GENETIC ENGINEERING OF BACTERIOPHAGES USING CRISPR-CAS13A
20250145968 ยท 2025-05-08
Assignee
Inventors
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N2795/00022
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N2795/00021
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
International classification
C12N7/00
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
Abstract
The present disclosure provides methods and compositions for modifying the genomes of bacteriophages, in particular by integrating a coding sequence for an anti-CRISPR protein into the bacteriophage genome together with a desired modification such as a deletion, insertion, or nucleotide substitution, and selecting for bacteriophages with the integrated anti-CRISPR coding sequence by introducing the phage into a counter selection strain comprising an RNA-targeting CRISPR-Cas system.
Claims
1. A method of introducing a genetic modification at a locus within the genome of a bacteriophage, the method comprising: i) providing a first population of bacterial cells comprising a polynucleotide and the bacteriophage, wherein the polynucleotide comprises a coding sequence for an anti-CRISPR protein that inhibits an RNA-targeting CRISPR-Cas system in the bacterial cells, flanked by two homology arms comprising nucleotide sequence homology to the bacteriophage locus; ii) culturing the bacterial cells under conditions conducive to homologous recombination between the polynucleotide and the bacteriophage genome, and obtaining a lysate from the cultured cells; iii) infecting a second population of bacterial cells comprising the RNA-targeting CRISPR-Cas system with the lysate; and iv) isolating modified bacteriophage from the contacted population of CRISPR bacterial cells.
2. The method of claim 1, wherein the bacteriophage is a lytic bacteriophage and the isolating comprises isolating recombinant plaques from the contacted population of CRISPR bacterial cells.
3. The method of claim 1, further comprising verifying the integration of the coding sequence for the CRISPR inhibitor at the locus within the bacteriophage genome.
4. The method of claim 1 or 3, wherein the RNA-targeting CRISPR-Cas system comprises Cas13a.
5. The method of claim 1 or 4, wherein one or both of the homology arms are at least about 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, or more nucleotides in length.
6. The method of any one of claims 1 to 5, wherein the bacteriophage is selected from the group consisting of KZ, OMKO1, and PaMx41.
7. The method of any one of claims 1 to 6, wherein the integration of the CRISPR inhibitor into the bacteriophage genome at the locus introduces a genetic modification at the locus.
8. The method of claim 7, wherein the genetic modification is a deletion.
9. The method of claim 7, wherein the genetic modification is an insertion.
10. The method of claim 7, wherein the genetic modification is a nucleotide substitution.
11. The method of any one of claims 1 to 10, wherein the RNA-targeting CRISPR-Cas system comprises a crRNA comprising one or more mismatches between two direct repeat sequences and/or a truncation of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more nucleotides within a direct repeat at the 5 and/or 3 end of the crRNA.
12. The method of any one of claims 1 to 10, wherein the RNA-targeting CRISPR-Cas system comprises a crRNA containing one direct repeat sequence.
13. The method of any one of claims 1 to 12, wherein the anti-CRISPR protein is AcrVIA1.
14. The method of any one of claims 1 to 13, wherein the crRNA targets orf120 or orf146, or an ortholog thereof.
15. The method of any one of claims 1 to 14, wherein the locus is from phiKZ phage and is selected from the group consisting of orf39, orf54, orf120, orf146, orf93, orf241, orf242, orf89, orf90, orf91, orf92, orf93, and orthologs thereof.
16. The method of any one of claims 1 to 15, wherein first population of bacterial cells comprises the bacteriophage prior to comprising the polynucleotide.
17. The method of any one of claims 1 to 15, wherein first population of bacterial cells comprises the bacteriophage subsequent to comprising the polynucleotide.
18. The method of any one of claims 1 to 17, wherein the polynucleotide and flanking homology arms are present in an editing plasmid, and wherein the editing plasmid is introduced into the first population of bacterial cells by electroporation.
19. The method of any one of claims 1 to 18, wherein the second population of bacterial cells comprises the RNA-targeting CRISPR-Cas system prior to being contacted with the lysate.
20. The method of any one of claims 1 to 18, wherein the second population of bacterial cells comprises the RNA-targeting CRISPR-Cas system subsequent to being contacted with the lysate.
21. A modified bacteriophage produced using the method of any one of claims 1 to 15.
22. A bacterial cell comprising the modified bacteriophage of claim 21.
23. A modified bacteriophage comprising a coding sequence for an anti-CRISPR protein integrated into the bacteriophage genome at a locus that is not essential for phage replication, wherein the anti-CRISPR protein can inhibit an RNA-targeting CRISPR-Cas system, and wherein the locus also comprises a deletion, insertion, or mutation relative to an otherwise equivalent, non-modified bacteriophage.
24. The modified bacteriophage of claim 23, wherein the anti-CRISPR protein is AcrVIA1.
25. The modified bacteriophage of claim 23 or 24, wherein the bacteriophage is selected from the group consisting of KZ, OMKO1, and PaMx41.
26. The modified bacteriophage of any one of claims 23 to 25, wherein the locus is selected from the group consisting of orf39, orf54, orf120, orf146, orf93, orf241, orf242, orf89, orf90, orf91, orf92, orf93, and orthologs thereof.
27. A bacterial cell comprising the modified bacteriophage of any one of claims 23 to 26.
28. A bacterial cell comprising a polynucleotide and a bacteriophage, wherein the polynucleotide comprises a coding sequence for an anti-CRISPR protein that inhibits an RNA-targeting CRISPR-Cas system, flanked by two homology arms comprising substantial nucleotide sequence identity to a locus within the genome of the bacteriophage.
29. The bacterial cell of claim 28, wherein the anti-CRISPR protein is AcrVIA1.
30. The bacterial cell of claim 28 or 29, wherein the RNA-targeting CRISPR-Cas system comprises Cas13a.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
DETAILED DESCRIPTION OF THE INVENTION
1. General
[0038] Practicing this invention utilizes routine techniques in the field of molecular biology. Basic texts disclosing the general methods of use in this invention include Sambrook and Russell, Molecular Cloning, A Laboratory Manual (3.sup.rd ed. 2001); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al., eds., 1994)).
[0039] For nucleic acids, sizes are given in either kilobases (kb), base pairs (bp), or nucleotides (nt). Sizes of single-stranded DNA and/or RNA can be given in nucleotides. These are estimates derived from agarose or acrylamide gel electrophoresis, from sequenced nucleic acids, or from published DNA sequences. For proteins, sizes are given in kilodaltons (kDa) or amino acid residue numbers. Protein sizes are estimated from gel electrophoresis, from sequenced proteins, from derived amino acid sequences, or from published protein sequences.
[0040] Oligonucleotides that are not commercially available can be chemically synthesized, e.g., according to the solid phase phosphoramidite triester method first described by Beaucage and Caruthers, Tetrahedron Lett. 22:1859-1862 (1981), using an automated synthesizer, as described in Van Devanter et. al., Nucleic Acids Res. 12:6159-6168 (1984). Purification of oligonucleotides is performed using any art-recognized strategy, e.g., native acrylamide gel electrophoresis or anion-exchange high performance liquid chromatography (HPLC) as described in Pearson and Reanier, J. Chrom. 255: 137-149 (1983).
2. Definitions
[0041] As used herein, the following terms have the meanings ascribed to them unless specified otherwise.
[0042] The terms a, an, or the as used herein not only include aspects with one member, but also include aspects with more than one member. For instance, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a cell includes a plurality of such cells, and so forth.
[0043] The terms about and approximately as used herein shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Typically, exemplary degrees of error are within 20 percent (%), preferably within 10%, and more preferably within 5% of a given value or range of values. Any reference to about X specifically indicates at least the values X, 0.8X, 0.81X, 0.82X, 0.83X, 0.84X, 0.85X, 0.86X, 0.87X, 0.88X, 0.89X, 0.9X, 0.91X, 0.92X, 0.93X, 0.94X, 0.95X, 0.96X, 0.97X, 0.98X, 0.99X, 1.01X, 1.02X, 1.03X, 1.04X, 1.05X, 1.06X, 1.07X, 1.08X, 1.09X, 1.1X, 1.11X, 1.12X, 1.13X, 1.14X, 1.15X, 1.16X, 1.17X, 1.18X, 1.19X, and 1.2X. Thus, about X is intended to teach and provide written description support for a claim limitation of, e.g., 0.98X.
[0044] The term nucleic acid or polynucleotide refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogs of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
[0045] The term gene means the segment of DNA involved in producing a polypeptide chain. It may include regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons).
[0046] A promoter is defined as an array of nucleic acid control sequences that direct transcription of a nucleic acid. As used herein, a promoter includes necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase II type promoter, a TATA element. A promoter also optionally includes distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription. The promoter can be a heterologous promoter. In some embodiments, the promoter is a prokaryotic promoter, e.g., a promoter used to drive crRNA, anti-anti-CRISPR, or RNA-targeting CRISPR-Cas13 gene expression in prokaryotic cells. Typical prokaryotic promoters include elements such as short sequences at the 10 and 35 positions upstream from the transcription start site, such as a Pribnow box at the 10 position typically consisting of the six nucleotides TATAAT, and a sequence at the 35 position, e.g., the six nucleotides TTGACA.
[0047] An expression cassette is a nucleic acid construct, generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular polynucleotide sequence in a host cell. An expression cassette may be part of a plasmid, viral genome, or nucleic acid fragment. Typically, an expression cassette includes a polynucleotide to be transcribed, operably linked to a promoter. The promoter can be a heterologous promoter. In the context of promoters operably linked to a polynucleotide, a heterologous promoter refers to a promoter that would not be so operably linked to the same polynucleotide as found in a product of nature (e.g., in a wild-type organism).
[0048] As used herein, a first polynucleotide or polypeptide is heterologous to an organism or a second polynucleotide or polypeptide sequence if the first polynucleotide or polypeptide originates from a foreign species compared to the organism or second polynucleotide or polypeptide, or, if from the same species, is modified from its original form. For example, when a promoter is said to be operably linked to a heterologous coding sequence, it means that the coding sequence is derived from one species whereas the promoter sequence is derived from another, different species; or, if both are derived from the same species, the coding sequence is not naturally associated with the promoter (e.g., is a genetically engineered coding sequence).
[0049] Polypeptide, peptide, and protein are used interchangeably herein to refer to a polymer of amino acid residues. All three terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. As used herein, the terms encompass amino acid chains of any length, including full-length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
[0050] The terms expression and expressed refer to the production of a transcriptional and/or translational product, e.g., of a crRNA and/or a nucleic acid sequence encoding a protein (e.g., an RNA-targeting Cas protein such as Cas13a or an anti-CRISPR protein). In some embodiments, the term refers to the production of a transcriptional and/or translational product encoded by a gene (e.g., a Cas13a gene) or a portion thereof. The level of expression of a DNA molecule in a cell may be assessed on the basis of either the amount of corresponding Mrna that is present within the cell or the amount of protein encoded by that DNA produced by the cell.
[0051] Conservatively modified variants applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids that encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are silent variations, which are one species of conservatively modified variations. Every nucleic acid sequence herein that encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid that encodes a polypeptide is implicit in each described sequence.
