS chromatograms are shown in
(167) TABLE-US-00013 TABLE 10 Capillary Electrophoresis Unglycosylated Antibody Non-reduced % Reduced % Heavy Chain PP4631 97.3 99.5 0.3 PP4637 97.2 99.5 0.4 PP4638 96.9 99.4 0.4
(168) Deamidation: Capillary Isoelectric Focusing (cIEF) and Liquid Chromatography-Mass Spectrometry (LC-MS)
(169) The level of protein deamidation under high pH stress was determined by comparing the antibodies with and without high pH stress treatment over two different time periods (5 hrs and 12.5 hrs), followed by cIEF and LC-MS analysis.
(170) The charge isoform profile and isoelectric points of the different antibodies was determined by capillary isoelectric focusing (cIEF). Briefly, samples underwent buffer exchange into 20 mM Tris pH 8.0 and then 100 μg of sample protein was mixed with the amphoteric electrolyte, methyl cellulose, along with PI 7.05 and PI 9.77 markers. iCE3™ was used for analysis, with a 100 μm I.D. capillary; 1.5 kV plus 3 kV; OD280 for detection. For deamidation stress treatment, samples were treated with 500 mM NaHCO.sub.3 for 5 hr or 12.5 hr, then examined with cIEF and LC-MS. The results of the analysis are shown in Table 11 below and the LC-MS graphs are shown in
(171) TABLE-US-00014 TABLE 11 Isoelectric focusing and deamidation DM treatment Main Antibody Peak PI time DM % peak % Basic % PP4631 8.28 Untreated 17.3 71.9 3.0 5 h 27.1 65.4 3.0 12.5 h 40.3 53.2 2.5 PP4637 8.11 Untreated 18.1 79.0 2.9 5 h 31.5 65.7 2.8 12.5 h 44.0 53.8 2.2 PP4638 8.36 Untreated 22.5 69.6 2.3 5 h 34.4 57.6 2.7 12.5 h 45.9 46.5 2.3
(172) Differential Scanning Calorimetry (DSC) Thermal Analysis
(173) In order to determine the thermal stability and melting temperatures of the different antibodies, they were subject to Differential Scanning Calorimetry (DSC) Thermal Analysis. Briefly, 2 mg/mL samples in PBS pH 7.4 were subject to temperature ramping from 15° C. to 105° C. at a rate of 1° C./min. Cp changing with temperature was monitored for both samples and buffer (as background). Cp vs temperature curves were obtained with background subtraction, and peaks indicated the Tm of the analytes. As shown in Table 12 below, all three antibodies demonstrated a similarly high melting temperature. DSC curves for the three antibodies are shown in
(174) TABLE-US-00015 TABLE 12 Size Exclusion Chromatography Antibody T.sub.M (° C.) PP4631 75.6 PP4637 76.2 PP4638 76.6
(175) Oxidation: Peptide Mapping
(176) Oxidative modification of the humanized antibodies was evaluated by peptide mapping using LC-MS with or without oxidative stress. The samples were denatured at 65° C. in the presence of 6M GnCl and 5 mM p-ME, then acetylated with iodacetamide. The processed samples are then digested with Trypsin (Promega, sequencing grade) at 55° C. and the digested mixture was separated on a C18 reversed phase LC column (ACQUITY UPLC BEH130 C18, 2.1×100 mm, 1.7 μm) and analyzed by mass spectrometry (Waters XEVO-G2S QTOF) using Masslynx and Biophatmlynx analysis tools. For the oxidation stress analysis, samples treated with 0.05% or 0.1% H.sub.2O.sub.2 for 1 hr, then examined with LC-MS. The results are shown in Tables 13-16 below.
(177) TABLE-US-00016 TABLE 13 Oxidation of the humanized antibodies at Methionine sites. Top panel: antibody PP4631. Middle panel: antibody PP4637. Bottom panel: antibody PP4638. PP4631 oxidation (%) Fragment Modification Oxidation 0.05% H.sub.2O.sub.2 0.1% H.sub.2O.sub.2 Modifiers Number start end sites Sequence 0 h Oxidation 1 h Oxidation 1 h Oxidation M(1) 1:T001 1 18 4 DIQMTQSPSSLSASVGDR (SEQ ID NO: 74) 0.4 0.5 0.4 2:T037 425 447 436 WQQGNVFSCSVMHEALHNHYTQK (SEQ ID NO: 75 0.6 1.6 2.7 PP4637 oxidation (%) Fragment Modification Oxidation 0.05% H.sub.2O.sub.2 0.1% H.sub.2O.sub.2 Modifiers Number start end sites Sequence 0 h Oxidation 1 h Oxidation 1 h Oxidation M(1) 1:T001 1 18 4 DIQMTQSPSSLSASVGDR (SEQ ID NO: 74) 0.4 0.5 0.5 2:T036 425 447 436 WQQGNVFSCSVMHEALHNHYTQK (SEQ ID NO: 75) 0.7 1.7 3.0 PP4638 oxidation (%) Fragment Modification Oxidation 0.05% H.sub.2O.sub.2 0.1% H.sub.2O.sub.2 Modifiers Number start end sites Sequence 0 h Oxidation 1 h Oxidation 1 h Oxidation M(1) 1:T001 1 18 4 DIQMTQSPSSLSASVGDR (SEQ ID NO: 74) 0.7 0.7 0.6 2:T036 425 447 436 WQQGNVFSCSVMHEALHNHYTQK (SEQ ID NO: 75) 0.9 1.6 2.8
(178) TABLE-US-00017 TABLE 14 Oxidation of the humanized antibody PP4631 at Tryptophan sites. Red numbers indicate evidence of fragmentation found; ″—″ indicates none detected; ″0″ indicates detected at extremely low levels. PP4631 oxidation (%) Fragment Modification Oxidation 0.05% H.sub.2O.sub.2 0.1% H.sub.2O.sub.2 Modifiers Number start end sites Sequence 0 h Oxidation 1 h Oxidation 1 h Oxidation 1:T003 25 39 35 ASENIYSNLAWYQQK (SEQ ID NO: 76) 0.2 0.2 0.2 W(1) 1:T007 62 103 92 FSGSGSGTDYTLTISSLQPEDFATYFCQHLWGTPYT — 0 0 FGQGTK (SEQ ID NO: 77) 1:T013 146 149 148 VQWK (SEQ ID NO: 78) 0.2 0.2 0.1 2:T001 1 38 36 QVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGLSWI 0 — — R (SEQ ID NO: 79) 2:T003 44 64 47/52 GLEWIGYIWYDGNTNFHPSLK (SEQ ID NO: 80) 0 0.2 0.2 2:T009 98 129 115 TEGHYYGSNYGYYALDYWGQGTSVTVSSASTK 0 0.1 0 (SEQ ID NO: 81) 2:T012 156 218 166 DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS 0.1 0.1 0.1 SVVTVPSSSLGTQTYICNVNHKPSNTK (SEQ ID NO: 82) 2:T020 283 296 285 FNWYVDGVEVHNAK (SEQ ID NO: 83) 4.5 3.9 3.9 2:T023 310 325 321 VVSVLTVLHQDWLNGK (SEQ ID NO: 84) 0 0 0 2:T033 379 400 389 GFYPSDIAVEWESNGQPENNYK (SEQ ID NO: 85) 2.2 2.6 2.7 2:T037 425 447 425 WQQGNVFSCSVMHEALHNHYTQK (SEQ ID NO: 75) 0.1 0.1 0.1
