CARBONYL REDUCTASE MUTANT AND ITS APPLICATION
20250145970 ยท 2025-05-08
Inventors
- Xiuzhen Gao (Zibo, CN)
- Qinyuan Ma (Zibo, CN)
- Yanmiao Yin (Zibo, CN)
- Yanling Zhao (Zibo, CN)
- Zhixin Ma (Zibo, CN)
- Tong Zhang (Zibo, CN)
Cpc classification
International classification
Abstract
The present disclosure relates to the technical field of biotechnology, in particular to carbonyl reductase mutant and its application. Specifically, the present disclosure provides a carbonyl reductase mutant for catalyzing the preparation of (R)-8-chloro-6-hydroxyoctanoic acid ethyl ester from 8-chloro-6-oxooctanoic acid ethyl ester. The mutant protein is a non natural protein and undergoes mutations in three core amino acids related to enzyme catalytic activity in the initial carbonyl reductase. The advantageous effect of the present disclosure is that the carbonyl reductase mutant provided by the present disclosure has the characteristic of efficiently catalyzing the preparation of the precursor substance (R)-8-chloro-6-hydroxyoctanoic acid from 8-chloro-6-oxooctanoic acid ethyl ester, and can efficiently catalyze the oxidation-reduction reaction of 8-chloro-6-oxooctanoic acid, with a product space-time yield of 99.9 g.Math.L1.Math.h1 or more.
Claims
1. A carbonyl reductase mutant, characterized in that an amino acid sequence of protein of the carbonyl reductase mutant is selected from one of the following sequences: (1) as shown in SEQ ID NO: 3; (2) as shown in SEQ ID NO: 5.
2. A gene encoding the carbonyl reductase mutant according to claim 1.
3. The gene according to claim 2, wherein a nucleotide sequence of the gene is as shown in SEQ ID NO: 4 and SEQ ID NO: 6.
4. A gene expression cassette, a vector, or a recombinant bacterium containing the gene as claimed in claim 2.
5. A preparation method of the carbonyl reductase mutant according to claim 1, comprising following steps: synthesizing a coding gene of an initial carbonyl reductase, conducting site directed mutagenesis of the coding gene of the initial carbonyl reductase, constructing an expression vector, transforming a protein expression host bacterium, and inducing protein expression.
6. The method according to claim 5, wherein the nucleotide sequence of the coding gene of the carbonyl reductase mutant is shown in SEQ ID NO: 4 and SEQ ID: 6.
7. An application of the carbonyl reductase mutant according to claim 1 in a reaction of 8-chloro-6-oxooctanoic acid ethyl ester, wherein the carbonyl reductase mutant is used to catalyze the reaction using 8-chloro-6-oxooctanoic acid ethyl ester as a substrate to synthesize a lipoic acid precursor of (R)-8-chloro-6-hydroxyoctanoic acid ethyl ester.
8. A catalyst, wherein an active ingredient of the catalyst comprises the carbonyl reductase mutant according to claim 1.
9. The application of the catalyst as claimed in claim 8 in the reaction of 8-chloro-6-oxooctanoic acid ethyl ester, wherein the catalyst is used to catalyze the reaction using 8-chloro-6-oxooctanoic acid ethyl ester as a substrate to synthesize a lipoic acid precursor of (R)-8-chloro-6-hydroxyoctanoic acid ethyl ester.
10. The application according to any one of claim 7, wherein a catalytic reaction is carried out using the 8-chloro-6-oxooctanoic acid ethyl ester as the substrate to synthesize the lipoic acid precursor of (R)-8-chloro-6-hydroxyoctanoic acid ethyl ester, and the catalytic reaction is carried out under conditions of 25-30 C., pH=7.0-7.5, and a concentration of the 8-chloro-6-oxooctanoic acid ethyl ester of 33.3 g/L.
11. The application according to any one of claim 9, wherein a catalytic reaction is carried out using the 8-chloro-6-oxooctanoic acid ethyl ester as the substrate to synthesize the lipoic acid precursor of (R)-8-chloro-6-hydroxyoctanoic acid ethyl ester, and the catalytic reaction is carried out under conditions of 25-30 C., pH=7.0-7.5, and a concentration of the 8-chloro-6-oxooctanoic acid ethyl ester of 33.3 g/L.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION OF THE EMBODIMENTS
[0028] In order to enable skilled person in the art to better understand the present disclosure, the present disclosure will be further elaborated in conjunction with specific embodiments.