[0052] As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a conservatively modified variant where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles. In some cases, conservatively modified variants of an RNA-targeting CRISPR-Cas13 protein can have an increased stability, assembly, or activity as described herein.
[0053] The following eight groups each contain amino acids that are conservative substitutions for one another: [0054] 1) Alanine (A), Glycine (G); [0055] 2) Aspartic acid (D), Glutamic acid I; [0056] 3) Asparagine (N), Glutamine (Q); [0057] 4) Arginine (R), Lysine (K); [0058] 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); [0059] 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); [0060] 7) Serine (S), Threonine (T); and [0061] 8) Cystine (C), Methionine (M) [0062] (see, e.g., Creighton, Proteins, W. H. Freeman and Co., N. Y. (1984)).
[0063] Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
[0064] In the present application, amino acid residues are numbered according to their relative positions from the left most residue, which is numbered 1, in an unmodified wild-type polypeptide sequence.
[0065] As used in herein, the terms identical or percent identity, in the context of describing two or more polynucleotide or amino acid sequences, refer to two or more sequences or specified subsequences that are the same. Two sequences that are substantially identical have at least 60% identity, preferably 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using a sequence comparison algorithm or by manual alignment and visual inspection where a specific region is not designated. For example, polypeptides comprising an amino acid sequence substantially identical to SEQ ID NO:1 and optionally having anti-CRISPR activity and nucleic acids comprising a nucleotide sequence substantially identical to SEQ ID NO:2 is provided. With regard to polynucleotide sequences, this definition also refers to the complement of a test sequence. With regard to amino acid sequences, in some cases, the identity exists over a region that is at least about 50 amino acids or nucleotides in length, or more preferably over a region that is 75-100 amino acids or nucleotides in length.
[0066] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. For sequence comparison of nucleic acids and proteins, the BLAST 2.0 algorithm and the default parameters discussed below are used.
[0067] A comparison window, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
[0068] An algorithm for determining percent sequence identity and sequence similarity is the BLAST 2.0 algorithm, which is described in Altschul et al., (1990) J. Mol. Biol. 215: 403-410. Software for performing BLAST analyses is publicly available at the National Center for Biotechnology Information website, ncbi.nlm.nih.gov. The algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits acts as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word size (W) of 28, an expectation (E) of 10, M=1, N=2, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word size (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).
[0069] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
[0070] The CRISPR-Cas system refers to a class of bacterial systems for defense against foreign nucleic acids. CRISPR-Cas systems are found in a wide range of bacterial and archaeal organisms. CRISPR-Cas systems fall into two classes with six types, I, II, III, IV, V, and VI as well as many sub-types, with Class 1 including types I and III CRISPR systems, and Class 2 including types II, IV, V and VI; Class 1 subtypes include subtypes I-A to I-F, for example. See, e.g., Fonfara et al., Nature 5 32, 7600 (2016); Zetsche et al., Cell 163, 759-771 (2015); Adli et al. (2018). Endogenous CRISPR-Cas systems include a CRISPR locus containing repeat clusters separated by non-repeating spacer sequences that correspond to sequences from viruses and other mobile genetic elements, and Cas proteins that carry out multiple functions including spacer acquisition, RNA processing from the CRISPR locus, target identification, and cleavage. In class 1 systems these activities are affected by multiple Cas proteins, with Cas13 providing the endonuclease activity, whereas in class 2 systems they are all carried out by a single Cas, Cas9.
[0071] An RNA-targeting CRISPR-Cas system or RNA-guided CRISPR-Cas system refers to a Cas protein (an RNA-targeting or RNA-guided Cas protein or RNA ribonuclease) and crRNA that act together to target an RNA molecule comprising the target sequence specified in the spacer region of the crRNA. In some embodiments, the Cas protein within the RNA-targeting CRISPR-Cas system is a Cas13 ribonuclease, e.g., Cas13a, Cas13b, Cas 13c, Cas 13d, Cas13x, or Cas13y. Any of the numerous Cas13 proteins, of any family and from any source, can be used in the present methods. In particular embodiments, Cas13a is used, e.g., Cas13a from Leptotrichia. See, e.g., Mendoza et al. (2020), the entire disclosure of which is herein incorporated by reference.
[0072] The crRNAs, or CRISPR RNAs, used herein can be any crRNA that can function with an endogenous or exogenous RNA-targeting CRISPR-Cas system to direct the degradation of RNA comprising the crRNA target sequence. The crRNAs can be bound by the RNA-targeting Cas component of such a system, e.g., Cas13a. As used herein, an RNA-targeting CRISPR-Cas system crRNA refers to a crRNA that, when incubated together with one or more RNA-targeting Cas proteins such as Cas13a, can direct the protein to a target RNA sequence as defined by (e.g., being complementary or homologous to) the spacer sequence of the crRNA. An RNA-targeting CRISPR-Cas13 crRNA can also be any naturally occurring, or wild-type, crRNA that is present in a CRISPR array in any species with an RNA-targeting CRISPR-Cas system, or to a crRNA made using a repeat sequence from any CRISPR array from any species with an RNA-targeting CRISpR-Cas system. crRNAs comprise a spacer sequence of, e.g., <15 nucleotides, 15-20, 20-25, 25-30, or >30 nucleotides in length, or 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length, with homology to a targeted RNA transcript sequence at a position adjacent to a PAM sequence (e.g., 5-TTC-3), as well as one or more repeat sequences of, e.g., 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 or more nucleotides in length, or e.g., 20-40, 30-40, 25-35 nucleotides in length, comprising a stem-loop structure.
[0073] crRNAs can also be modified, e.g., in the stem region, the loop region, or outside of the stem-loop region, as described elsewhere herein, e.g., in a sequence that includes exchanged complementary base pairs within the stem region and modified nucleotides within the loop. For example, in crRNAs that comprise two repeats, the repeat sequences can differ from one another at one or more nucleotides, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more nucleotides, as described in more detail elsewhere herein. crRNAs can also comprise a single repeat sequence together with the spacer sequence and can also comprise truncations within one or both repeat sequences, e.g., a truncation of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or greater nucleotides from the 5 or 3 end of the crRNA, e.g., a truncation relative to a full-length crRNA, e.g., a full-length wild-type crRNA. The overall length of the crRNA can vary and is typically, e.g., 60-120 nucleotides in length, e.g., 60, 70, 80, 90, 100, 110, 120, or any integer within that range, or e.g., 60-90, 60-100, 60-110, 70-120, 80-120, 90-120, or 70-100, 80-100, or 90-100 nucleotides in length.
[0074] As used herein, an editing plasmid or donor template refers to a bacterial plasmid or other nucleic acid construct that comprises a polynucleotide to be integrated using HDR (homology directed recombination) into a bacteriophage genome. The polynucleotide can comprise, e.g., an Acr coding sequence and a sequence to induce a deletion, insertion, or nucleotide substitution in the bacteriophage genome. The plasmid also comprises homology arms, flanking the coding polynucleotide, that comprise homology to a targeted sequence within the bacteriophage genome, i.e., the site of acr gene insertion and genomic modification as described herein. In some embodiments, two distinct homologous regions are present on the template, with each region comprising at least 50, 100, 200, 300, 400, 500, 600, 700, 800, 900 or more nucleotides or more of homology with the corresponding genomic sequence. In some embodiments, the homologous regions correspond to genomic regions that are separated by, e.g., at least 50, 100, 200, 300, 400, 500, 600, 700, 800, 900 bp, or 1, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 kb or more in the genome. The donor template can be present in any form, e.g., on a plasmid that is introduced into the cell (i.e., an editing plasmid), as a free floating doubled stranded DNA template (e.g., a template that is liberated from a plasmid in the cell), or as single stranded DNA. As the sequence separating the homologous regions on the template will be introduced into the genome by HDR, the present methods can be used to induce precisely defined deletions into the genome (i.e., if the genomic sequence normally present between the homologous regions is absent on the template), to introduce insertions (i.e., if a nucleotide sequence that is not normally present in the genome at the corresponding genomic locus is present on the template between the homologous regions), or to introduce modifications to the genome (i.e., if the nucleotide sequence between the homologous regions on the template differs from the corresponding genomic sequence at one or more nucleotides).
[0075] Anti-CRISPR, or (Acr) proteins, or (acr) genes, refers to a family of genes and encoded proteins that are associated with inhibition of CRISPR-Cas activity, including RNA-targeting CRISPR-Cas activity such as that provided by Cas13a. Acr proteins effectively against Cas13a can include, e.g., AcrVIA1 and any family members, variants, derivatives, or fragments thereof, polypeptides sharing at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% identity to AcrVIA1, or polynucleotides encoding said polypeptides.
3. Detailed Description of the Embodiments
Integration of Acr-Encoding Constructs into Phage Genomes
[0076] The present disclosure provides novel methods and compositions for generating deletions, insertions, or other genetic modifications in lytic bacteriophages using both Acr-encoding polynucleotides and using RNA-targeting CRISPR-Cas systems such as those comprising Cas13a. In particular embodiments, the present methods and compositions provide a first step in which a polynucleotide encoding an anti-CRISPR protein (Acr) is introduced into a bacteriophage genome. In particular embodiments, the polynucleotide is introduced into the bacteriophage genome by introducing both the bacteriophage (e.g., by infection) and the polynucleotide (e.g., by electroporation) into a bacterial cell, wherein the polynucleotide is present within an editing plasmid in which the coding sequence for the Acr is flanked by homology arms comprising homology to a target site within the bacteriophage genome. It will be appreciated that the introduction of the bacteriophage and the polynucleotide (e.g., the plasmid) into the bacteria can occur in any order, i.e., by introducing the bacteriophage first, by introducing the polynucleotide (e.g., the plasmid) first, or by introducing the bacteriophage and the polynucleotide (e.g., the plasmid) at the same time. By culturing the bacterial cell under conditions conducive to homologous recombination, the polynucleotide is integrated into the bacteriophage genome at the targeted site. In addition, in particular embodiments the editing plasmid (or donor template) also introduces one or more genetic modifications (e.g., gene insertion or deletion) into the bacteriophage genome in proximity to the site of acr gene insertion.
[0077] In a subsequent, counter-selection step, bacteriophage isolated from the bacteria, where the phage genome may now include an integrated acr gene if recombination has taken place, are introduced into a second population of bacterial cells comprising an RNA-targeting CRISPR-Cas system. In particular embodiments, the CRISPR-Cas system comprises a Cas13a protein and a crRNA targeting a bacteriophage gene that is essential for its replication. In particular embodiments, the crRNA targets orf120 or orf146 of KZ phage, or an ortholog of either of these coding sequences in another phage. In this way, if recombination has not taken place and the phage genome lacks an integrated acr gene, then the CRISPR-Cas system inhibits the replication of the phage and prevents (or reduces) the formation of lytic plaques. In contrast, if acr gene integration has taken place into the phage genome, then the expressed Acr inhibits the RNA-targeting CRISPR-Cas system and allows bacteriophage replication and, consequently, the formation of plaques. Modified bacteriophage (comprising the integrated acr gene as well as the induced genomic modification) can then be isolated from the plaques and characterized, e.g., using restriction analysis and/or PCR assays, sequencing, or other relevant molecular biological, biochemical, or functional assays.