(179) TABLE-US-00018 TABLE 15 Oxidation of the humanized antibody PP4637 at Tryptophan sites. Red numbers indicate evidence of fragmentation found; ″—″ indicates none detected; ″0″ indicates detected at extremely low levels. PP4637 oxidation (%) Fragment Modification Oxidation 0.05% H.sub.2O.sub.2 0.1% H.sub.2O.sub.2 Modifiers Number start end sites Sequence 0 h Oxidation 1 h Oxidation 1 h Oxidation 1:T003 25 39 35 ASENIYSNLAWYQQK (SEQ ID NO: 76) 0.2 0.2 0.2 W(1) 1:T007 62 103 92 FSGSGSGTDYTLTISSLQPEDFATYFCQHLWGTPY — — 0 TFGQGTK (SEQ ID NO: 77) 1:T013 146 149 148 VQWK (SEQ ID NO: 78) 0.1 0.1 0.1 2:T001 1 38 36 QVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGLS — 0.1 — WIR (SEQ ID NO: 79) 2:T003 44 64 47/52 GLEWIGYIWYDGNTNFHSPLK (SEQ ID NO: 86) 0 0 0.1 2:T008 98 129 115 TEG HYYGSNYGYYALDYWGQGTLVTVSSASTK 0.2 0.2 0.1 (SEQ ID NO: 87) 2:T011 156 218 166 DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL — 0 0 SSVVTVPSSSLGTQTYICNVNHKPSNTK (SEQ ID NO: 82) 2:T019 283 296 285 FNWYVDGVEVHNAK (SEQ ID NO: 83) 4.0 4.0 4.0 2:T022 310 325 321 VVSVLTVLHQDWLNGK (SEQ ID NO: 84) 0 0 0 2:T032 379 400 389 GFYPSDIAVEWESNGQPENNYK (SEQ ID NO: 85) 2.5 2.5 2.7 2:T036 425 447 425 WQQGNVFSCSVMHEALHNHYTQK (SEQ ID NO: 75) 0.2 0 0.1
(180) TABLE-US-00019 TABLE 16 Oxidation of the humanized antibody PP4638 at Tryptophan sites. Red numbers indicate evidence of fragmentation found; ″—″ indicates none detected; ″0″ indicates detected at extremely low levels. PP4638 oxidation (%) Fragment Modification Oxidation 0.05% H.sub.2O.sub.2 0.1% H.sub.2O.sub.2 Modifiers Number start end sites Sequence 0 h Oxidation 1 h Oxidation 1 h Oxidation 1:T003 25 42 35 ASENIYSNLAWYQQKPGK (SEQ ID NO: 88) — — — W(1) 1:T006 62 103 92 FSGSGSGTDFTLTISSLQPEDFATYYCQHLWGTPY 0 0 0 TFGGGTK (SEQ ID NO: 89) 1:T012 146 149 148 VQWK (SEQ ID NO: 78) 0.1 — — 2:T001 1 38 36 QVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGLS 0 — — WIR (SEQ ID NO: 79) 2:T003 44 64 47/52 GLEWIGYIWYDGNTNFHSPLK (SEQ ID NO: 86) 0.1 0.2 0.2 2:T008 98 129 115 TEG HYYGSNYGYYALDYWGQGTLVTVSSASTK 0.3 0.3 0.4 (SEQ ID NO: 87) 2:T011 156 218 166 DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL 0 0 0.2 SSVVTVPSSSLGTQTYICNVNHKPSNTK (SEQ ID NO: 82) 2:T019 283 296 285 FNWYVDGVEVHNAK (SEQ ID NO: 83) 3.7 4.1 4.1 2:T022 310 325 321 VVSVLTVLHQDWLNGK (SEQ ID NO: 84) 0 0 0 2:T032 379 400 389 GFYPSDIAVEWESNGQPENNYK (SEQ ID NO: 85) 2.6 2.9 2.7 2:T036 425 447 425 WQQGNVFSCSVMHEALHNHYTQK (SEQ ID NO: 75) 0 0 0
(181) Binding Specificity
(182) The binding specificity of the different antibodies was determined by assessing the ability to detect non-specific binding to two different cell lines that do not express CTLA4 (CHO and HEK293) relative to 10D1 at two different concentrations. Briefly, 100 μg/mL or 20 μg/mL samples (or reference mAb) in PBS was incubated with 3×10e.sup.6 cells/ml (CHO or HEK293). FITC labeled rabbit-anti-human-IgG antibody (Boster, Wuhuan, China) was used for detection and the binding of target mAb to cells was measured by FACS. As shown in Table 17 below, antibodies PP4631 and PP4637 demonstrate very low binding and good specificity, whereas antibody PP4638 displayed non-specific binding activity to the control cell lines.
(183) TABLE-US-00020 TABLE 17 Binding Specificity to CHO and HEK293 cell lines MFI Samples CHO HEK 293 CELL only 3.50583 4.16546 2.sup.nd Ab only 4.00062 4.68083 10D1 (100 ug/ml) 3.82459 5.49435 10D1 (20 ug/ml) 3.70334 4.95407 PP4631 (100 ug/ml) 10.8065 7.76113 PP4631 (20 ug/ml) 5.03402 5.5862 PP4637 (100 ug/ml) 15.0944 10.5987 PP4637 (20 ug/ml) 5.89652 5.78233 PP4638 (100 ug/ml) 83.4742 36.8002 PP4638 (20 ug/ml) 15.3381 9.86523
Example 16. Epitope Mapping of the L3D10 and Humanized Antibodies
(184) In order to map the CTLA-4 binding epitope of the L3D10 parent antibody and the humanized variants, PP4631 and PP4637, we took advantage of the fact that the mouse and human CTLA4 proteins are cross-reactive to B7-1, but not to the anti-CTLA-4 antibodies. Accordingly, we designed a number of mutants of the human CTLA-4Fc protein in which clusters of amino acids from the human CTLA-4 protein were replaced with amino acids from the murine Ctla-4 protein. As the anti-CTLA-4 antibodies used in this study do not bind to murine Ctla-4, binding of the anti-human CTLA-4 antibodies should be abolished when key residues of the antibody binding epitope are replaced with murine amino acids.
(185) DNA vectors encoding 11 CTLA-4Fc mutant proteins (M1-M11)(SEQ ID NOS: 40-50) were constructed based on the wild type human CTLA-4Fc sequence and proteins were produced by transient transfection in HEK293 at the 0.01 mL scale followed by one-step Protein A chromatography purification.
(186) Binding of the anti-CTLA4 antibodies to CTLA4Fc proteins was performed by ELISA. Plates were coated with CTLA-4Fc proteins at 1 μg/mL and biotinylated antibodies or B7-1 Fc fusion protein were then used in soluble phase in the binding assay, with the amounts of protein bound measured using horse-radish peroxidase (HRP)-conjugated streptavidin.