[0029] The present disclosure will be further described in conjunction with specific embodiments. It should be noted that the following embodiments are only for explanation and illustration, and do not limit the scope of the present disclosure in any way.
[0030] Main reagents and consumable materials: PhantaMax Super-Fidelity DNA polymerase P505 was purchased from Nanjing Vazyme Biotech Co., Ltd.; FastDigest DpnI DNA endonuclease (item number: FD1703) was purchased from Thermo Fisher Scientific; The pET28 (a) plasmid is a known E. coli expression vector with a size of 5369 bp, T7 promoter, vector labels N-6His and C-6His, and resistance to Kanamycin, which were purchased from Novogen; E. coli DH5 competent cells (item number: G6016), E. coli Rosetta (DE3) competent cells (item number: G6031), and E. coli Overexpress C43 (DE3) competent cells (item number: X17016) were all purchased from Angyu Biotechnology Co., Ltd; Agar powder (item number: A8190), purchased from Solarbio; TRYPTONE (item number: LP0042) and YEAST EXTRACT (item number: LP0021) were both purchased from OXOID; and reagents such as NaCl (item number: 10019318), K.sub.2HPO.sub.4.Math.3H.sub.2O (item number: 10017518), KH.sub.2PO.sub.4 (item number: 10017618), and glycerol (item number: 10010618) were purchased from Sinopharm Chemical Reagent Co., Ltd.
LB Medium
[0031] Each 100 mL LB medium contains: 1 g tryptone, 0.5 g yeast extract, and 1 g NaCl, pH=7.0-7.2.
[0032] Preparation method: Dissolve 10 g of tryptone, 5 g of yeast extract, and 10 g of NaCl in 1 L of distilled water without adjusting the pH value; perform sterilization with high-pressure steam at 121 C. for 20 minutes. If preparing solid culture medium, add 1.8 g of agar powder to 100 mL culture medium.
[0033] Unless otherwise specified, the reagents used in the following embodiments are conventional reagents in this field, which can be purchased commercially or prepared according to conventional methods in this field, and the specifications are LR (Laboratory reagent). Unless otherwise specified, the methods used in the following embodiments are conventional methods in this field, and the experimental conditions used are routine in this field and can be referred to the relevant laboratory manuals or manufacturer's instructions.
Embodiment 1, Preparation of Carbonyl Reductase Mutant
1. Design of Carbonyl Reductase Mutant
[0034] Through gene mining, the carbonyl reductase gene with Genbank ID XP_003867714.1 was screened from the NCBI database. The open reading frame of this gene is 1005 bp long, the carbonyl reductase encoded by it consists of 334 amino acids, and its amino acid sequence (334aa) is:
TABLE-US-00001 (SEQIDNO:1) MPVFISGATGFIAQHVIKELLNDGFQVIGSVRSKAKGEYLSSLIKSKKF SYAVVPDIVATGAFDQVLQENQDIDSFIHTASPVDFQVSDVQTGLLDPA IEGTKNVLIAIEKYGKNVKNVVVTSSTSAVRDSSGSRPSNSLLTEASWN EITLEQGLKSARLGYSAAKTFAEKEVWKFAAEHNGTFNITTVNPTYVFG PQAFEVQNKSQLNDSAEYVNNIFKLKPNDDIPMFVGLFIDVRDVAKAHV AAIKKPKEFNGQRLVLINSAWTNELLAVIINKHFPNVDIPKGNIEKSDE ELKKADLKWDNSKTKKLLGYSFIPIEKSVVDAVQQLLDTE.