[0078] Accordingly, the present disclosure provides methods and compositions for introducing modifications into a bacteriophage genome comprising the integration of an Acr-encoding gene into the phage genome as well as one or more other modifications such as a deletion, insertion, or nucleotide substitution. The present disclosure also provides bacterial cells for counter selection comprising RNA-targeting CRISPR-Cas systems, for selecting for modified bacteriophage genomes in the counter selection bacterial cells, and for isolating and characterizing successfully modified bacteriophage. The methods and compositions can be used in any bacteriophage (e.g., lytic or temperate) and bacteriophage-infectable bacterial cells, including bacterial cells that do or do not have an endogenous RNA-targeting CRISPR-Cas system.
[0079] The methods and compositions described herein can be applied to a number of different bacteriophages. In some embodiments the bacteriophage are jumbo bacteriophage (see, e.g., Yuan and Go, Front Microbiol. 2017; 8: 403). In some embodiments, the bacteriophage are members of the Myoviridae, Podoviridae, or Siphoviridae. Exemplary bacteriophage include, but are not limited to phiKZ, OMKO1, and pamx41.
[0080] Any anti-CRISPR can be used in the present methods, so long that the anti-CRISPR inhibits an RNA-guided RNA nuclease such as Cas13 or Cas13a. In particular embodiments, the anti-CRISPR is AcrVIA1, e.g., AcrVIA1 from Listeriophage LS46 (see, e.g., Meeske et al. (2020), the entire disclosure of which is herein incorporated by reference), which is MIYYIKDLKVKGKIFENLMNKEAVEGLITFLKKAEFEIYSRENYSKYNKWFEMWKSPTS SLVFWKNYSFRCHLLFVIEKDGECLGIPASVFESVLQIYLADPFAPDTKELFVEVCNLYE CLADVTVVEHFEAEESAWHKLTHNETEVSKRVYSKDDDELLKYIPEFLDTIATNKKSQK YNQIQGKIQEINKEIATLYESSEDYIFTEYVSNLYRESAKLEQHSKQILKEELN (SEQ ID NO:1) or can be substantially identical to SEQ ID NO:1. A coding sequence for SEQ ID NO:1 is
TABLE-US-00001 (SEQIDNO:2) ATGATCTACTATATAAAAGATTTAAAAGTGAAAGGAAAAATATTTGAAA ATCTAATGAACAAAGAGGCTGTAGAAGGATTAATTACTTTTTTAAAGAA AGCGGAATTTGAGATATACTCAAGAGAAAATTATTCAAAATACAACAAA TGGTTTGAAATGTGGAAAAGCCCAACTTCGAGCCTTGTGTTTTGGAAAA ATTATAGTTTTCGCTGTCATCTTCTTTTTGTCATAGAAAAAGATGGTGA ATGCCTTGGAATTCCTGCATCTGTTTTTGAATCTGTACTTCAAATTTAC CTTGCGGATCCGTTCGCTCCCGATACGAAAGAACTTTTTGTTGAGGTTT GTAATTTATATGAATGTTTAGCGGATGTCACTGTCGTAGAACATTTTGA AGCGGAAGAATCAGCGTGGCATAAATTAACCCATAATGAGACCGAAGTA TCAAAAAGAGTCTATAGTAAAGATGATGACGAACTTCTTAAATATATTC CAGAATTTCTTGACACCATAGCGACAAACAAGAAAAGTCAAAAATACAA TCAAATTCAAGGAAAAATACAAGAAATTAATAAGGAAATAGCTACACTT TATGAATCGTCAGAGGATTATATATTTACTGAATATGTTAGTAATTTAT ATAGAGAGTCTGCAAAGTTGGAGCAACACAGCAAACAAATTTTAAAAGA GGAGCTAAATTAA
[0081] Donor templates comprising polynucleotides encoding the anti-CRISPRs can be generated, e.g., by first amplifying homology arms by PCR from the target locus using the bacteriophage to be modified as a template, and optionally introducing or omitting sequences, as described in more detail elsewhere herein, to induce a modification of the targeted phage genomic locus. A polynucleotide encoding the Acr gene can then also be amplified, and the amplification products can then be introduced into a plasmid, e.g., a pHTERD30T backbone plasmid, and used to transform bacteria such as PAO1, e.g., by electroporation. Transformed cells can be cultured, e.g., in LB with 10 mM MgSO4 and 30 g/ml gentamicin, and then infected with an appropriate bacteriophage, e.g., wild type KZ phage for PAO1 cells, by adding the phage to the bacterial culture at, e.g., a multiplicity of infection (MOI) of about 1. In some embodiments, the cells are infected prior to introduction of the homologous donor template, and in some embodiments the phage and the template are introduced simultaneously. Following further culture, the cells are lysed, and the phage lysate (which contains both wild-type bacteriophage genomes where recombination has not occurred, and recombinant phage comprising the integrated acr transgene and the genomic modification of interest) is isolated and used to infect a second population of bacterial cells (e.g., PAO1 cells) comprising an RNA-targeting CRISPR-Cas system (e.g., a CRISPR-Cas13a system). The bacteriophage and the CRISPR-Cas system can be introduced in any respective order, i.e., the CRISPR-Cas system first, the bacteriophage first, or the CRISPR-Cas system and bacteriophage at the same time. Any of a number of crRNAs can be used in the CRISPR-Cas system, so long that they target bacteriophage RNA that are essential for bacteriophage replication and, consequently, for the formation of lytic plaques. In particular embodiments, the crRNA targets an essential transcript such as gp120. Plaques that are produced will likely comprise recombinant bacteriophage and can be isolated and characterized, e.g., as described in the present Examples.
[0082] In some embodiments, the methods and compositions are used to generate mutations in bacteriophage. In some embodiments, the targeted bacteriophage loci are non-essential, e.g., outside of the coding sequence of an essential gene or encoding a non-essential protein. In some embodiments, the homologous templates are designed such that integration of the acr transgene deletes or otherwise disrupts the targeted locus. In some embodiments, the homologous templates are designed such that the integration of the acr transgene introduces an additional transgene into the targeted locus within the bacteriophage genome. In some embodiments, the homologous templates are designed such that the integration of the acr gene modifies one or more nucleotides within the bacteriophage genome, e.g., to introduce a missense or nonsense mutation into a targeted gene.
[0083] In some embodiments, the homologous regions on the template (i.e., homology arms) correspond to genomic phage sequences separated by, e.g., at least about 25, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900 bp or more, or by about 1, 5, 10 kb or more and in some embodiments less than 500, or 1000 bp, and the genomic phage region normally present between the genomic sequences is absent on the template, such that the intervening region between the genomic sequences is deleted from the genome when the acr gene is integrated. In some embodiments, the homologous repair template is used to insert a sequence into the targeted genomic site, e.g., an exogenous sequence is present on the template (in addition to the acr transgene) between the homologous regions that is not normally present at the corresponding genomic locus, such that the exogenous sequence is introduced into the genome when the donor template is integrated into the phage genome by HDR. In some embodiments, the homologous donor template is used to modify the phage genomic sequence at the targeted phage locus, e.g., the nucleotide sequence present on the template (in addition to the acr transgene) between the homologous regions differs from the corresponding genomic sequence at one or more nucleotides, such that the sequence present on the template is introduced into the phage genome during HDR.
RNA-Targeting CRISPR-Cas Systems
[0084] Once recombinant bacteriophage comprising an integrated Acr-encoding polynucleotide and one or more deletions, insertions, or mutations at a targeted locus have been isolated, they are introduced into a second population of bacterial cells comprising an RNA-targeting (or RNA-guided) CRISPR-Cas system. In such methods, a deletion is induced using an RNA-targeting CRISPR-Cas13 system and a crRNA targeting a specific site within the genome, and a homologous repair template is introduced comprising homology to genomic sequence surrounding the targeted site.
[0085] The homologous repair template can be present, e.g., on a plasmid, as free-floating DNA (e.g., as liberated from a plasmid in the cell), or as single-stranded DNA, and can be introduced before, at the same time as, or after the infection of the bacteria by the bacteriophage.
[0086] The methods and compositions can be used to modify bacteriophage genomes for any purpose, e.g., to delete or modify phage genes, or to introduce exogenous genes into a phage genome, for example for therapeutic purposes to treat bacterial infections, for use as vectors for gene delivery into bacteria, for phage-based vaccination (i.e., as vaccine carriers), for use as bacterial biosensing devices, and for biocontrol in manufacturing.
[0087] The present methods and compositions involve the use of bacteria for counter selection that comprise an RNA-targeting CRISPR-Cas system. In particular embodiments, a CRISPR-Cas system is introduced into a cell that does not contain an endogenous system. In particular embodiments, the CRISPR-Cas system comprises a Cas13 protein such as Cas13a (or polynucleotide encoding a Cas13 or Cas13a protein), and a crRNA targeting a bacteriophage transcript that is essential for phage replication in the bacteria. Any RNA-targeting Cas protein, from any source, can be used, so long that a specified RNA sequence is targeted for degradation upon the introduction of a crRNA specific for the targeted sequence. In particular embodiments, Cas13a is used from Leptotrichia, e.g., Leptotrichia shahii.
[0088] In some such embodiments, a plasmid or other vector is introduced into a prokaryotic cell containing polynucleotides encoding a Cas13 protein, e.g., Cas13a, operably linked to one or more promoters, such that the Cas13 protein is expressed in the cell. In particular embodiments, the cells are from a P. aeruginosa PAO1 strain harboring the tn7::cas13aLse (SDM084) on the chromosome. In some embodiments, an expression construct is produced and introduced into a plasmid, such that upon introduction of the plasmid into a bacterial cell (such as a Cas13a-expression PAO1 cell) the crRNA is expressed in the cell such that the crRNA and Cas13a can target phage transcripts expressed in the cell. In other embodiments, the Cas13 protein, e.g., Cas13a, is produced in vitro and either introduced directly into the cells or are used to assemble RNPs comprising the Cas13 and a crRNA which are then introduced into the cells using standard methods and as described elsewhere herein.
[0089] In some embodiments, a plasmid is introduced into a bacterial cell that includes both a polynucleotide encoding an RNA-targeting Cas13 (i.e., polynucleotide encoding Cas13a), as well as one or more crRNAs that target one or more essential RNA sequences within the bacteriophage genome. In such embodiments, the polynucleotides encoding the crRNA and/or RNA-targeting Cas protein are linked to one or more promoters capable of effecting expression of the crRNA and/or RNA-targeting Cas proteins in the cell, including constitutive and inducible promoters.
crRNAs
[0090] The crRNAs used in the present methods and compositions contain a spacer sequence of, e.g., less than 15, 15-20, 20-25, or 25-30 nucleotides in length, e.g., 25 nucleotides, that is complementary to the phage genomic site to be targeted, e.g., a genomic site adjacent to a PAM sequence, as well as one or more repeat sequences that flank the spacer sequences and that comprise sequences that can give rise to stem and loop structures. In wild-type CRISPR-Cas13 systems, the repeat sequences are identical, or virtually identical to one another, although in the present methods modified repeat sequences can also be used, as described in more detail elsewhere herein. Exemplary crRNA target sequences include sequences shown in Table 3, as well as sequences comprising at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more identity with one or more sequence in Table 3.