(187) The anti-human CTLA-4 antibodies do not cross react with murine Ctla-4, which presumably reflects differences in the amino acid sequence between human and mouse CTLA-4 in the extracellular domain.
(188) In order to map the binding epitope of the anti-human CTLA-4 antibodies we generated a number of non-overlapping CTLA-4Fc mutant proteins that incorporate clusters of murine-specific amino acids into the human CTLA-4 sequence. The amino acids incorporated into each of the 11 mutants is shown in
(189) TABLE-US-00021 TABLE 18 WT and mutant CTLA-4Fc proteins produced transiently in HEK293 cells. Protein name Yield (mg) CTLA-4Fc WT control 0.72 Mutant 1 1.29 Mutant 2 0.03 Mutant 3 0.21 Mutant 4 0.11 Mutant 5 1.89 Mutant 6 0.38 Mutant 7 0.25 Mutant 8 1.61 Mutant 9 0.01 Mutant 10 0.04 Mutant 11 1.70
(190) The capacity of chimeric L3D10 and the humanized antibodies PP4631 and PP4637 to bind the immobilized CTLA-4Fc mutant constructs was then determined by ELISA in which plates were coated with the CTLA-4 mutant constructs and biotinylated anti-CTLA-4 antibodies, or B7-1Ig control protein, were added and binding measured using HRP-conjugated streptavidin. The results of binding assays are shown in Tables 19-22. As expected, all 4 binding proteins demonstrated nice dose-dependent binding for the WT CTLA-4Fc protein. However, mutations that were introduced into the M9 and M10 proteins appear to alter the overall structure and these mutants failed to bind B7-1Fc. Mutations introduced in M2 and M4 also partially altered CTLA-4 conformation as indicated by reduced binding relative to the WT protein. Consistent with this notion, all 4 of these mutants (M2, M4, M9 and M10) were expressed at much lower yield (Table 18). In contrast, using binding to the WT CTLA-4Fc protein and binding of the B7-1Fc proteins as references, M11 clearly stands out as a protein that is expressed well, binds B7-1 Fc efficiently but failed to bind two humanized anti-CTLA-4 antibodies. Its binding to original L3D10 is also reduced by approximately 100-fold (Table 20). As expected, the mutations that affect the overall confirmation also affected the binding to the anti-CTLA-4 antibodies.
(191) TABLE-US-00022 TABLE 19 Integrity of CTLA4Ig mutants as indicated by their binding to B7-1 Ig fusion protein. Binding to CTLA4Fc proteins was performed by ELISA, with the amounts of biotinylated protein bound measured by horse-radish peroxidase (HRP)-conjugated streptavidin. Values shown are the OD450 measurements. WT = wild type CTLA-4Fc. M1-M11 are CTLA-4Fc mutant proteins. Protein Conc. WT M1 M2 M3 M4 M5 M6 M7 M8 M9 M10 M11 0 0.193 0.196 0.202 0.184 0.182 0.182 0.184 0.185 0.18 0.172 0.175 0.174 0 0.19 0.182 0.177 0.175 0.171 0.171 0.173 0.17 0.168 0.164 0.162 0.163 10 ng/ml 0.259 0.328 0.204 0.267 0.199 0.286 0.255 0.218 0.293 0.166 0.167 0.22 10 ng/ml 0.257 0.311 0.187 0.249 0.184 0.271 0.244 0.22 0.276 0.154 0.159 0.217 100 ng/ml 1.137 1.594 0.316 1.087 0.359 1.513 1.093 0.785 1.468 0.164 0.164 0.884 100 ng/ml 1.111 1.553 0.299 1.082 0.34 1.221 1.049 0.695 1.375 0.155 0.15 1.045 1 ug/ml 2.813 3.147 1.179 3.147 1.375 2.877 3.053 2.703 3.253 0.199 0.171 3.053 1 ug/ml 2.651 3.053 0.986 2.864 1.413 3.025 2.983 2.716 2.93 0.218 0.172 3.159
(192) TABLE-US-00023 TABLE 20 Epitope mapping of chimeric L3D10 antibody. Binding to CTLA4Fc proteins was performed by ELISA, with the amounts of biotinylated protein bound measured by horse-radish peroxidase (HRP)-conjugated streptavidin. Values shown are the OD450 measurements. WT = wild type CTLA-4Fc. M1-M11 are CTLA-4Fc mutant proteins Protein Conc. WT M1 M2 M3 M4 M5 M6 M7 M8 M9 M10 M11 0 0.202 0.196 0.2 0.187 0.184 0.189 0.192 0.198 0.187 0.179 0.179 0.183 0 0.195 0.187 0.185 0.18 0.176 0.176 0.176 0.176 0.17 0.166 0.166 0.167 10 ng/ml 1.433 2.47 0.375 0.62 0.507 1.539 1.033 0.714 1.233 0.18 0.18 0.202 10 ng/ml 1.518 2.432 0.317 0.587 0.356 1.366 0.976 0.738 1.237 0.171 0.169 0.203 100 ng/ml 3.053 3.253 1.384 2.318 2.142 2.841 2.699 2.495 2.909 0.295 0.215 0.635 100 ng/ml 3.025 3.239 1.164 2.354 1.409 2.991 2.771 2.483 2.841 0.304 0.216 0.759 1 ug/ml 3.373 3.268 2.387 3.184 2.651 3.025 3.092 3.147 3.136 0.916 0.804 2.841 1 ug/ml 3.114 2.967 2.619 3.124 2.659 3.034 3.072 2.991 3.034 0.916 0.868 2.983
(193) TABLE-US-00024 TABLE 21 Epitope mapping of humanized antibody PP4631. Binding to CTLA4Fc proteins was performed by ELISA, with the amounts of biotinylated protein bound measured by horse-radish peroxidase (HRP)-conjugated streptavidin. Values shown are the OD450 measurements. WT = wild type CTLA-4Fc. M1-M11 are CTLA-4Fc mutant proteins Protein Conc. WT M1 M2 M3 M4 M5 M6 M7 M8 M9 M10 M11 10 ng/ml 0.312 2.264 0.207 0.198 0.194 0.407 0.22 0.194 0.247 0.177 0.181 0.172 10 ng/ml 0.29 2.297 0.184 0.178 0.174 0.378 0.202 0.185 0.222 0.154 0.16 0.164 100 ng/ml 1.077 2.827 0.203 0.27 0.219 1.371 0.459 0.281 0.725 0.171 0.17 0.172 100 ng/ml 0.841 3.061 0.194 0.264 0.208 1.589 0.42 0.277 0.801 0.154 0.155 0.159 1 ug/ml 2.51 2.881 0.339 0.882 0.473 2.79 1.992 1.169 2.33 0.175 0.17 0.178 1 ug/ml 2.471 2.958 0.263 1.121 0.573 2.795 2.016 1.243 2.642 0.167 0.169 0.185