[0035] The nucleotide sequence encoding the carbonyl reductase is:
TABLE-US-00002 (SEQIDNO:2) atgccggttttcatcagcggcgcgaccggtttcatcgcgcagcacgtta tcaaagaactgctgaacgatggtttccaggttatcggtagcgttcgttc taaagcgaaaggcgaatacctgagcagcctgatcaaatctaaaaaattc tcttacgcggttgttccggatatcgttgcgaccggcgcgttcgatcagg ttctgcaggaaaaccaggatatcgatagcttcatccacaccgcttctcc ggttgatttccaggttagcgatgttcagaccggtctgctggatccggcg atcgaaggtaccaaaaacgttctgatcgcgatcgaaaaatacggtaaaa acgttaaaaacgttgttgttacctcttccaccagcgcggttcgtgacag cagcggtagccgtccgtctaacagcctgctgaccgaagcgagctggaac gaaatcaccctggaacagggtctgaaatctgcgcgtctgggctacagcg cggcgaaaaccttcgcagaaaaagaagtgtggaaattcgcggcggaaca caacggcaccttcaacatcaccaccgttaacccgacctacgttttcggt ccgcaggcgttcgaagttcagaacaaaagccagctgaacgattctgctg aatacgttaacaacatcttcaaactgaaaccgaacgatgatatcccgat gttcgttggcctgttcatcgatgtgcgtgatgttgcgaaagcgcacgtt gcggcgatcaaaaaaccgaaagaatttaacggccagcgtctggtgctga tcaacagcgcatggaccaacgaactgctggcggttatcatcaacaaaca cttcccgaacgttgatatcccgaaaggcaacatcgaaaaaagcgatgaa gaactgaaaaaagcggatctgaaatgggataactctaaaaccaaaaaac tgctgggctacagcttcatcccgatcgaaaaaagcgtggttgatgcggt tcagcagctgctggataccgaataa.
[0036] The present disclosure analyzes the protein three-dimensional structure of the carbonyl reductase and determines that the key factor affecting the enzymatic properties of the initial carbonyl reductase is substrate channel steric hindrance. By selecting mutation sites at the entrance and channel inside of substrate channel, the key roles of R129, D210, and S126 sites were determined using an iterative saturation mutagenesis, wherein R129L/D210T and R129L/D210T/S126A mutants show good catalytic performance and enzyme activity.
[0037] The nucleotide sequence corresponding to R129 is codons 385-387, the nucleotide sequence corresponding to D210 is codons 628-630, and The nucleotide sequence corresponding to S126 is codons 376-378.
[0038] The double mutation R129L/D210T changed the codons 385-387 of the carbonyl reductase gene sequence from CGT to CTG, thereby replacing the 129th position of the amino acid sequence from arginine (R) to leucine (L); changed the codons 628-630th position from GAT to ACC, thereby the 210th position of the amino acid sequence from aspartic acid (D) to threonine (T), to obtain an enzyme mutant, wherein its amino acid sequence is shown in SEQ ID NO: 3, and the nucleotide sequence of the coding gene is shown in SEQ ID NO: 4.
[0039] While the triple mutation changed from AGC to GCG at codons 376-378 of the carbonyl reductase double mutant gene sequence, thereby replacing serine(S) with alanine (A) at position 126 of the amino acid sequence, to obtain a triple mutant, wherein its amino acid sequence is shown in SEQ ID NO: 5, and the nucleotide sequence of the coding gene is shown in SEQ ID NO: 6.