[0091] Full-length repeat sequences within the crRNAs can be, e.g., from 30-40 nucleotides in length, e.g., 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 nucleotides, and contain sequences that can give rise to a stem-loop, i.e., where the RNA can fold upon itself and form hybridized base pairs between two complementary regions to form the stem, with the nucleotides located between the two complementary regions and which therefore do not hybridize to form base pairs forming the loop. The stem-loop regions of the present crRNAs can be of any length, e.g., from 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more nucleotides, and can contain stems containing 2, 3, 4, 5, 6, 7, 8, 9, 10 or more complementary base pairs. The loops can also be of different lengths, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more nucleotides. The sequence within the repeat but outside of the stem-loop can also be of various length, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more nucleotides.
[0092] In particular embodiments, a modified crRNA is used, in which one or both of the repeat sequences surrounding a spacer is modified, truncated, or absent so that the two repeats are not identical. In particular embodiments, one or both repeats are modified while still maintaining the stem and loop structures in at least one repeat. In some embodiments, the repeat sequences differ by 1 or more nucleotides, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more (e.g., 1-15, 1-8, 1-4, 2-6, 3-6) nucleotides. In some embodiments, one of the repeats flanking the spacer is a wild-type or naturally occurring sequence, and the other repeat is a modified sequence. In other embodiments, both of the repeats surrounding a spacer are modified compared to wild-type. In some embodiments, one of the repeats is absent, so that the crRNA comprises (1) a single repeat sequence comprising a stem-loop and (2) a spacer. In some embodiments, one or both repeats is truncated, e.g., from the 5 or 3 end of the crRNA, so as to reduce the overall length of the crRNA. In such embodiments, the truncation can remove 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more (e.g., 15, 1-8, 1-10, 2-5) nucleotides from the 3 and/or 5 end of the crRNA, as compared to a full-length repeat.
[0093] In particular embodiments, nucleotides are modified in the stem region and/or the loop region of the repeat. For example, the orientation of base pairs that are formed within the stem region can be reversed, e.g., a G-C base pair could be reversed in one of the stems so that it is C-G in the stem of the other repeat. Such base-pair reversals can be implemented in, e.g., 1, 2, 3, 4, 5 or more base pairs formed within the stem. In particular embodiments, 3 base pairs are reversed, i.e., involving the introduction of 6 nucleotide differences between the two repeat sequences. In certain embodiments, nucleotides within the loop region can be modified. For example, one or more C or G within the loop region can be replaced with an A or T in one of the repeats. Such loop nucleotide changes could be implemented in, e.g., 1, 2, 3, 4 or more (e.g., 1-4, 1-3, 2-4) nucleotides within the loop. In particular embodiments, 3 nucleotides are modified. In some embodiments, repeat nucleotides outside of the stem-loop region are modified so as to differ between the two repeats. In some embodiments, 3 base pairs within the stem region are in reversed orientation in the two repeats, and 3 nucleotides within the loop are different between the repeats, for a total of 9 total differences in the nucleotide sequences of the two repeats
[0094] The modification principles described herein for modifying RNA-targeting CRISPR crRNAs, e.g., involving the use of crRNAs with only one repeat sequence, with truncated repeat sequences, or with two repeat sequences containing one or more nucleotide differences, e.g., in the stem, loop, or outside of the stem-loop, can also be used in other CRISPR systems, including other type I systems (e.g., subtypes I-A, I-B, I-U, I-D, I-E, I-F) as well as in type V and type VI systems. As such, in some embodiments, the present disclosure provides a modified crRNA from a type I (e.g., type I-F), type V, or type VI CRISPR system, wherein one or both of the repeat sequences surrounding a spacer is modified, truncated, or absent so that the two repeats are not identical.
RNA and Protein Preparation
[0095] The Cas protein within an RNA-targeting CRISPR-Cas system and/or the crRNA can be prepared using any method. For example, in some embodiments the protein can be purified from naturally occurring sources, synthesized, or more typically can be made by recombinant production in a cell engineered to produce the protein. Exemplary expression systems include various bacterial, yeast, insect, and mammalian expression systems.
[0096] The Cas and/or anti-CRISPR polypeptides as described herein can be fused to one or more fusion partners and/or heterologous amino acids to form a fusion protein. Fusion partner sequences can include, but are not limited to, amino acid tags, non-L (e.g., D-) amino acids or other amino acid mimetics to extend in vivo half-life and/or protease resistance, targeting sequences or other sequences. In some embodiments, functional variants or modified forms of the Cas or anti-CRISPR proteins include fusion proteins of an RNA-targeting Cas protein or anti-CRISPR polypeptides and one or more fusion domains. Exemplary fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy chain constant region (Fc), maltose binding protein (MBP), and/or human serum albumin (HSA). A fusion domain or a fragment thereof may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography. For the purpose of affinity purification, relevant matrices for affinity chromatography, such as glutathione-, amylase-, and nickel- or cobalt-conjugated resins are used. Many of such matrices are available in kit form, such as the Pharmacia GST purification system and the QLAexpress system (Qiagen) useful with (HIS6) fusion partners. As another example, a fusion domain may be selected so as to facilitate detection of the Cas or anti-CRISPR polypeptide. Examples of such detection domains include the various fluorescent proteins (e.g., GFP) as well as epitope tags, which are usually short peptide sequences for which a specific antibody is available. Epitope tags for which specific monoclonal antibodies are readily available include FLAG, influenza virus haemagluttinin (HA), and c-myc tags. In some cases, the fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation. In certain embodiments, an RNA-targeting Cas protein or anti-CRISPR protein is fused with a domain that stabilizes the protein (a stabilizer domain). By stabilizing is meant anything that increases protein half-life, by any mechanism. Fusions may be constructed such that the heterologous peptide is fused at the amino terminus of an RNA-targeting Cas or anti-CRISPR polypeptide and/or at the carboxyl terminus of an RNA-targeting Cas13 or anti-CRISPR polypeptide.
[0097] In some embodiments, the RNA-targeting Cas protein and/or anti-CRISPR polypeptide as described herein comprise at least one non-naturally encoded amino acid. In some embodiments, a polypeptide comprises 1, 2, 3, 4, or more unnatural amino acids. Methods of making and introducing a non-naturally occurring amino acid into a protein are known. See, e.g., U.S. Pat. Nos. 7,083,970; and 7,524,647. The general principles for the production of orthogonal translation systems that are suitable for making proteins that comprise one or more desired unnatural amino acid are known in the art, as are the general methods for producing orthogonal translation systems.
[0098] A non-naturally encoded amino acid is typically any structure having any substituent side chain other than one used in the twenty natural amino acids. Because non-naturally encoded amino acids typically differ from the natural amino acids only in the structure of the side chain, the non-naturally encoded amino acids form amide bonds with other amino acids, including but not limited to, natural or non-naturally encoded, in the same manner in which they are formed in naturally occurring polypeptides. However, the non-naturally encoded amino acids have side chain groups that distinguish them from the natural amino acids. For example, R optionally comprises an alkyl-, aryl-, acyl-, keto-, azido-, hydroxyl-, hydrazine, cyano-, halo-, hydrazide, alkenyl, alkynl, ether, thiol, seleno-, sulfonyl-, borate, boronate, phospho, phosphono, phosphine, heterocyclic, enone, imine, aldehyde, ester, thioacid, hydroxylamine, amino group, or the like or any combination thereof. Other non-naturally occurring amino acids of interest that may be suitable for use include, but are not limited to, amino acids comprising a photoactivatable cross-linker, spin-labeled amino acids, fluorescent amino acids, metal binding amino acids, metal-containing amino acids, radioactive amino acids, amino acids with novel functional groups, amino acids that covalently or noncovalently interact with other molecules, photocaged and/or photoisomerizable amino acids, amino acids comprising biotin or a biotin analog, glycosylated amino acids such as a sugar substituted serine, other carbohydrate modified amino acids, keto-containing amino acids, amino acids comprising polyethylene glycol or polyether, heavy atom substituted amino acids, chemically cleavable and/or photocleavable amino acids, amino acids with an elongated side chains as compared to natural amino acids, including but not limited to, polyethers or long chain hydrocarbons, including but not limited to, greater than about 5 or greater than about 10 carbons, carbon-linked sugar-containing amino acids, redox-active amino acids, amino thioacid containing amino acids, and amino acids comprising one or more toxic moiety.
[0099] crRNAs can also be prepared, e.g., by chemical synthesis or by in vitro transcription, e.g., using a pUC19 or equivalent vector, e.g., containing a T7 transcription cassette, and purification of the produced crRNAs and, e.g., removal of the 5 triphosphate group. RNPs, e.g., crRNA-protein complexes comprising the RNA-targeting Cas protein and the crRNA can be prepared by incubating the components together. In particular embodiments, the RNP comprises Cas13a and a crRNA. Methods of chemically synthesizing RNA or of producing RNA in in vitro transcription systems are well known in the art.
[0100] The efficacy of crRNAs, RNA-targeting CRISPR-Cas systems, and RNPs can be assessed using any of a number of assays. In particular embodiments, the ability of an RNA-targeting CRISPR-Cas system to prevent bacteriophage replication, and/or the ability of an anti-CRISPR to rescue bacteriophage replication, can be assessed by titering phage comprising a polynucleotide encoding the anti-CRISPR onto bacteria comprising the RNA-targeting CRISPR-Cas system, and detecting the formation of lytic plaques. The generation of deletions, insertions, and modifications in phage genomes can also be assessed by, e.g., delays or other alterations in the growth of infected cells, as well as by standard molecular biology or biochemical methods for detecting deletions, insertions, or genomic modifications such as PCR, Sanger sequencing, whole genome sequencing, or Southern Blotting.
Delivery into Cells
[0101] Introduction of the RNA-targeting CRISPR-Cas system polynucleotides, polypeptides, RNPs, and/or of anti-CRISPRs (e.g., donor templates or editing plasmids), into bacterial cells can take different forms. For example, in some embodiments, the polypeptides and/or RNPs themselves are introduced into the cells. Any method for the introduction of polypeptides or RNPs into cells can be used. For example, in some embodiments, electroporation, bacteriophage-mediated, or liposomal or nanoparticle delivery to the cells can be employed. In other embodiments, one or more polynucleotides encoding a crRNA and/or RNA-targeting Cas (such as Cas13a), or encoding an anti-CRISPR, are introduced into a cell and the crRNA and/or RNA-targeting Cas protein, and/or the anti-CRISPR protein, are subsequently expressed in the cell. In some embodiments, the polynucleotide is an RNA molecule. In some embodiments, the polynucleotide is a DNA molecule.
[0102] In some embodiments, the crRNA, Cas protein, and/or anti-CRISPR are expressed in the cell from RNA encoded by an expression cassette, wherein the expression cassette comprises a promoter operably linked to a polynucleotide encoding the crRNA, Cas protein, and/or anti-CRISPR protein. In some embodiments, the promoter is heterologous to the polynucleotide encoding the crRNA, anti-CRISPR and/or Cas protein. In some embodiments, promoters are inducible or repressible, such that expression of a nucleic acid operably linked to the promoter can be expressed under selected conditions.