(194) TABLE-US-00025 TABLE 22 Epitope mapping of humanized antibody PP4637. Binding to CTLA4Fc proteins was performed by ELISA, with the amounts of biotinylated protein bound measured by horse-radish peroxidase (HRP)-conjugated streptavidin. Values shown are the OD450 measurements. WT = wild type CTLA-4Fc. M1-M11 are CTLA-4Fc mutant proteins Protein Conc. WT M1 M2 M3 M4 M5 M6 M7 M8 M9 M10 M11 10 ng/ml 0.597 2.307 0.195 0.544 0.189 1.239 0.603 0.19 0.5 0.373 0.169 0.157 10 ng/ml 0.535 2.244 0.162 0.195 0.435 1.188 0.516 0.535 0.47 0.148 0.15 0.152 100 ng/ml 1.947 2.632 0.182 0.389 0.248 2.601 1.296 0.521 2.001 0.15 0.15 0.152 100 ng/ml 2.229 2.186 0.175 0.364 0.221 2.425 0.875 0.405 2 0.137 0.139 0.148 1 ug/ml 2.724 2.05 0.259 1.662 0.725 2.654 2.355 1.418 2.548 0.157 0.151 0.162 1 ug/ml 2.742 2.297 0.274 1.549 0.724 2.84 2.374 1.369 2.69 0.147 0.143 0.165
(195) TABLE-US-00026 TABLE 23 Raw data from a repeat study showing specific loss of antigenic epitope only in M11. As in Table 2-5, except that additional controls were included to shown specificity of the binding. May 3, 2016 Ab Conc hCTLA4-Fc M1 M2 M3 M4 M5 M6 M7 M8 M9 M10 M11 Biotin-L3D10 0 0.18 0.187 0.377 0.183 0.22 0.177 0.183 0.186 0.368 0.15 0.215 0.171 0 0.177 0.222 0.538 0.167 0.18 0.229 0.177 0.142 0.217 0.293 0.114 0.155 10 ng/ml 1.705 2.692 0.469 0.623 0.817 1.853 1.244 0.837 1.27 0.158 0.169 0.19 10 ng/ml 1.799 2.779 0.333 0.593 0.563 1.802 1.331 0.884 1.454 0.213 0.157 0.194 100 ng/ml 3.316 3.195 1.313 2.244 2.233 3.251 3.032 2.672 3.015 0.419 0.26 0.752 100 ng/ml 3.458 3.567 1.37 2.535 2.356 3.316 3.032 2.875 3.157 0.346 0.272 0.746 1000 ng/ml 3.567 3.509 2.833 3.333 3.08 3.413 3.282 3.299 3.352 1.124 0.945 2.888 1000 ng/ml 3.672 3.509 2.755 3.299 3.145 3.537 3.316 3.352 3.435 1.181 0.941 2.914 Biotin-HB7-1 0 0.195 0.2 0.202 0.193 0.192 0.197 0.195 0.198 0.192 0.186 0.185 0.186 0 0.192 0.185 0.181 0.192 0.178 0.178 0.178 0.187 0.173 0.169 0.168 0.161 10 ng/ml 0.316 0.37 0.216 0.304 0.22 0.345 0.279 0.258 0.326 0.177 0.176 0.239 10 ng/ml 0.31 0.356 0.21 0.414 0.26 0.331 0.279 0.253 0.297 0.159 0.167 0.236 100 ng/ml 1.581 1.882 0.333 1.245 0.527 1.813 1.235 0.899 1.557 0.176 0.172 1.092 100 ng/ml 1.525 1.928 0.323 1.345 0.489 1.735 1.385 0.987 1.643 0.162 0.155 1.283 1000 ng/ml 3.76 3.6 1.167 3.435 1.973 3.316 3.413 3.101 3.635 0.232 0.185 3.568 1000 ng/ml 3.6 3.673 1.316 3.51 2.009 3.459 3.413 3.183 3.635 0.215 0.181 3.673 Biotin-HL12 10 ng/ml 0.451 2.812 0.207 0.202 0.194 0.626 0.23 0.207 0.327 0.197 0.205 0.181 10 ng/ml 0.417 2.693 0.181 0.179 0.177 0.642 0.22 0.195 0.32 0.158 0.182 0.162 100 ng/ml 1.868 3.568 0.212 0.29 0.256 2.618 0.589 0.345 1.532 0.172 0.174 0.171 100 ng/ml 1.938 3.317 0.203 0.274 0.247 2.126 0.571 0.305 1.419 0.155 0.155 0.162 1000 ng/ml 2.99 3.568 0.268 1.181 0.712 2.922 2.187 1.329 2.817 0.181 0.17 0.177 1000 ng/ml 3.033 3.51 0.268 1.184 0.759 3.071 2.358 1.475 2.869 0.144 0.171 0.187 Biotin-HL32 10 ng/ml 0.983 2.654 0.202 0.218 0.197 1.409 0.429 0.218 0.727 0.176 0.176 0.17 10 ng/ml 0.955 2.604 0.184 0.2 0.168 1.359 0.389 0.21 0.761 0.148 0.154 0.152 100 ng/ml 2.669 3.007 0.232 0.534 0.319 2.908 1.839 0.523 2.669 0.145 0.161 0.16 100 ng/ml 2.741 3.158 0.203 0.554 0.374 2.895 1.741 0.478 2.604 0.145 0.148 0.157 1000 ng/ml 3.183 3.146 0.327 1.837 1.019 2.966 2.817 1.72 3.042 0.173 0.163 0.174 1000 ng/ml 3.209 3.316 0.321 1.867 1.015 3.196 2.857 1.766 3.051 0.143 0.163 0.187 Biotin-L3D10 Biotin-L3D10 Biotin-HB7-1 Biotin-hB7-1 Ab conc mCTLA4-Fc hlg-Fc mCTLA4-Fc hlg-Fc Biotin-HL12 Biotin-HL12 Biotin-HL32 0 0.19 0.198 0.202 0.191 0 0.189 0.184 0.18 0.185 10 ng/ml 0.201 0.201 0.338 0.181 0.179 0.188 0.185 0.179 10 ng/ml 0.18 0.182 0.318 0.164 0.165 0.162 0.17 0.181 100 ng/ml 0.303 0.315 1.635 0.176 0.171 0.177 0.185 0.176 100 ng/ml 0.314 0.326 1.668 0.165 0.162 0.163 0.165 0.171 1000 ng/ml 0.942 1.385 3.569 0.18 0.177 0.182 0.184 0.183 1000 ng/ml 0.94 1.475 3.353 0.179 0.172 0.177 0.176 0.187 mCTLA4 hlgG mCTLA4 hlgG mCTLA4 hlgG mCTLA4 hlgG Biotin-L3D10 Biotin-hB7-1 Biotin-HL12 Biotin-HL32
(196) Since L3D10 retained significant binding to M11, we tested if the binding is specific. We coated plate with human CTLA4-Fc (hCTLA4Fc), mouse CTLA4-Fc (mCTLA4-Fc), Control IgG1-Fc or all mutant hCTLA4-Fc and measured their binding to B7-1Fc along with L3D10, PP4631 and PP4637. The bulk of the data are presented in Table 23. As shown in
(197) Using known complex structure 133, we mapped the CTLA-4 epitope in a 3-D structure. As shown in
(198) Taking advantage of the fact that the mouse and human CTLA4 proteins are cross-reactive to B7-1, but that anti-human CTLA-4 antibodies do not cross react with murine Ctla-4 protein, we were able to map the binding epitope of the L3D10 derived antibodies by ELISA. Using a number of mutants of the human CTLA-4Fc protein in which clusters of amino acids from the human CTLA-4 protein were replaced with amino acids from the murine Ctla-4 protein, we clearly demonstrate that when we replace 4 amino acids that immediately follow the known B7-1 binding domain of CTLA-4, dose-dependent binding of the antibodies is largely abolished. The fact that the binding epitope maps directly adjacent to the B7-1 binding domain correlates well with the demonstrated ability of the L3D10 antibodies to block B7-CTLA-4 interactions both in vitro and in vivo. Since soluble CTLA4 is produced by fusion of C-terminal amino acids of the extracellular IgV domain to intracellular domain, it is tempting to speculate that antibody that binds to polymorphic C-terminal domain residues (only 18 amino acid from the C-terminus) is more likely to lose reactivity to soluble CTLA-4, in which a large intracellular domain is fused to the C-terminus of the extracellular domain.