TABLE-US-00003 (SEQIDNO:3) MPVFISGATGFIAQHVIKELLNDGFQVIGSVRSKAKGEYLSSLIKSKKF SYAVVPDIVATGAFDQVLQENQDIDSFIHTASPVDFQVSDVQTGLLDPA IEGTKNVLIAIEKYGKNVKNVVVTSSTSAVLDSSGSRPSNSLLTEASWN EITLEQGLKSARLGYSAAKTFAEKEVWKFAAEHNGTFNITTVNPTYVFG PQAFEVQNKSQLNTSAEYVNNIFKLKPNDDIPMFVGLFIDVRDVAKAHV AAIKKPKEFNGQRLVLINSAWTNELLAVIINKHFPNVDIPKGNIEKSDE ELKKADLKWDNSKTKKLLGYSFIPIEKSVVDAVQQLLDTE. (SEQIDNO:4) atgccggttttcatcagcggcgcgaccggtttcatcgcgcagcacgtta tcaaagaactgctgaacgatggtttccaggttatcggtagcgttcgttc taaagcgaaaggcgaatacctgagcagcctgatcaaatctaaaaaattc tcttacgcggttgttccggatatcgttgcgaccggcgcgttcgatcagg ttctgcaggaaaaccaggatatcgatagcttcatccacaccgcttctcc ggttgatttccaggttagcgatgttcagaccggtctgctggatccggcg atcgaaggtaccaaaaacgttctgatcgcgatcgaaaaatacggtaaaa acgttaaaaacgttgttgttacctcttccaccagcgcggttctggacag cagcggtagccgtccgtctaacagcctgctgaccgaagcgagctggaac gaaatcaccctggaacagggtctgaaatctgcgcgtctgggctacagcg cggcgaaaaccttcgcagaaaaagaagtgtggaaattcgcggcggaaca caacggcaccttcaacatcaccaccgttaacccgacctacgttttcggt ccgcaggcgttcgaagttcagaacaaaagccagctgaacacctctgctg aatacgttaacaacatcttcaaactgaaaccgaacgatgatatcccgat gttcgttggcctgttcatcgatgtgcgtgatgttgcgaaagcgcacgtt gcggcgatcaaaaaaccgaaagaatttaacggccagcgtctggtgctga tcaacagcgcatggaccaacgaactgctggcggttatcatcaacaaaca cttcccgaacgttgatatcccgaaaggcaacatcgaaaaaagcgatgaa gaactgaaaaaagcggatctgaaatgggataactctaaaaccaaaaaac tgctgggctacagcttcatcccgatcgaaaaaagcgtggttgatgcggt tcagcagctgctggataccgaataa. (SEQIDNO:5) MPVFISGATGFIAQHVIKELLNDGFQVIGSVRSKAKGEYLSSLIKSKKF SYAVVPDIVATGAFDQVLQENQDIDSFIHTASPVDFQVSDVQTGLLDPA IEGTKNVLIAIEKYGKNVKNVVVTSSTAAVLDSSGSRPSNSLLTEASWN EITLEQGLKSARLGYSAAKTFAEKEVWKFAAEHNGTFNITTVNPTYVFG PQAFEVQNKSQLNTSAEYVNNIFKLKPNDDIPMFVGLFIDVRDVAKAHV AAIKKPKEFNGQRLVLINSAWTNELLAVIINKHFPNVDIPKGNIEKSDE ELKKADLKWDNSKTKKLLGYSFIPIEKSVVDAVQQLLDTE. (SEQIDNO:6) atgccggttttcatcagcggcgcgaccggtttcatcgcgcagcacgtta tcaaagaactgctgaacgatggtttccaggttatcggtagcgttcgttc taaagcgaaaggcgaatacctgagcagcctgatcaaatctaaaaaattc tcttacgcggttgttccggatatcgttgcgaccggcgcgttcgatcagg ttctgcaggaaaaccaggatatcgatagcttcatccacaccgcttctcc ggttgatttccaggttagcgatgttcagaccggtctgctggatccggcg atcgaaggtaccaaaaacgttctgatcgcgatcgaaaaatacggtaaaa acgttaaaaacgttgttgttacctcttccaccgcggcggttctggacag cagcggtagccgtccgtctaacagcctgctgaccgaagcgagctggaac gaaatcaccctggaacagggtctgaaatctgcgcgtctgggctacagcg cggcgaaaaccttcgcagaaaaagaagtgtggaaattcgcggcggaaca caacggcaccttcaacatcaccaccgttaacccgacctacgttttcggt ccgcaggcgttcgaagttcagaacaaaagccagctgaacacctctgctg aatacgttaacaacatcttcaaactgaaaccgaacgatgatatcccgat gttcgttggcctgttcatcgatgtgcgtgatgttgcgaaagcgcacgtt gcggcgatcaaaaaaccgaaagaatttaacggccagcgtctggtgctga tcaacagcgcatggaccaacgaactgctggggttatcatcaacaaacac ttcccgaacgttgatatcccgaaaggcaacatcgaaaaaagcgatgaag aactgaaaaaagcggatctgaaatgggataactctaaaaccaaaaaact gctgggctacagcttcatcccgatcgaaaaaagcgtggttgatgcggtt cagcagctgctggataccgaataa.
2. Obtainment of Carbonyl Reductase Mutant Gene
[0040] The carbonyl reductase mutant gene can be obtained through whole gene synthesis or molecular cloning methods. This experiment used whole gene synthesis method to obtain the carbonyl reductase gene with Genbank ID XP_003867714.1, and PCR method to obtain the carbonyl reductase mutant gene.
1. Whole Gene Synthesis of Initial Carbonyl Reductase
[0041] Whole gene synthesis was performed on carbonyl reductase with Genbank ID XP_003867714.1, and the synthesized gene fragment was ligated into the pET28A (+) plasmid. Sangon Biotech (Shanghai) Co., Ltd. was trusted to synthesize the above-mentioned genes.