[0103] In embodiments where a polynucleotide is introduced that encodes an appropriate crRNA or polynucleotide encoding a Cas protein or an anti-CRISPR, any suitable promoter can be used that will lead to a level of expression that is higher than the level in the absence of the construct. Any level of expression that is sufficient to, e.g., increase or decrease bacteriophage replication as described herein can be used.
[0104] In some embodiments, polynucleotides, e.g., homologous repair template encoding an anti-CRISPR, or polynucleotide encoding a crRNA and/or RNA-targeting Cas protein, are introduced into bacteria using phage, e.g., a phage delivery vector comprised of ssDNA or dsDNA that delivers DNA cargo to target cells. Any phage capable of introducing a polynucleotide into the target cell can be used. The phage could be, e.g., a tailed phage or a filamentous phage, that carries an entirely designed genome or that has heterologous genes introduced into an otherwise natural genome.
[0105] In other embodiments, polynucleotides, e.g., homologous repair template encoding an anti-CRISPR, or polynucleotide encoding a crRNA and/or RNA-targeting Cas protein, are introduced into bacteria using bacterial conjugation. In some embodiments, polynucleotides are introduced into target prokaryotes using E. coli as a conjugative donor strain, e.g., using mobilizable plasmids that transfer their genetic material, e.g., homologous repair template encoding an anti-CRISPR, or polynucleotide encoding a crRNA and/or RNA-targeting Cas protein.
[0106] In certain embodiments, the crRNA and/or Cas protein are produced in vitro and introduced directly into cells, either individually or as a pre-formed RNP, i.e., a crRNA-Cas protein complex.
[0107] In certain embodiments, the crRNA and Cas protein are introduced into the cell by directly introducing RNA into the cell, e.g., crRNA and/or mRNA encoding an RNA-directed Cas protein such as Cas13a.
[0108] In some embodiments, the crRNAs, anti-CRISPR, and/or RNA-targeting CRISPR-Cas system components are introduced into cells using modified RNA. Various modifications of RNA are known in the art to enhance, e.g., the translation, potency and/or stability of RNA when introduced into cells. In particular embodiments, modified mRNA (mmRNA) is used, e.g., mmRNA encoding an RNA-targeting CRISPR-Cas system component or anti-CRISPR. In other embodiments, modified RNA comprising a crRNA is used. Non-limiting examples of RNA modifications that can be used include anti-reverse-cap analogs (ARCA), polyA tails of, e.g., 100-250 nucleotides in length, replacement of AU-rich sequences in the 3UTR with sequences from known stable mRNAs, and the inclusion of modified nucleosides and structures such as pseudouridine, e.g., N1-methylpseudouridine, 2-thiouridine, 4thioRNA, 5-methylcytidine, 6-methyladenosine, amide 3 linkages, thioate linkages, inosine, 2-deoxyribonucleotides, 5-Bromo-uridine and 2-O-methylated nucleosides. A non-limiting list of chemical modifications that can be used can be found, e.g., in the online database crdd.osdd.net/servers/simamod/.
[0109] Any prokaryotic cell that can be infected by a bacteriophage can be used in the present methods. Exemplary prokaryotic cells can include but are not limited to, those used for biotechnological purposes, the production of desired metabolites, E. coli and human pathogens. Examples of such prokaryotic cells can include, for example, Escherichia coli, Pseudomonas sp., Corynebacterium sp., Bacillus subtilis, Streptococcus pneumonia, Pseudomonas aeruginosa, Staphylococcus aureus, Campylobacter jejuni, Francisella novicida, Corynebacterium diphtheria, Enterococcus sp., Listeria monocytogenes, Mycoplasma gallisepticum, Streptococcus sp., or Treponema denticola. In some embodiments, prokaryotic cells include pathogenic cells and/or antibiotic resistant cells.
Kits
[0110] Other embodiments of the compositions described herein are kits comprising one or more crRNAs, RNA-targeting CRISPR-Cas protein or proteins, homologous repair templates, polynucleotides encoding one or more crRNAs of the invention and/or encoding one or more RNA-targeting Cas protein or proteins (such as Cas13a) or an anti-CRISPR (such as AcrVIA1), and/or RNPs comprising crRNAs and RNA-targeting Cas proteins. The kit typically contains containers, which may be formed from a variety of materials such as glass or plastic, and can include for example, bottles, vials, syringes, and test tubes. A label typically accompanies the kit, and includes any writing or recorded material, which may be electronic or computer readable form providing instructions or other information for use of the kit contents.
[0111] In some embodiments, the kits can further comprise instructional materials containing directions (i.e., protocols) for the practice of the methods of this invention (e.g., instructions for using the kit for inducing deletions, insertions, or other modifications into bacteriophage genomes. While the instructional materials typically comprise written or printed materials, they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD-ROM), and the like. Such media may include addresses to internet sites that provide such instructional materials.
4. Examples
[0112] Bacteriophages (or phages) possess many genes of unknown function and thus genetic tools are required to understand their biology and to enhance their antimicrobial efficacy. Pseudomonas aeruginosa jumbophage KZ and its relatives are a broad host range phage family that assemble a proteinaceous phage nucleus structure during infection. Due to the phage nucleus, DNA-targeting CRISPR-Cas is ineffective against this phage and thus there are currently no reverse genetic tools for this family. Here, we develop a DNA phage genome editing technology using the RNA-targeting CRISPR-Cas13a enzyme as a selection tool, an anti-CRISPR gene (acrVIA1) as a selectable marker, and homologous recombination. Precise insertion of foreign genes, gene deletions, and addition of chromosomal fluorescent tags into the KZ genome were achieved. Deletion of orf39, which encodes a tubulin-like protein (PhuZ) that centers the phage nucleus during infection, led to the mispositioning of the phage nucleus but surprisingly has no impact on phage replication, despite a proposed role in capsid trafficking. An endogenous fluorescent tag placed on gp93, a proposed inner body protein in the phage head revealed a protein that is injected with the phage genome, localizes with the maturing phage nucleus, and then is massively synthesized around the phage nucleus during phage maturation. Successful editing of other phages that resist DNA-targeting CRISPR-Cas systems [e.g., OMKO1, PaMx41] demonstrates the flexibility of this method. The data suggested that the RNA-targeting Cas13a system holds great promise for becoming a universal genetic editing tool for intractable phages. This phage genetic engineering platform enables the systematic study of phage genes with unknown function and the precise modification of phages for use in a variety of applications.
Introduction
[0113] Here, we develop the CRISPR-Cas13a system as a novel genetic engineering approach for KZ. Using Cas13a targeting an essential transcript, we select for phage DNA that has undergone homologous recombination resulting in a desired genetic change along with the acquisition of an anti-Cas13a trans gene, acrVIA1 (derived from Listeriophage LS46 [23]), as a selectable marker. This approach allows us to precisely insert foreign gene fragments into the KZ genome, knock out non-essential genes, and fuse fluorescent tags to individual genes. Importantly, the same guide can be used for any genomic manipulation for the same phage strain as engineered phages are identified based on the acquisition of the Cas13a inhibitor, not a change in the target sequence. Our work establishes a Cas13a-based phage engineering strategy that could be a universally powerful tool for engineering phages that are intractable with DNA-targeting genetic engineering techniques.
Results
Optimization of CRISPR-Cas13a for Efficient Phage Targeting
[0114] Cas13a is an RNA-guided RNA nuclease that can block KZ replication in P. aeruginosa PAO1. We previously targeted KZ by expressing crRNA guides from a plasmid (
Screening of KZ Recombinants by CRISPR-Cas13a Counter Selection
[0115] To avoid disrupting any essential genes that are required for phage replication, we first attempted to insert acrVIA1 immediately downstream of KZ major capsid gene (orf120). A template DNA substrate for homologous recombination, composed of 600-bp homology arms flanking acrVIA1 was cloned into a plasmid, referred to as an editing plasmid (
[0116] To test the flexibility of this nascent genetic technology and generate new biological insights of phage KZ, we next knocked out (or attempted to knock out) multiple genes; phuZ (orf39), orf54, orf89-orf93, orf93, orf146, orf241, and orf241-orf242 (summarized in Table 1), in addition to attempting to add chromosomal fluorescent tags onto orf54 and orf93. The successes, failures, and next steps are discussed below, along with the new insights gained. Whole genome sequencing of two deletion mutants, phuZ and orf93, revealed no other mutations. The accuracy of this system highlights an important advantage of adapting an RNA-targeting system CRISPR-Cas13a to select for edits in phage genomes, compared to direct DNA cleavage.
Characterization of PhuZ and Gp93 Using Engineered KZ Mutants
[0117] PhuZ (gp39) is conserved across jumbo phages and some megaphages [25]. It constitutes a bipolar spindle to center the phage nucleus during phage intracellular development [26, 27], and treadmill newly synthesized phage capsids from the cell inner membrane to the phage nucleus for DNA packaging [28]. These functions made us speculate that PhuZ might be essential or important for phage growth, however, this is not the case. phuZ mutants exhibited a similar burst size (24 phage particles per infected bacterial cell vs. 19 of WT phage) under our experimental conditions. Under the microscope, we observed that the phage nucleus was mispositioned in cells infected by phuZ mutants, in contrast to WT infections (
[0118] orf93 encodes gp93, a high copy number inner body (IB) protein that is packaged in the phage head [31, 32]. Deletion of orf93 also yielded viable phage with no obvious growth defect. We next analyzed the inserted fluorescent chromosomal label at the C-terminus of the protein, which is notable as the first endogenous protein tag in this phage family. Labeled gp93 was observed in the mature virion (
[0119] To assess whether the deletions of phuZ or orf93 impact growth in a strain-dependent manner, we challenged a panel of 21 P. aeruginosa clinical strains with phuZ and orf93 mutants to investigate whether these genes are dispensable for KZ replication in PAO1 but not elsewhere. Plaque assays showed that host ranges of both mutants were similar, if not identical, to WT (
[0120] The phage nucleus is primarily composed of gp54 [27]. We were unable to knockout or fluorescently label orf54, even when wild-type gp54 was provided by expressing from a plasmid in trans. The primers used to amplify the region of editing generated multiple bands for both deletion and tag-addition mutant variants (
Precise Genome Engineering of Clinical Phage OMKO1
[0121] We next explored the versatility of our phage engineering platform by editing the genome of a clinical jumbo phage. We selected OMKO1, a P. aeruginosa phage with an approximate 280 kbp genome that has 90.1% nucleotide sequence identity to KZ. OMKO1 is a potentially ideally therapeutic phage since P. aeruginosa strains that evolve resistance to infection become sensitized to small-molecule antibiotics. This phage has been used for phage therapy as emergency treatment for chronic infections caused by antibiotic-resistant P. aeruginosa38 and it is currently being tested in a phase I/II clinical trial (CYstic Fibrosis bacterioPHage Study at Yale, https://clinicaltrials.gov/ct2/show/NCT04684641). With this phage, we tested whether we could insert DNA barcodes without impacting host range for downstream clinical applications. Insertion of a DNA tracking signature into clinical phages would enable differentiation from naturally occurring phages during the manufacturing process and after administration to patients.