(199) To further investigate the binding domain of the anti-CTLA4 antibodies, 6 additional mutant CTLA4-Fc fusion proteins, designated M12-M17 (SEQ ID NOS: 51-56), were designed (
Example 17. Anti-CTLA-4 mAb Synergizes with Anti-4-1BB in Inducing Tumor Rejection
(200) Studies in animal models have indicated that the anti-tumor response elicited by anti-CTLA-4 monoclonal antibody (mAb) is, at least in part, due to an antigen-specific T cell response against normal “self” differentiation antigens (73, 74). The tendency of anti-CTLA-4 antibodies to exacerbate autoimmune diseases is well documented in the mouse (75-78). This notion was further corroborated and proved to be a major limitation in more recent human trials in which the patients developed severe autoimmune manifestations that required discontinuation of treatment (79). On the other hand, cancer therapeutic anti-4-1BB mAbs have been shown to abrogate the development of autoimmune diseases in lupus prone mice (24, 25).
(201) The fact that anti-4-1BB mAbs can both stimulate anti-tumor responses and decrease autoimmune manifestations raises the intriguing possibility that the combination of this antibody with anti-CTLA-4 mAb may result in cancer rejection without autoimmunity. In this study anti-CTLA-4 and anti-4-1BB were combined to induce rejection of large established tumors.
(202) Combined Effect of Anti-Murine-CTLA-4 and Anti-Murine-4-1BB Antibodies in the Induction of CD8 T Cell-Mediated Tumor Rejection.
(203) Two models, one of minimal disease and one of large established tumors, were used to test the anti-tumor effect of combining anti-murine-4-1BB and anti-murine-CTLA-4 mAb treatments. C57BL/6 mice were challenged with a subcutaneous inoculation of MC38 colon cancer cells, and at different times after tumor cell inoculation, antibodies were injected into tumor-challenged mice and the tumor size and incidence were monitored by physical examination.
(204) In the minimal disease model, the mice were treated with hamster IgG plus rat IgG, anti-4-1BB plus hamster IgG (anti-4-1BB alone group), anti-CTLA-4 plus rat IgG (anti-CTLA-4 alone group), or anti-4-1BB combined with anti-CTLA-4 starting at 48 hours after inoculation of tumor cells. The antibodies were administered intraperitoneally (i.p.) on days 2, 9, and 16. Treatment with either anti-4-1BB or anti-CTLA-4 mAb alone resulted in a delay in tumor growth with 1 out of 5 mice in each group rejecting tumors, while 4 out of 5 mice treated with both anti-CTLA-4 and anti-4-1BB mAbs were tumor-free at the conclusion of the experiment.
(205) To determine if the anti-tumor effects of combination mAb treatment against small tumor burden could be extended to therapeutic applications against larger tumor burdens, mice with established tumors were treated with antibodies. Wild type C57BL/6 mice were challenged with a subcutaneous inoculation of MC38 colon cancer cells. Tumors were allowed to grow for 14 days, at which point, mice with established tumors (usually >7 mm in diameter) were selected and divided randomly into four treatment groups: hamster IgG plus rat IgG, anti-4-1BB plus hamster IgG, anti-CTLA-4 plus rat IgG, and anti-4-1BB mAb combined with anti-CTLA-4 mAb. The antibodies were administered i.p. on days 14, 21, and 28 after tumor challenge. As shown in
(206) MC38 is known to form liver metastasis..sup.80 To evaluate the effect of therapeutic antibodies on liver metastasis, all mice enrolled in the experiments were analyzed for liver metastasis by histology. As shown in Table 24, approximately 60% of the control Ig-treated mice had micro-metastasis in the liver. Treatments with either anti-CTLA-4 or anti-4-1BB antibodies alone reduced the rate of metastasis somewhat, although the reduction did not reach statistical significance. Remarkably, only 1/22 mice in the group treated with both antibodies had liver metastases. Using a logistic regression model, we found that the odds of liver metastasis for mice given anti-4-1BB alone were approximately 4.7 times higher than the odds for mice given both anti-4-1BB and anti-CTLA-4 (95% CI: 1.6, 13.7; p=0.0050). Similarly, the odds of liver metastasis were 3.6 times higher for mice given anti-CTLA-4 only compared to mice given both treatments (95% CI: 1.3, 10.2; p=0.0174). Thus, combination therapy significantly reduces liver metastasis by MC38 when compared to treatment with either antibody alone.
(207) TABLE-US-00027 TABLE 24 Combination therapy substantially reduces liver metastases* Number of mice with Group metastasis comparison Group Treatment n (%) p-value G1 Hamster IgG + 19 11 Rat IgG (57.8%) G2 Anti-CTLA-4 + 18 6 vs.G1: 0.1383 Rat IgG (33.3%) G3 Anti-4-16B + 21 8 vs.G1: 0.2136 Hamster IgG (38.1%) G4 Anti-CTLA-4 + 22 1 vs.G1: 0.0007 Anti-4-1BB (4.5%) vs.G2: 0.0174 vs.G3: 0.0050 *Data are summarized from 4 independent experiments. At least two sections per liver were examined after H&E staining.
(208) To determine which subset of immune cells was contributing to the anti-tumor effect elicited by combination mAb treatment, the major subsets of lymphocytes were depleted with monoclonal antibodies. MC38 tumor cells were injected subcutaneously. Once tumors were palpable, tumor-bearing mice were separated into four groups. Each group had a series of intraperitoneal antibody injections to deplete differing subsets of immune cells, including no depletion with normal rat IgG, CD4 T cell depletion with anti-CD4 mAb (GK 1.5), CD8 T cell depletion with anti-CD8 mAb (2.4.3), and NK cell depletion with anti-NK1.1 mAb (PK136). In addition, all mice in all groups were treated with anti-CTLA-4 plus anti-4-1BB mAbs once weekly for three weeks. Adequate depletion of immune cell subsets was evaluated by flow cytometry of peripheral blood taken from mice immediately prior to completion of the experiment (data not shown). As expected, mice with no depletion of immune cells responded to treatment with anti-CTLA-4 combined with anti-4-1BB mAb (
(209) Anti-4-1BB Antibody Reduced Antibody Response to Xenogeneic Anti-CTLA-4 Antibodies.