2. Site Directed Mutagenesis of Carbonyl Reductase
(1) Primer Design for Site Directed Mutagenesis
TABLE-US-00004 TABLE1 MutantPrimerDesign Sequence Primer name Sequence(5-3) Template R129L-F SEQIDNO:7 tccaccagcgcggttctggacagcagcggt CoCR13 R129L-R SEQIDNO:8 gctaccgctgctgtccagaaccgcgctggt D210T-F SEQIDNO:9 aaaagccagctgaacacctctgctgaatac R129L D210T-R SEQID aacgtattcagcagaggtgttcagctggct NO:10 S126A-F SEQID gttacctcttccaccgcggcggttctggac R129L/D210T NO:11 S126A-R SEQID gctgtccagaaccgccgcggtggaagaggt NO:12
(2) Site Directed Mutagenesis of Carbonyl Reductase
[0042] Using the pET28A (+) plasmid containing the initial carbonyl reductase gene as a template, the carbonyl reductase mutant gene was amplified using the upstream and downstream primers obtained in step (1) according to the following PCR system and procedure.
[0043] The PCR system: PhantaMax Super-Fidelity DNA polymerase P505 0.5 L, template plasmid 0.6 L, upstream primer-F (10 M) 1 L, downstream primer-R (10 M) 1 L, 2PCR Buffer 12.5 L, dNTP mix 0.5 L, and ddH.sub.2O 8.9 L.
[0044] The PCR procedure is as follows: a. perform pre-denaturation at 95 C. for 5 minutes; b. perform denaturation at 95 C. for 30 seconds, anneal at 55 C. for 30 seconds, extend at 72 C. for 3.75 minutes, 20 cycles; c. extend at 72 C. for 10 minutes, cool down to 4 C., use DpnI enzyme to digest the template plasmid containing the initial carbonyl reductase gene at 37 C. for 30 minutes.
(3) Transformation of DH5 Competent Cell
[0045] Transform the digestion product of pET28A (+) plasmid containing carbonyl reductase mutant obtained in step (2) into DH5 competent cells.
[0046] Place DH5 competent cells on ice, wait for the cells to melt, add 15 L plasmid solution, let it sit on ice for 30 minutes; heat shock at 42 C. for 45 seconds, then let it stand on ice for 2 minutes; add 700 L sterile LB liquid medium, culture at 37 C. and 200 rpm in a shaker for 1 hour, centrifuge at 4000 rpm for 1 minute, and leave 200 L supernatant; mix the precipitated bacterial cells with the supernatant, then coat them all onto LB plate medium containing Kana resistance (50 g/mL), and then inverted and culture overnight at 37 C.
(4) Positive Clone Screening
[0047] Select single colony from LB agar plates and inoculate them into LB liquid medium containing Kana resistance (50 g/mL), incubate overnight at 37 C. and 200 rpm on a shaker; after preservation (sterile glycerol final concentration of 15%), send them to GENEWIZ (Suzhou, China) company for sequencing to identify whether the initial carbonyl reductase mutation is successful. The plasmid is required to return from the company when the sequencing is successful.
3. Heterologous Expression of Carbonyl Reductase Mutant 6His Fusion Protein
(1) Protein Expression Competent Cells Transformation
[0048] Take out Overexpress C43 (DE3) competent cells from a 80 C. ultra-low temperature refrigerator, place them on ice, and add 1 L of pET28A (+) plasmid containing carbonyl reductase mutant to each competent cell after the cells melt, place them on ice for 30 minutes, heat shock at 42 C. for 45 seconds, then place them on ice for 2 minutes, add 700 L sterile LB liquid culture medium, culture at 37 C. and 200 rpm for 1 hour in a shaker, take 200 L of cultured bacterial solution, apply it to LB plate medium containing Kana resistance (50 g/mL), and inverted and culture overnight at 37 C.
(2) Preservation of Carbonyl Reductase Mutant Expression Strain
[0049] Select single colony from LB plate and inoculate them into test tubes of LB liquid medium containing Kana resistant (50 g/mL), incubate overnight at 37 C. and 200 rpm on a shaker as an expression strain for carbonyl reductase mutants; add sterile glycerol with a final volume concentration of 15% to the bacterial solution and store it in a 80 C. ultra-low temperature freezer for long term preservation.