[0122] Two engineered OMKO1 strains were generated, one with acrVIA1 and a 120 nucleotide barcode inserted downstream of the capsid gene, and another with acrVIA1 integrated upstream of the shell gene (orf54 homologue;
Application of CRISPR-Cas13a Phage Engineering to Another Virulent Phage
[0123] To evaluate the applicability of the CRISPR-Cas13a-mediated genome editing approach to other virulent phages, we selected P. aeruginosa phage PaMx41. PaMx41 was isolated from environmental and sewage water samples in Central Mexico, and belongs to the Podoviridae family [34]. Its genome is approximately 43.5 kbp long and harbors 55 open reading frames (ORFs), 70% of which have unknown functions [35]. Remarkably, PaMx41 appeared to be resistant to many DNA-targeting CRISPR-Cas systems (Type IC, II-A, and V-A) and showed partial sensitivity (10-fold reduction in efficiency of plating) to Type I-F to a degree that is not sufficient for counter selection (
DISCUSSION
[0124] We exploited the RNA-targeting CRISPR-Cas13a system in conjunction with homologous recombination to achieve genetic modification of jumbo phage KZ and phage PaMx41 that all resist DNA-targeting CRISPR-Cas systems. CRISPR-Cas13a-mediated counter-selection recovered rare (10.sup.5) phage recombinants from a large pool of wild-type phages. Many studies have uncovered that phages can hamper CRISPR-Cas activities, for example, by repressing transcription of CRISPR-Cas components [36, 37], possessing covalent DNA modifications [38-41], or encoding anti-CRISPR proteins (recently reviewed in [42]). Furthermore, the assembly of a proteinaceous nucleus-like structure that shields phage genomes from attack by distinct DNA-targeting nucleases [19, 20] represents the ultimate anti-CRISPR/anti-RM mechanism. Therefore, development of a phage genomic manipulation approaches that target a relatively constant and exposed molecule, mRNA, with Cas13a may provide a near-universal approach. Moreover, Cas13 is rarely encoded in bacteria and thus most phages are not expected to encode anti-Cas13a proteins.
[0125] One major challenge of using Cas13a in our experience has been the wide variability of crRNA efficacy, which is likely due to numerous factors. Future studies focusing on the optimization of crRNA design or perhaps the implementation of other Cas13 enzymes or Cas7-11 [43, 44] will be important. However, we circumvent this problem by implementing an anti-CRISPR selectable marker [45] to ensure that the same strong guide can be used for all genetic manipulations. The downside is that this limits the user to a single perturbation, however, double and triple mutants are possible in principle if one designs and optimizes crRNAs to target the specific sites that await editing and instead of inserting an acr marker, alters the protospacer sequence during manipulation.
[0126] Deletion of a specific phage gene allows us to study its biological function. Here, we observed that phuZ mutant mispositioned the phage nucleus during viral intracellular development. Previous studies revealed that newly assembled phage capsids trafficked along PhuZ filaments towards the phage nucleus for viral DNA packaging [28]. However, our work suggests that capsid translocation is not dependent on PhuZ. Moreover, loss of PhuZ appeared not to affect burst size, in contrast with a previous report using over-expression of a catalytic mutant and microscopy to estimate burst size [29]. Overall, phuZ seems to be a bona fide nonessential gene for KZ. The evolutionary advantage of encoding this tubulin in this jumbophage and many others requires further investigation. Furthermore, an endogenous fluorescent label on gp93 demonstrated that it is packaged in the phage head, ejected with the genome, and massively synthesized later in infection, with peri-nuclear localization. The labeling not only allows us to visualize individual virions under the microscope, but also to observe the injection of this inner body protein into the host cell, which had been previously proposed with little evidence [32, 46].
[0127] Altogether, the RNA-targeting CRISPR-Cas13a counter-selection tool should be applicable to a broad range of phages and enable downstream high throughput genetic approaches for phage engineering. The ability to precisely and efficiently generate synthetic phages with desired features will not only benefit phage therapeutic applications but also advance our understanding of fundamental phage biology and phage-bacteria interactions.
Materials and Methods
Strains, DNA Oligonucleotides and Plasmid Constructions
[0128] All bacterial and phage strains, spacer sequences, and primers used in this study are listed in Tables 1-5.
[0129] The crRNAs designed for CRISPR-Cas13 targeting were constructed in the pHERD30T backbone. The pHERD30T-crRNA Version 2 was constructed by thermal annealing of oligonucleotides oSDM465 and oSDM466 and phosphorylation by polynucleotide kinase (PNK). The annealed product was introduced by Gibson assembly into pHERD30T linearized by PCR using oligonucleotides oSDM457 and oSDM458. Proper construction of the expression vector was verified by Sanger sequencing. The pHERD30T-crRNA Version 3 was constructed just as for Version 2, but the crRNA-coding insert was instead composed of oligonucleotides oSDM455 and oSDM456. Both Version 2 and Version 3 of this plasmid were designed such that cleavage by BsaI would generate a linear plasmid that would accept annealed oligonucleotide spacers via ligation. Oligonucleotide pairs with repeat-specific overhangs encoding spacer sequences were annealed and phosphorylated using T4 polynucleotide kinase and then cloned into the BsaI-digested empty vectors. Cloning procedures were performed in commercial E. coli DH5a cells (New England Biolabs) according to the manufacturer's protocols. The resulting crRNA plasmids were electroporated into P. aeruginosa PAO1 strain harboring the tn7::cas13aLse (SDM084) on the chromosome as described previously [19]. Gene expression was induced by the addition of L-arabinose at a final concentration of 0.3% and isopropyl -D-1-thiogalactopyranoside (IPTG) at a final concentration of 1 mM.
[0130] To construct template plasmids for homologous recombination, homology arms of >500 bp in length were amplified by PCR using the KZ genomic DNA as the template. To prevent Cas13a cleavage, several synonymous mutations were introduced into the crRNA-targeting site of the left orf120 homology arm by designing the reverse primer (JG064) to contain appropriate mismatches. The acrVIA1 gene was amplified from plasmid pAM383 [23], a gift from Luciano Marraffini, The Rockefeller University. PCR products were purified and assembled as a recombineering substrate and then inserted into the NheI site of the pHERD30T backbone by Gibson Assembly (New England Biolabs) following the manufacturer's protocols. The resulting plasmids were transformed into PAO1 by electroporation.
Isolation of Phage Recombinants
[0131] Host strains bearing recombination plasmids were grown in LB supplemented with 10 mM MgSO4 and 50 g/ml gentamicin, at 37 C. with aeration at 250 rpm. When OD600 is around 2, Wild type KZ was added into the culture at a MOI (multiplicity of infection) of 1 to allow infection to occur for 18 hours. 2% volume of chloroform was added into the infection culture and left to shake gently on an orbital shaker at room temperature for 15 min, followed by centrifugation at 4,000g for 15 min to remove cell debris. The supernatant lysate was further treated with 2% of chloroform for 15 min and centrifuged again under the same conditions, followed by a 30-min treatment with DNase I (New England Biolabs) at 37 C. The resulting phage lysate containing both WT phages and recombinants are tittered on PAO1 strains bearing the CRISPR-Cas13a system with the most efficient crRNA (orf120 guide #2) to screen for recombinants. Individual phage plaques were picked from top agar and purified for three rounds using the CRISPR counter-selection strain to ensure thorough removal of any remaining WT or escapers. Whether or not they are recombinant phages or Cas13a escaper phages were determined by PCR using appropriate pairs of primers amplifying the modified regions of the phage genome. Identified phages were further confirmed and analyzed by sequencing the PCR products or the whole genomes and then stored at 4 C.
Phage Plaque Assay
[0132] Host strains were grown in LBM (LB supplemented with 10 mM MgSO4), 50 g/ml gentamicin, 1 mM IPTG and 0.3% arabinose inducers for gene expression, at 37 C. with aeration at 250 rpm for overnight. Phage spotting assays were performed using 1.5% LB agar plates and 0.42% LB top agar, both of which contained 10 mM MgSO4 and inducers. 100 l of appropriate overnight culture was suspended in 3.5 ml of molten top agar and then poured onto an LB+10 mM MgSO4 agar plate, leading to the growth of a bacterial lawn. After 10-15 min at room temperature, 2 l of ten-fold serial dilutions of phages was spotted onto the solidified top agar. Plates were incubated overnight at 37 C. Plate images were obtained using Gel Doc EZ Gel Documentation System (BioRad) and Image Lab (BioRad) software.
Microplate Liquid Assay
[0133] Fresh overnight cultures were diluted to a cell concentration of 1108 cfu/ml in TSB media supplemented with 10 mM MgSO4. Phage lysates were added to reach a MOI of 1 and 0.01 in a Corning Costar 96-well clear flat-bottom microplate (Thermo Fisher Scientific) sealed with a Breathe-Easy sealing membrane (Merck KGaA). After the infection cultures were incubated at room temperature for 20 min, plates were incubated at 37 C., 800 rpm for 8 hours in a BioTek LogPhase 600 plate reader (Agilent Technologies, Inc.). Cell growth was monitored by measuring OD600 every 20 min. Each phage-host combination was performed in three biological replicates.
Data Analysis
[0134] Growth curves for each phage-host combination were obtained by plotting OD600 after blank correction (baseline adjustment) against time. Each growth curve was transformed into a single numerical value by calculating the area under the curve (AUC) using the Trapezoid method. Then, AUCs were normalized as a percentage of the AUC of their corresponding uninfected control following the equation,
The resulting value, defined as the liquid assay score, represents how well the phage strain can repress the growth of a bacterial population over the course of the 8-hour experiment. No inhibition of bacterial growth would result in a liquid assay score of 0, and complete suppression would translate into a score of 100. Liquid assay scores were averaged using data from three biological replicates.
Burst Size Measurement
[0135] Phage burst size was determined by one-step growth curve experiments. Briefly, the host PAO1 strain was grown in LBM to OD600 0.4. 1 ml of the cell culture was then centrifuged at 4,000g for 2 min and the cell pellet was resuspended in 50 l of fresh LBM. Appropriate amount of phages was mixed with the cell culture to achieve an MOI of 0.01 to limit to single infections. The mixture was incubated on ice for 20 min for phage adsorption and transferred to a 37 C. heat block for 10 min to trigger phage DNA injection. The infection mixture was centrifuged at 10,000g for 2 min. Transfer 10 l of the supernatant into 990 l of ice-cold SM buffer supplied with 2% chloroform. Titer to calculate the number of free phages. After discarding the supernatant to remove free phage particles, the pellet was resuspended in 1 ml of LBM, followed by incubation at 37 C. with shaking at 250 rpm. Samples were collected at 10-min intervals until 90 min, and phage titer was determined immediately. Phage burst sizes were calculated by dividing the phage titers at 50 min by the initial phage titers after subtracting free phages.