(210) One of the obstacles to repeated antibody therapy is the enhancement of host antibody responses to the therapeutic antibodies..sup.81 Since 4-1BB is known to reduce antibody response to proteins, we evaluated the effect of anti-4-1BB antibodies on host response to anti-CTLA-4 antibodies. As shown in
(211) In Human CTLA-4 Knock-in Mice, a Combination of Anti-Mouse 4-1BB and Anti-Human CTLA-4 Antibodies Induced Tumor Rejection and Long-Lasting Cancer Immunity.
(212) Since anti-4-1BB reduces the production of antibodies against the anti-CTLA-4 antibodies, an interesting issue is whether the enhancement of tumor rejection by anti-4-1BB is solely due to its effect in suppressing antibody response. This human CTLA4 gene knock-in mouse allowed us to test if the anti-tumor effect of the anti-human CTLA4 antibodies can be enhanced by anti-4-1BB antibody. As shown in
(213) To test whether the double antibody treated mice were immune to further tumor cell challenge, we challenged them with tumor cells at 110 days after their first tumor cell challenge. As shown in
(214) One of the obstacles to protein-based immunotherapy is host immunity to the therapeutic proteins. In the case of antibodies, the host can mount antibodies to xenotypic, allotypic and idiotypic epitopes..sup.81 The xenotypic response can be eliminated by complete humanization, although other anti-antibody responses require special considerations. The obstacle is more obvious for anti-CTLA-4 antibody as it is an adjuvant in itself. Previous work by Mittler et al. demonstrated a significant suppression of T-cell dependent humoral immune response..sup.83 Our data demonstrate that co-administration of anti-4-1BB antibodies reduces host responses to the anti-CTLA-4 antibody, which suggests another advantage of combination therapy using anti-CTLA-4 and anti-4-1BB antibody.
(215) Taken together, our data demonstrate that combination therapy with anti-CTLA-4 and anti-4-1BB antibodies offers three major advantages, namely, an increased effect in cancer immunity, mutual suppression of autoimmune side effects, and amelioration of anti-antibody responses.
(216) All publications and patents mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference in its entirety. While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure as come within known or customary practice within the art to which the invention pertains and as may be applied to the essential features hereinbefore set forth.
REFERENCES CITED
(217) 1. Townsend ARM, Tothbard J, Gotch F M, Bahadur G, Wraith D, McMichael A J. The epitope of influenza nucleoprotein recognized by cytotoxic lymphocytes can be defined with short synthetic peptides. Cell. 1986; 44:959-68. 2. Zinkernagel R M, Doherty P C. Restriction of in vitro T cell-mediated cytotoxicity in lymphocytic choriomeningitis within a syngeneic or semiallogeneic system. Nature. 1974; 248:701-2. 3. Lafferty K J, Prowse S J, Simeonovic C J, Warren H S. Immunobiology of tissue transplantation: a return to the passenger leukocyte concept. Annu Rev Immunol. 1983; 1:143-73. 4. Liu Y, Linsley P S. Costimulation of T-cell growth. Curr Opin Immunol. 1992; 4(3):265-70. 5. Schwartz R H. Costimulation of T lymphocytes: the role of CD28, CTLA4, and B7/BB1 in interleukin-2 production and immunotherapy. Cell. 1992; 71(7):1065-8. 6. Freeman G J, Freedman A S, Segil J M, Lee G, Whitman J F, Nadler L M. B7, a new member of the Ig superfamily with unique expression on activated and neoplastic B cells. J Immunol. 1989; 143(8):2714-22. 7. Freeman G J, Gribben J G, Boussiotis V A, Ng J W, Restivo V A, Jr., Lombard L A, et al. Cloning of B7-2: a CTLA4 counter-receptor that costimulates human T cell proliferation [see comments]. Science. 1993; 262(5135):909-11. 8. Hathcock K S, Laszlo G, Dickler H B, Bradshaw J, Linsley P, Hodes R J. Identification of an alternative CTLA4 ligand costimulatory for T cell activation [see comments]. Science. 1993; 262(5135):905-7. 9. Wu Y, Guo Y, Liu Y. A major costimulatory molecule on antigen-presenting cells, CTLA4 ligand A, is distinct from B7. J Exp Med. 1993; 178(5): 1789-93. 10. Leach D R, Krummel M F, Allison J P. Enhancement of antitumor immunity by CTLA4 blockade [see comments]. Science. 1996; 271(5256): 1734-6. 11. Linsley P S, Brady W, Urnes M, Grosmaire L S, Damle N K, Ledbetter J A. CTLA4 is a second receptor for the B cell activation antigen B7. J Exp Med. 1991; 174(3):561-9. 12. Linsley P S, Clark E A, Ledbetter J A. T-cell antigen CD28 mediates adhesion with B cells by interacting with activation antigen B7/BB-1. Proc Natl Acad Sci USA. 1990; 87(13):5031-5. 13. Hodi F S, Mihm M C, Soiffer R J, Haluska F G, Butler M, Seiden M V, et al. Biologic activity of cytotoxic T lymphocyte-associated antigen 4 antibody blockade in previously vaccinated metastatic melanoma and ovarian carcinoma patients. Proc Natl Acad Sci USA. 2003; 100(8):4712-7. PubMed PMID: 12682289. 14. Hodi F S, O'Day S J, McDermott D F, Weber R W, Sosman J A, Haanen J B, et al. Improved survival with ipilimumab in patients with metastatic melanoma. N Engl J Med. 2010; 363(8):711-23. Epub 2010/06/08. doi: 10.1056/NEJMoa1003466. PubMed PMID: 20525992; PubMed Central PMCID: PMC3549297. 15. Larkin J, Chiarion-Sileni V, Gonzalez R, Grob J J, Cowey C L, Lao C D, et al. Combined Nivolumab and Ipilimumab or Monotherapy in Untreated Melanoma. N Engl J Med. 2015; 373(1):23-34. Epub 2015/06/02. doi: 10.1056/NEJMoa1504030. PubMed PMID: 26027431. 16. Ribas A, Hodi F S, Callahan M, Konto C, Wolchok J. Hepatotoxicity with combination of vemurafenib and ipilimumab. N Engl J Med. 2013; 368(14):1365-6. Epub 2013 Apr. 5. doi: 10.1056/NEJMc1302338. PubMed PMID: 23550685. 17. Delyon J, Mateus C, Lambert T. Hemophilia A induced by ipilimumab. N Engl J Med. 2011; 365(18):1747-8. Epub 2011/11/04. doi: 10.1056/NEJMc1110923. PubMed PMID: 22047582. 18. Fadel F, El Karoui K, Knebelmann B. Anti-CTLA4 antibody-induced lupus nephritis. N Engl J Med. 2009; 361(2):211-2. Epub 2009/07/10. doi: 10.1056/NEJMc0904283. PubMed PMID: 19587352. 