(3) Protein Expression
[0050] Transfer the overnight cultured test tube bacterial solution into 50 mL of sterile LB liquid culture medium (inoculation volume of 1%), with a final concentration of kanamycin of 50 g/mL, cultured at 37 C. and 200 rpm for about 2.5 hours. When OD.sub.600=0.6-0.8, add sterile IPTG with a final concentration of 0.1 mM, induce and culture at 28 C. and 200 rpm for 6 hours, then centrifuge at 8000rpm for 10 minutes, and collect the bacterial cells.
Embodiment 2, Determination of Enzyme Activity and Kinetic Parameters of Carbonyl Reductase CoCR 13 and its Mutants
(1) Enzyme Activity Assay
[0051] The carbonyl reductase enzyme activity assay system is as follows: 150 L PB buffer (100 mM, pH 7.0), 10 L NADPH (0.25 g/L), 20 L 8-chloro-6-oxooctanoic acid ethyl ester (2.5 mM, dissolved in DMF), 20 L purified mutant enzyme solution, and the mixed system is added to a 96-well plate; measure the decrease in light absorption value at 340 nm within 6 minutes at 30 C. using a microplate reader, and calculate the amount of NADPH consumed by the reaction based on the standard curve.
[0052] One enzyme activity unit U is defined as the amount of enzyme required to consume 1 mol NADPH within 1 minute.
(3) Kinetic Parameters
[0053] The substrate concentration was set to be 0.1-10 mM, and the rest was the same enzyme activity determination system and reaction conditions as described above.
[0054] Conclusion: The carbonyl reductase mutants with amino acid sequences such as SEQIDNO: 3 and SEQIDNO: 5 exhibit higher catalytic reduction activity and efficiency towards 8-chloro-6-oxooctanoic acid ethyl ester compared to the wild-type carbonyl reductase.
TABLE-US-00005 TABLE 2 Enzyme activity and kinetic parameters of initial carbonyl reductase and its mutants Specific Number of Michaelis Catalytic Relative activity conversions constant efficiency catalytic Mutant (U/mg) (s.sup.1) (mM) (mM.sup.1 .Math. s.sup.1) efficiency WT 1.36 0.05 4.7 0.33 5.12 0.87 0.92 1.00 R129L/D210T 45.41 2.7 50.60 1.49 1.74 0.16 29.12 31.65 R129L/D210T/ 93.60 1.49 69.46 2.50 0.81 0.11 85.95 93.42 S126A
Embodiment 3, Determination of Optimal Temperature and pH for Carbonyl Reductase CoCR 13 and its Mutants R129L/D210T/S126A
(1) Optimal Temperature
[0055] In the enzyme activity measurement system of Embodiment 2, except for pure enzyme solution, all other ingredients were incubated at the following temperatures (20 C.-50 C.) for 10 minutes and the enzyme activity was measured at the same temperature using a microplate reader. The enzyme activity was determined at different temperatures using the enzyme activity at 30 C. as the standard of 100%.
[0056] The optimal temperature for the wild-type is 30 C., while the optimal temperature for the three mutants R129L/D210T/S126A is 30 C.
(2) Optimal pH
[0057] In Embodiment 2, the buffer was replaced with citric acid-citrate buffer system (pH 4.0-6.0), phosphate buffer system (pH 6.0-8.0), and Tris-HCl buffer system (pH 8.0-9.0) to measure enzyme activity, with PB (pH 7.0) enzyme activity as the standard of 100%.
[0058] Result: The optimal pH for CoCR 13 is 7.0, and the optimal pH for R129L/D210T/S126A is 7.5.
Embodiment 4, Synthesis and Detection of 8-chloro-6-hydroxyoctanoic Acid ethyl ester using carbonyl reductase mutant
1. Synthesis of 8-chloro-6-hydroxyoctanoic acid ethyl ester
[0059] (1) 2 mL reaction system: Take 200 mM PB (pH 7.0), carbonyl reductase CoCR 13 or the double mutant R129L/D210T or triple mutant R129L/D210T/S126A 50 g/L from Embodiment 1, GDH 25 g/L stored in the laboratory, 150 mM 8-chloro-6-oxooctanoate acid ethyl ester, 225 mM glucose, 0.25 g/L NADP.sup.+, and 1.5% DMF into a 5 mL EP tube for reaction overnight at 30 C. and 250 rpm overnight; 2 mL of ethyl acetate was added to the reaction solution for full extraction, then centrifuge at 6000 rpm for 5 minutes to collect the supernatant for detection. [0060] (2) 50 mL reaction system: Take 200 mM PBS (pH 7.5), 20 g/L of carbonyl reductase mutant R129L/D210T/S126A from Embodiment 1, 10 g/L of GDH stored in the laboratory, 150 mM 8-chloro-6-oxooctanoic acid ethyl ester, 225 mM glucose, 0.1 g/L NADP.sup.+, and 1.5% DMF into a 250 mL reaction vessel for reaction at 30 C. and 500 rpm for 20 minutes. The reaction mixture was fully extracted with the same volume of ethyl acetate and centrifuged at 6000 rpm for 5 minutes to obtain the supernatant for detection.