Single-Cell Infection Assay
[0136] 1 ml of host cells was grown in LBM (LB supplemented with 10 mM MgSO4) and 50 g/ml gentamicin (if necessary), at 37 C. with aeration at 250 rpm for overnight. The overnight culture was diluted 1:100 into 5 ml of LBM and grown at 37 C. with 250 rpm shaking until OD600 0.4. Next, 1 ml of cell culture was collected by centrifugation at 3,000g for 2 min at room temperature and concentrated by 25-fold in fresh LBM. 10 l of cells were then mixed with 10 l of appropriate phage strains to reach an appropriate MOI, followed by incubation at 30 C. for 10 min to allow for phage infection. The infection mixture was further diluted by 10-fold into 50 l of fresh LBM at room temperature. 1 l of the diluted culture was gently placed onto a piece of agarose pad (1 mm thick) with 1:5 diluted LBM, arabinose (0.8%), and DAPI (5 g/ml; Invitrogen& #153, No. D1306). A coverslip (No. 1.5, Fisher Scientific) was gently laid over the agarose pad and the sample was imaged under the fluorescence microscope at 30 C. within a cage incubator to maintain temperature and humidity.
Fluorescence Microscopy and Imaging
[0137] Microscopy was performed on an inverted epifluorescence (Ti2-E, Nikon, Tokyo, Japan) equipped with the Perfect Focus System (PFS) and a Photometrics Prime 95B 25-mm camera. Image acquisition and processing were performed using Nikon Elements AR software. During a time-lapse movie, the specimen was typically imaged at a time interval of 5 min at the focal plane for 2.5-3 h, through channels of phase contrast (200 ms exposure, for cell recognition), blue (DAPI, 200 ms exposure, for phage DNA), and green (GFP, 300 ms exposure, for Gp93-mNeonGreen).
Next-Generation Sequencing (NGS)
[0138] To isolate phage genomic DNA, purified high titer lysates were treated with Benzonase Nuclease (Sigma) for 30 min at 37 C. Phage genomic DNA was extracted with a modified Wizard DNA Clean-Up kit (Promega) protocol. DNA samples were quantified with AccuGreen Broad Range dsDNA quantification kit (Biotium, USA) in a Qubit Fluorometer 2.0.
[0139] Purified phage genomic DNA was processed following Illumina DNA Preparation Protocol. Samples were sequenced on a MiSeq system (Illumina) with 300 cycles of paired-end sequencing, and loading concentration of 12 pM. Illumina short reads were downsampled to 50-100 coverage and de novo assembled using SPAdes. The sequences of mutant phage strains were aligned to the reference genome in Geneious with the Mauve alignment algorithm to confirm the intended genomic edits.
[0140] The isolated orf54 pseudo knock-out phage strain (orf54) was sequenced using long-read sequencing. DNA samples were processed using SQK-LSK109 kit (Oxford Nanopore Technologies, UK). Libraries were sequenced using an R10.3 flow cell until the desired number of reads was achieved. Oxford Nanopore long reads were filtered for the longest high quality reads using Nanofilt and de novo assembled using Flye.
TABLE-US-00002 TABLE 1 Summary of phage mutants engineered by CRISPR-Cas13a. Gene No./ Identified screening Isolated Phage Genomic site protein Modification Plaque#.sup.1 % or not? KZ Upstream of orf54 Insertion 17 41.2% Yes Downstream of Insertion 16 50.0% orf120 orf39 PhuZ Deletion 17 52.9% orf93 Inner body Deletion 20 20.0% protein gp93-mNeonGreen 22 18.2% fusion orf241 Hypothetical Deletion 23 26.1% orf241, orf242 Hypothetical Double deletions 12 41.7% orf54 Shell Deletion 15 20.0% No mCherry-gp54 fusion 24 8.3% gp54-mCherry fusion 11 9.1% gfp11-gp54 fusion 57 7.0% orf89, orf90, Head Multiple deletions 17 11.8% orf91, orf92, orf93 structural proteins orf146 Structural Deletion 86 0.0% protein OMKO1 Downstream of Deletion 17 11.8% Yes the capsid gene Upstream of the Deletion 89 0% capsid gene PaMx41 orf24 Hypothetical Deletion 8 100.0% Yes .sup.1Number of plaques analyzed by PCR to screen for recombinants.
TABLE-US-00003 TABLE 2 Bacterial strains and phages used in this work. Name Description Source/Reference Bacterial strains PAO1 P. aeruginosa Lab collection SDM084 PAO1 tn7::Lse cas13a [19] BF# P. aeruginosa CF clinical Paul Turner Lab strains Phages KZ Alan Davidson Lab JBD30 Alan Davidson Lab OMKO1 Paul Turner Lab PaMx41 Gabriel Guarneros Pea at Centro de Investigacin y de Estudios Avanzados (KU884563)
TABLE-US-00004 TABLE3 SamplecrRNAsequencesusedinthiswork. SEQ ID Phage Target Type NO: Sequence(5-3) JBD30 orf38 VI-A 3 acgccaatctctgctacgacggtc KZ orf54 VI-A 4 tcaaactcaagctactgctcctgc 5 atgctcgttcagcagatgccctac 6 ggtatggctggtctactcattgtt orf120 7 cttaagccgtgagctggaaagggt 8 gctgatcttaagccgtgagctgga 9 agcttgctgatcttaagccgtgag orf146 10 ttcatactgggttgaaactaatga 11 ggcttctgcatttgaagattatgt PaMx41 orf11 VI-A 12 ccaccctgaatcctcaagaactca 13 agactggtcgtatctcggctgcta 14 aaagagcgcgtatatctgaccgcc 15 gtcaagcgtcagactggtcgtatc 16 tcaatcttaccgtcaagcgtcaga 17 ctcggctgctatcatcgctgcgaa orf04 I-C 18 tgatacgaaggaaattgtcgcaattggcgataga orf28 19 atttctgactttaatagggaggccgaattccata orf14 I-F 20 tctcagcgtaatagtcctgtttcttctggcag orf42 21 ttcttctatttctcccagaatctttccgcaat orf06 II-A 22 tttattactgttgaccctgc orf20 23 tttccagcatagttctatac orf23 V 24 tggagaatgaagaaggtaaggta orf46 25 agaatatgccttgcataggatag
TABLE-US-00005 TABLE4 SEQID ID NO: Description Name Sequence(5-3) JG003 26 mNeonGreen mGreen-F CCAATATTCTCGAGGGTGGCGGTGGCTCGATGGTGAGCAAGGGCG JG004 27 mGreen-pHERD-R GACTCTAGAGGATCCCCGGGTACCTTACTTGTACAGCTCGTCC JG010 28 gp93 IB3-SacI-F AGCATCGAATTCGAGCTCCATGTCTCTACTTAAAATGCT JG011 29 IB3-XhoI-R AGCATCCTCGAGCTTCTCATCATTCTCAGGTG JG075 30 H1forinsertion pHERD-gp120H1-F CCATGGGATCTGATAAGAATTCCCTAGGGTAATGCGTCCGACCTATCG JG064 31 atgp1203UTR gp120-muH1stop-R GATCATTTTTTATTCCTACGTAGGCTCGAGCTAAGGTTTTAAGTCGGCAA GCTTACC JG029 32 H2forinsertion gp120-H2-KpnI-F AGCATCGGTACCCATATGGCTGGAAAGGGTTACCGTTA JG030 33 atgp1203UTR gp120-H2-SalI-R AGCATCGTCGACCAACAAAACGTGAGACAGGG JG046 34 Checkinsertion CheckFP-inphage-R AGTGCTTCTTCTTCTGGACTAAGTC JG047 35 atgp1203UTR CheckFP-inphage-F GTGGTACTATCAGCCTATCCAAAGG JG065 36 AcrVIA1 AcrVIA1-XhoI-F AGGCCCCTCGAGCCTACGTAGGAATAAAAAATGATCTACTATATAAAAG JG066 37 AcrVIA1-NdeI-R CGGCCCCATATGTTAATTTAGCTCCTCTTTTA JG088 38 Checkthe AcrVIA1-mid-F TCCGTTCGCTCCCGATACGA existanceof AcrVIA1 JG095 39 H1formCherry- pHERD-Op24NheI-F GCCTTTTGCTGGCCTTTTGCTCACATAAGTTGAAGACCCGCCACTATATTT gp54fusion AGG JG096 40 Op24H1-AcrVIA-R CACTTTTAAATCTTTTATATAGTAGATCATTTTAAATACCTTTACGATTAT GG JG097 41 AcrVIA1for Op24H1-AcrVIA-F CAAGAAACCATAATCGTAAAGGTATTTAAAATGATCTACTATATAAAAG mCherry-gp54 A JG098 42 fusion AcrVIA-mCherry-R CACCATTTTTTATTCCTACGTAGGCCTAGGTTAATTTAGCTCCTCTTTTA JG099 43 H2formCherry- AcrVIA-mCherry-F AATTAACCTAGGCCTACGTAGGAATAAAAAATGGTGAGCAAGGGCGAGG gp54fusion A JG100 44 pHERD-gp54NheI-R TGCTCTGCGAGGCTGGCCGATAAGCTAGATGTGGGTCGCAATAGAGAAC GGAG JG104 45 H1forgp54- pHERD-gp54end-F GCCTTTTGCTGGCCTTTTGCTCACATAAGGAGCAAGTCATCCTAGATGCA JG105 46 gfp11fusion gp54end-gfp11-R CATGTGGTCACGCGAGCCGCCCGACCCGCCGTACCAGGTACCCGGTGCA T JG106 47 H2forgp39 KO39H2-F ATTAACTTATACTGGAGCCCTTCGG JG107 48 deletion pHERD-KO39H2-R TGCTCTGCGAGGCTGGCCGATAAGCTAGCTTTTTAGCAGTGTTCTTTGCC JG050 49 Checkgp54 gp54-mid-R CAGTGGTCGGAGTCCAATGTAGATC JG108 50 editing Check-recomb54-F