19. Kocak E, Lute K, Chang X, May K F, Jr., Exten K R, Zhang H, et al. Combination therapy with anti-CTL antigen-4 and anti-4-1BB antibodies enhances cancer immunity and reduces autoimmunity. Cancer Res. 2006; 66(14):7276-84. Epub 2006/07/20. doi: 10.1158/0008-5472.CAN-05-2128. PubMed PMID: 16849577. 20. Lute K D, May K F, Lu P, Zhang H, Kocak E, Mosinger B, et al. Human CTLA4-knock-in mice unravel the quantitative link between tumor immunity and autoimmunity induced by anti-CTLA4 antibodies. Blood. 2005. PubMed PMID: 16037385. 21. May K F, Roychowdhury S, Bhatt D, Kocak E, Bai X F, Liu J Q, et al. Anti-human CTLA4 monoclonal antibody promotes T cell expansion and immunity in a hu-PBL-SCID model: a new method for preclinical screening of costimulatory monoclonal antibodies. Blood. 2005; 105:1114-20. PubMed PMID: 15486062. 22. Shields R L, Namenuk A K, Hong K, Meng Y G, Rae J, Briggs J, et al. High resolution mapping of the binding site on human IgG1 for Fc gamma RI, Fc gamma RII, Fc gamma RIII, and FcRn and design of IgG1 variants with improved binding to the Fc gamma R. J Biol Chem. 2001; 276(9):6591-604. Epub 2000/11/30. doi: 10.1074/jbc.M009483200. PubMed PMID: 11096108. 23. Dall'Acqua W F, Woods R M, Ward E S, Palaszynski S R, Patel N K, Brewah Y A, et al. Increasing the affinity of a human IgG1 for the neonatal Fc receptor: biological consequences. J Immunol. 2002; 169(9):5171-80. Epub 2002/10/23. PubMed PMID: 12391234. 24. Gao S H, Huang K, Tu H, Adler A S. Monoclonal antibody humanness score and its applications. BMC biotechnology. 2013; 13:55. Epub 2013 Jul. 6. doi: 10.1186/1472-6750-13-55. PubMed PMID: 23826749; PubMed Central PMCID: PMC3729710. 25. Sun Y, Chen H M, Subudhi S K, et al. Costimulatory molecule-targeted antibody therapy of a spontaneous autoimmune disease. Nat Med 2002.8: 1405-13 26. Foell J, Strahotin S, O'Neil S P, et al. CD137 costimulatory T cell receptor engagement reverses acute disease in lupus-prone NZB×NZW F1 mice. J Clin Invest 2003.111: 1505-18 27. Melero I, Shuford W W, Newby S A, et al. Monoclonal antibodies against the 4-1BB T-cell activation molecule eradicate established tumors. Nat Med 1997.3: 682-5 28. May K F, Jr., Chen L, Zheng P and Liu Y Anti-4-1BB monoclonal antibody enhances rejection of large tumor burden by promoting survival but not clonal expansion of tumor-specific CD8+ T cells. Cancer Res 2002.62: 3459-65 29. Ye Z, Hellstrom I, Hayden-Ledbetter M, et al. Gene therapy for cancer using single-chain Fv fragments specific for 4-1BB. Nat Med 2002.8: 343-8 30. Walunas, T. L., et al., CTLA4 can function as a negative regulator of T cell activation. Immunity, 1994. 1(5): p. 405-13. 31. Krummel, M. F. and J.P. Allison, CD28 and CTLA4 have opposing effects on the response of T cells to stimulation. J Exp Med, 1995. 182(2): p. 459-65. 32. Anderson, D. E., et al., Paradoxical inhibition of T-cell function in response to CTLA4 blockade; heterogeneity within the human T-cell population. Nat Med, 2000. 6(2): p. 211-4. 33. Coyle, A. J. et al. (2001) “The Expanding B7 Superfamily: Increasing Complexity In Costimulatory Signals Regulating T Cell Function,” Nature Immunol. 2(3):203-209. 34. Sharpe, A. H. et al. (2002) “The B7-CD28 Superfamily,” Nature Rev. Immunol. 2:116-126. 35. Collins, M. et al. (2005) “The B7 Family Of Immune-Regulatory Ligands,” Genome Biol. 6:223.1-223.7. 36. Flajnik, M. F. et al. (2012) “Evolution Of The B7 Family: Co-Evolution Of B7H6 And Nkp30, Identification Of A New B7 Family Member, B7H7, And Of B7's Historical Relationship With The MHC,” Immunogenetics epub doi.org/10.1007/s00251-012-0616-2. 37. Martin-Orozco, N. et al. (2007) “Inhibitory Costimulation And Anti-Tumor Immunity,” Semin. Cancer Biol. 17(4):288-298. 38. Flies, D. B. et al. (2007) “The New B7s: Playing a Pivotal Role in Tumor Immunity,” J. Immunother. 30(3):251-260 39. Ishida, Y. et al. (1992) “Induced Expression Of PD-1, A Novel Member Of The Immunoglobulin Gene Superfamily, Upon Programmed Cell Death,” EMBO J. 11:3887-3895. 40. Agata, Y. et al. (1996) “Expression Of The PD-1 Antigen On The Surface Of Stimulated Mouse T And B Lymphocytes,” Int. Immunol. 8(5):765-772. 41. Yamazaki, T. et al. (2002) “Expression Of Programmed Death 1 Ligands By Murine T Cells And APC,” J. Immunol. 169:5538-5545. 42. Nishimura, H. et al. (2000) “Facilitation Of Beta Selection And Modification Of Positive Selection In The Thymus Of PD-1-Deficient Mice,” J. Exp. Med. 191:891-898. 43. Martin-Orozco, N. et al. (2007) “Inhibitory Costimulation And Anti-Tumor Immunity,” Semin. Cancer Biol. 17(4):288-298. 44. Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). 45 Chothia and Lesk, 1987, J. Mol. Biol. 196:901-917. 46. Padlan, 1991, Molecular Immunology 28(4/5):489-498. 47. Studnicka et al., 1994, Protein Engineering 7:805. 48. Roguska et al., 1994, Proc. Natl. Acad. Sci. USA 91:969 49. Keler, T. et al. Activity and safety of CTLA4 blockade combined with vaccines in cynomolgus macaques. J. Immunol. 171, 6251-6259 (2003). 50. Wing, K. et al. CTLA4 control over Foxp3+ regulatory T cell function. Science 322, 271-275, doi:10.1126/science. 1160062 (2008). 51. Schwartz, R. S. The new immunology—the end of immunosuppressive drug therapy? N. Engl. J. Med. 340, 1754-1756, doi:10.1056/NEJM199906033402209 (1999). 52. Simpson, T. R. et al. Fc-dependent depletion of tumor-infiltrating regulatory T cells co-defines the efficacy of anti-CTLA4 therapy against melanoma. J. Exp. Med. 210, 1695-1710, doi: 10.1084/jem.20130579 (2013). 53. Selby, M. J. et al. Anti-CTLA-4 antibodies of IgG2a isotype enhance antitumor activity through reduction of intratumoral regulatory T cells. Cancer immunology research 1, 32-42, doi:10.1158/2326-6066.CIR-13-0013 (2013). 54. Maker, A. V., Attia, P. & Rosenberg, S. A. Analysis of the cellular mechanism of antitumor responses and autoimmunity in patients treated with CTLA4 blockade. J. Immunol. 