2. Detection of 8-chloro-6-hydroxyoctanoate acid ethyl ester
[0061] Use GC to detect the content of 8-chloro-6-hydroxyoctanoic acid ethyl ester in the sample.
[0062] GC instrument model: Agilent 7890B.
[0063] Parameter setting: Chromatography column: DB-624UI (300.32 mm1.8 m); Maintain a column temperature of 200 C. for 5 minutes, then raise the temperature to 250 C. at a rate of 20 C./min and hold for 10 minutes; the temperature of injection port at 240 C.; constant pressure of 100 Kpa, split ratio of 25:1; FID: 260 C.
[0064] Determine the content of substrate 8-chloro-6-oxooctanoic acid ethyl ester and product 8-chloro-6-hydroxyoctanoic acid ethyl ester in the sample based on peak area. The gas chromatography results are shown in
[0065] In the chromatograms corresponding to
TABLE-US-00006 TABLE 3 Peak information of substrates and products corresponding to the chromatogram in FIG. 2 Retention Peak Peak Relative time width Peak area height peak Peak (min) Type (min) (mAu*min) (mAu) area (%) 1 5.272 BV 0.40 442.18 57.49 31.7 2 5.872 BV 0.74 13486.33 1922.89 96.83
TABLE-US-00007 TABLE 4 Peak information of substrates and products corresponding to the chromatogram in FIG. 3 retention peak peak relative time width peak area height peak peak (min) type (min) (mAu*min) (mAu) area (%) 1 7.784 BB 0.24 134.75 27.05 0.86 2 8.351 BV 0.56 15618.79 3369.68 99.14
TABLE-US-00008 TABLE 5 Peak information of substrates and products corresponding to the chromatogram in FIG. 4 retention peak peak relative time width peak area height peak peak (min) type (min) (mAu*min) (mAu) area (%) 1 7.851 MMm 0.04 6.06 1.72 0.89 2 8.277 MMm 0.09 670.73 106.23 99.11
[0066] Among them,
[0067]
[0068]
[0069] From
[0070] In addition, HPLC was used to detect the chiral configuration of 8-chloro-6-hydroxyoctanoic acid ethyl ester in the sample.
[0071] HPLC instrument model: Thermo Fisher u3000.
[0072] Parameter setting: Chromatography column: Daicel IA (2504.6 mm, 5 m); wavelength 210 nm; mobile phase: n-hexane: isopropanol-95:5; flow rate of 0.8 mL/min.
[0073] The content of different configurations of 8-chloro-6-hydroxyoctanoic acid ethyl ester in the sample was determined based on the peak area, and the high performance liquid chromatography results are shown in
[0074] The peak information of different configurations of 8-chloro-6-hydroxyoctanoic acid ethyl ester in the chromatograms corresponding to
TABLE-US-00009 TABLE 6 Peak information of substrates and products corresponding to chromatograms in FIG. 5 retention time peak area peak height relative peak peak (min) (mAu*min) (mAu) area (%) 1 14.177 108.308 172.786 99.94 2 15.985 0.064 0.215 0.06
TABLE-US-00010 TABLE 7 Peak information of substrates and products corresponding to chromatograms in FIG. 6 retention time peak area peak height relative peak peak (min) (mAu*min) (mAu) area(%) 1 14.427 43.101 82.327 100 2 16.202 0.000 0.000 0.0
TABLE-US-00011 TABLE 8 Peak information of substrates and products corresponding to chromatograms in FIG. 7 retention time peak area peak height relative peak peak (min) (mAu*min) (mAu) area (%) 1 14.995 8.379 13.878 99.76 2 16.202 0.020 0.000 0.24
[0075] Among them,
[0076]
[0077]
[0078] From