175, 7746-7754 (2005). 55. Korman, A. J., Peggs, K. S. & Allison, J. P. Checkpoint blockade in cancer immunotherapy. Adv. Immunol. 90, 297-339, doi: 10.1016/S0065-2776(06)90008-X (2006). 56. Ribas, A. et al. Tremelimumab (CP-675,206), a cytotoxic T lymphocyte associated antigen 4 blocking monoclonal antibody in clinical development for patients with cancer. Oncologist 12, 873-883, doi:10.1634/theoncologist. 12-7-873 (2007). 57. Ribas, A. et al. Phase III randomized clinical trial comparing tremelimumab with standard-of-care chemotherapy in patients with advanced melanoma. J. Clin. Oncol. 31, 616-622, doi:10.1200/JCO.2012.44.6112 (2013). 58. Lee, K. M. et al. Molecular basis of T cell inactivation by CTLA4 [In Process Citation]. Science 282, 2263-2266 (1998). 59. Marengere, L. E. et al. Regulation of T cell receptor signaling by tyrosine phosphatase SYP association with CTLA4 [published errata appear in Science 1996 Dec. 6; 274(5293)1597 and 1997 Apr. 4; 276(5309):21]. Science 272, 1170-1173 (1996). 60. Liu, Y. Is CTLA4 a negative regulator for T-cell activation? Immunol. Today 18, 569-572 (1997). 61. Tivol, E. A. et al. Loss of CTLA4 leads to massive lymphoproliferation and fatal multiorgan tissue destruction, revealing a critical negative regulatory role of CTLA4. Immunity 3, 541-547 (1995). 62. Waterhouse, P. et al. Lymphoproliferative disorders with early lethality in mice deficient in CTLA4 [see comments]. Science 270, 985-988 (1995). 63. Bachmann, M. F., Kohler, G., Ecabert, B., Mak, T. W. & Kopf, M. Cutting edge: lymphoproliferative disease in the absence of CTLA4 is not T cell autonomous. J. Immunol. 163, 1128-1131 (1999). 64. Bachmann, M. F. et al. Normal pathogen-specific immune responses mounted by CTLA4-deficient T cells: a paradigm reconsidered. Eur. J. Immunol. 31, 450-458 (2001). 65. Nguyen, T. V., Ke, Y., Zhang, E. E. & Feng, G. S. Conditional deletion of Shp2 tyrosine phosphatase in thymocytes suppresses both pre-TCR and TCR signals. J. Immunol. 177, 5990-5996 (2006). 66. Qureshi, O. S. et al. Trans-endocytosis of CD80 and CD86: a molecular basis for the cell-extrinsic function of CTLA-4. Science 332, 600-603, doi:10.1126/science.1202947 (2011). 67. Ueda, H. et al. Association of the T-cell regulatory gene CTLA4 with susceptibility to autoimmune disease. Nature 423, 506-511 (2003). 68. Magistrelli, G. et al. A soluble form of CTLA-4 generated by alternative splicing is expressed by nonstimulated human T cells. Eur. J. Immunol. 29, 3596-3602, doi:10.1002/(SICI)1521-4141(199911)29:11 < 3596::AID-1MMU3596> 3.0.CO;2-Y (1999). 69. Kremer, J. M. et al. Treatment of rheumatoid arthritis by selective inhibition of T-cell activation with fusion protein CTLA4Ig. N. Engl. J. Med. 349, 1907-1915, doi: 10.1056/NEJMoa035075 (2003). 70. Abrams, J. R. et al. CTLA4Ig-mediated blockade of T-cell costimulation in patients with psoriasis vulgaris. J. Clin. Invest. 103, 1243-1252, doi:10.1172/JC15857 (1999). 71. Gerold, K. D. et al. The soluble CTLA-4 splice variant protects from type 1 diabetes and potentiates regulatory T-cell function. Diabetes 60, 1955-1963, doi:10.2337/db11-0130 (2011). 72. Peach R J, Bajorath J, Brady W, Leytze G, Greene J, Naemura J, et al. Complementarity determining region 1 (CDR1)- and CDR3-analogous regions in CTLA-4 and CD28 determine the binding to B7-1. J Exp Med. 1994; 180(6):2049-58. 73. van Elsas, A., Hurwitz, A. A. & Allison, J. P. Combination immunotherapy of B16 melanoma using anti-cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) and granulocyte/macrophage colony-stimulating factor (GM-CSF)-producing vaccines induces rejection of subcutaneous and metastatic tumors accompanied by autoimmune depigmentation. J. Exp. Med. 190, 355-366 (1999). 74. van Elsas, A. et al. Elucidating the autoimmune and antitumor effector mechanisms of a treatment based on cytotoxic T lymphocyte antigen-4 blockade in combination with a B16 melanoma vaccine: comparison of prophylaxis and therapy. J. Exp. Med. 194, 481-489. (2001). 75. Karandikar, N. J., Vanderlugt, C. L., Walunas, T. L., Miller, S. D. & Bluestone, J. A. CTLA-4: a negative regulator of autoimmune disease. J. Exp. Med. 184, 783-788 (1996). 76. Luhder, F., Chambers, C., Allison, J. P., Benoist, C. & Mathis, D. Pinpointing when T cell costimulatory receptor CTLA-4 must be engaged to dampen diabetogenic T cells. Proc. Natl. Acad. Sci. U.S.A 97, 12204-12209 (2000). 77. Hurwitz, A. A., Sullivan, T. J., Sobel, R. A. & Allison, J. P. Cytotoxic T lymphocyte antigen-4 (CTLA-4) limits the expansion of encephalitogenic T cells in experimental autoimmune encephalomyelitis (EAE)-resistant BALB/c mice. Proc. Natl. Acad. Sci. U.S.A. 99, 3013-3017 (2002). 78. Piganelli, J. D., Poulin, M., Martin, T., Allison, J. P. & Haskins, K. Cytotoxic T lymphocyte antigen 4 (CD152) regulates self-reactive T cells in BALB/c but not in the autoimmune NOD mouse. J. Autoimmun. 14, 123-131 (2000). 79. Phan, G. Q. et al. Cancer regression and autoimmunity induced by cytotoxic T lymphocyte-associated antigen-4 blockade in patients with metastatic melanoma. Proc Natl Acad Sci U.S.A. 100, 8372-8377 (2003). 80. Eisenthal, A. et al. Antitumor effects of recombinant interleukin-6 expressed in eukaryotic cells. Cancer Immunol. Immunother. 36, 101-107 (1993). 81. Schroff, R. W., Foon, K. A., Beatty, S. M., Oldham, R. K. & Morgan, A. C., Jr. Human anti-murine immunoglobulin responses in patients receiving monoclonal antibody therapy. Cancer Res. 45, 879-885 (1985). 82. Kearney, E. R. et al. Antigen-dependent clonal expansion of a trace population of antigen-specific CD4+ T cells in vivo is dependent on CD28 costimulation and inhibited by CTLA-4. J. Immunol. 155, 1032-1036 (1995). 83. Mittler, R. S., Bailey, T. S., Klussman, K., Trailsmith, M. D. & Hoffmann, M. K. Anti-4-1BB monoclonal antibodies abrogate T cell-dependent humoral immune responses in vivo through the induction of helper T cell anergy. J. Exp. Med. 190, 1535-1540 (1999).