AGTTTGAGGACCAAGTGTAACACC JG118 51 Check-KO54-R GTGGGTTAATTAGGCTACGTACGTG JG110 52 gp54 pHERD-gp54NheI-F GCCTTTTGCTGGCCTTTTGCTCACATAAGCTGCATTTTATAAAAATACTG JG111 53 pHERD-gp54NheI-R TGCTCTGCGAGGCTGGCCGATAAGCTAGTTAGTACCAGGTACCCGGT JG127 54 gp54-PstI-F AGCATCCTGCAGATGGCTGTTAACGAAAACGA JG128 55 gp54-SacI-R AGCGTCGAGCTCTTAGTACCAGGTACCCGGTGCATTATAG JG112 56 AcrVIA1for AcrVIA-Op24H2-R TAACATCCCTATCTACCGAGGTATTTCCTATTAATTTAGCTCCTCTTTTA gp54deletion (pairwith JG097) JG113 57 H2forgp54 AcrVIA-Op24H2-F GCAAACAAATTTTAAAAGAGGAGCTAAATTAATAGGAAATACCTCGGTA deletion GATAGG JG114 58 pHERD-Op24H2NheI-R TGCTCTGCGAGGCTGGCCGATAAGCTAGCTTTCTCATCTGAGTTAC JG119 59 H2forgp93 KO93H2-F CAAACATAATGAGGAACCCTTCGG JG120 60 deletion pHERD-KO93H2-R TGCTCTGCGAGGCTGGCCGATAAGCTAGCATAAAAGCAGCTGATTGTTTA JG121 61 Checkgp93 Check-KOgp93-R AGTTAGTACACGCTGTGCCGCT deletion JG122 62 gp39 pHERD-gp39-NheI-F GCCTTTTGCTGGCCTTTTGCTCACATAAGATTATATTAATCACAATGAGG JG123 63 pHERD-gp39-NheI-R TGCTCTGCGAGGCTGGCCGATAAGCTAGTTAATCGAATACAAGACCACT ACT JG124 64 H1forgp241- pHERD-KO2412-H1Acr-F GCCTTTTGCTGGCCTTTTGCTCACATAAGTTAAATAAAGATAACTTCTTTT gp242deletion C JG125 65 KO2412-H1Acr-R CCTTTTAGTTAATTTAATTTAGCTCCTCTTTTAAAATTTG JG126 66 Checkgp241- Check-KO2412-R GGCTAAGTCTTTTTCTCGATACTGG gp242deletion JG133 67 Operon#24 pHERD-Op24NheI-F GCCTTTTGCTGGCCTTTTGCTCACATAAGTACGTGACGGAGCATTCTTAA ATA JG134 68 pHERD-Op24NheI-R TGCTCTGCGAGGCTGGCCGATAAGCTAGCCCGAAGGAGCCGCTATATCA G JG135 69 H1forinsertion Omk-capH1-GibsonF GCCTTTTGCTGGCCTTTTGCTCACATAAGATCGAAGGCGCACTATCCGCT atthe3UTRof G JG136 70 thecapsidgene Omk-capmuHl-GibsonR GATCATTTTTTATTCCTACGTAGGGCTAGCCTAAGGTTTTAAGTCGGCAA inOMKO1 GCTTACC JG137 71 H1forinsertion pHERD-Op24InH1-F GCCTTTTGCTGGCCTTTTGCTCACATAAGGGAGCATTCTTAAATAAATTA JG138 72 atgp545UTR Op24InH1-RBS-R GATCATTGTATATTCCTATTTGTAATCTCGAGCGTAACGAACACTATGTT JG139 73 AcrVIA1for gp53RBS-AcrVIA1-F CTCGAGATTACAAATAGGAATATACAATGATCTACTATATAAAAGA insertionatgp54 JG140 74 5UTR AcrVIA1-Op24InH2-R CGCTATAATCTGCTATCAGCAGATCCTAGGTTAATTTAGCTCCTCTTTTA JG141 75 H2forinsertion AcrVIA1-Op24InH2-F AGGAGCTAAATTAACCTAGGATCTGCTGATAGCAGATTATAGCG JG142 76 atgp545UTR pHERD-Op24InH2-R TGCTCTGCGAGGCTGGCCGATAAGCTAGGTTGTAACGGTTCCGTAG JG146 77 H1forgp146 pHERD-KOgp146H1-F GCCTTTTGCTGGCCTTTTGCTCACATAAGAGCTATTGCAAATGCGGTACC JG147 78 deletion KOgp146H1-AcrR TAGATCATTTTTATTTCCTTGCTGTATAAGAACATTATACTACTTCCTCAA GTTCG JG148 79 Checkgp146 Check-gp146edit-R AATCTATCCCAGTTCAAGCTAAGCC deletion JG152 80 AcrVIA1for gp145RBS-AcrVIA1-F TTCTTATACAGCAAGGAAATAAAAATGATCTACTATATAAAAGAT JG153 81 gp146deletion AcrVIA1-Op63InH2-R GGAGGGCAATATGTCGTTTTAATTTAGCTCCTCTTTTAAAAT JG154 82 H2forgp146 AcrVIA1-Op63InH2-F AAAGAGGAGCTAAATTAAAACGACATATTGCCCTCCCTTCGG JG155 83 deletion pHERD-Op63InH2-R TGCTCTGCGAGGCTGGCCGATAAGCTAGATTCCATTTATTATTCAATTAA TAGCT JG156 84 gp146 pMMB-gp146-GbF GGAAACAGAATTAATTAAGCTTGCATGCCTGCAGATGGCTTCTGCATTTG AAGA JG157 85 pMMB-gp146-GbR CCGCCAAAACAGCCAAGCTGAATTCGAGCTCTTAAATAACAGCACCTTT GG JG160 86 H2forgp241 AcrVIA1-KO241H2-F CAAACAAATTTTAAAAGAGGAGCTAAATTAATAAGAGCATATGGCCCTC deletion CCTTCGG JG161 87 pHERD-KO241H2-R TGCTCTGCGAGGCTGGCCGATAAGCTAGTAATAGTGGTATTAACTTGTAG JG162 88 Checkgp241 Check-KOgp241-R CGGGTGTAATCGTACGTAGATCAATCGC deletion JG166 89 H2forgp241- KO2412-H2-F GAGGAGCTAAATTAAATTAACTAAAAGGTAAAAAAATGAATAATC JG167 90 gp242deletion pHERD-KO2412-H2-R TGCTCTGCGAGGCTGGCCGATAAGCTAGCATCCTTATTATGGAAGCTATA JG168 91 Checkorf24 Check-PaM24-R CTCGTGGTGATGTTAACCCTAGGG JG169 92 deletionin Check-PaM24-F CAACTCTGAATTCCGAACTGAGGCC PaMx41 JG170 93 Checkgp93 Check-KOgp93-F ACTCTTGTATATCCAATCTGTAGCGG deletion JG173 94 gp39 gp39-SacI-F ACCCATGGGATCTGATAAGAATTCGAGCTCATGATGTCTAAAGTAAAAA CTCG JG174 95 gp39-KpnI-R CAGGTCGACTCTAGAGGATCCCCGGGTACCTTAATCGAATACAAGACCA CTACT JG175 96 H1for pHERD-KOop42H1-F GCCTTTTGCTGGCCTTTTGCTCACATAAGTAACCTACCTTCTTTTACTAAT Operon#42 GCAGAATAG JG176 97 deletion KOop42H1-R CTTTTAAATCTTTTATATAGTAGATCATTTTTCTCTTCCTATATGGGTTTGC AGAG JG178 98 gfp1-10 pHERD-gfp10-GbF ACCCATGGGATCTGATAAGAATTCGAGCTCATGGTGAGCAAGGGCGAGG A JG179 99 pHERD-gfp10-GbR GGCCAGTGCCAAGCTTGCATGCCTGCAGCTTCTCGTTGGGGTCTTTGCTC JG180 100 Checkgfp11- gfp11-mid-F TGGTCCTTCATGAGTATGTAAATGC gp54andgp54- gfp11fusion JG181 101 Checkgp39 Check-KOgp39-R CTTCAGCCCATTTGTCTACCCG deletion JG182 102 H1forgp93- gp93-mNGH1-Gb-F GCCTTTTGCTGGCCTTTTGCTCACATAAGAATCCGAAGACTATTGCAGAC mNeonGreen TTCA JG183 103 fusion gp93-mNGH1-Gb-R CTATATGGGTTTGCGGTTCCTCATTATGTTTGTTATTACTTGTACAGCTCG TCCAT JG186 104 Check Check-KOop42-F CACCAATAAAGTCACCAGTACGTCC Operon#42 deletion JG187 105 Checkgp93- gp93-mid-F GCCCTAGCTGATTGGAATCCTGACG mNeonGreen fusion oSDM455 106 pHERD30T- Lse_crRNA_V3_Top ACTCTCTACTGTTTCTCCATGGTAAGAGACTACCTCTATATGAAAGAGGA crRNAVersion CTAAAACCGA oSDM456 107 3 Lse_crRNA_V3_Bot CGGGTACCGAGCTCGAATTCGAGACCGTACGTACGTGGTCTCGGTTTTAG TCCTCTTTCA oSDM457 108 pHERD30T- p30T_TSS-R ATGGAGAAACAGTAGAGAGTTG oSDM458 109 crRNAVersion p30T_TSS-F GAATTCGAGCTCGGTACC oSDM465 110 2 LseCas13crRNAV2F ACTCTCTACTGTTTCTCCATGGTAAGAGACTACCTCTATATGAAAGAGGA CTAAAACCGAGACCACGTACGTACGGTC oSDM466 111 LseCas13crRNAV2R CGGGTACCGAGCTCGAATTCGTTTTTGTGGAGATTCATATTCTCCAAGTC TCTTACCGGAGACCGTACGTACGTGGTC
TABLE-US-00006 TABLE 5 Host range assay of engineered OMKO1 variants. Phage OMKO1 OMKO1::Acr OMKO1::Acr-BC Host PA01 85 93 87 93 85 94 FB-4 25 35 25 37 25 33 FB-5 1 5 2 4 2 6 FB-15 0 2 0 2 0 5 FB-19 62 73 69 77 69 77 FB-52 89 93 91 94 90 94 FB-62 88 95 89 94 86 93 FB-63 0 59 0 59 0 60 FB-66 68 87 70 87 48* 86 FB-68 4 23 4 21 3 21 FB-71 9 59 10 60 4* 46* FB-72 3 13 6 14 4 14 FB-78 81 91 83 91 80 91 FB-81 79 92 81 93 79 92 FB-83 79 86 73 87 67 86 FB-87 4 42 5 43 1 30* FB-89 1 34 1 52* 1 62* FB-92 0 37 2 55* 2 64* FB-94 8 93 6 93 8 93 FB-96 84 94 86 94 85 93 FB-98 80 92 83 92 76 91 FB-99 85 93 85 93 84 92 0.01 1 0.01 1 0.01 1 MOI Host ranges were determined by microplate liquid assay at MOI of 0.01 and 1 on 22 P. aeruginosa clinical strains. The values are presented as the mean liquid assay scores across three independent experiments. Asterisks (*) indicate significant difference between WT and engineered strains as determined by Students' T-test (p < 0.05). The color intensity of each phage-host combination reflects the liquid assay score, which represents how well the phage strain can repress the growth of a given bacterial host. No inhibition of bacterial growth is reflected by a liquid assay score of 0, and complete suppression would result in a score of 100.
REFERENCES
[0141] 1. Kortright, K. E., Chan, B. K., Koff, J. L., and Turner, P. E. (2019). Phage Therapy: A Renewed Approach to Combat Antibiotic-Resistant Bacteria. Cell Host Microbe 25, 219-232. [0142] 2. Pires, D. P., Cleto, S., Sillankorva, S., Azeredo, J., and Lu, T. K. (2016). Genetically Engineered Phages: a Review of Advances over the Last Decade. Microbiol Mol Biol Rev 80, 523-543. [0143] 3. Doss, J., Culbertson, K., Hahn, D., Camacho, J., and Barekzi, N. (2017). A Review of Phage Therapy against Bacterial Pathogens of Aquatic and Terrestrial Organisms. Viruses 9. [0144] 4. Nobrega, F. L., Costa, A. R., Kluskens, L. D., and Azeredo, J. (2015). Revisiting phage therapy: new applications for old resources. Trends Microbiol 23, 185-191. [0145] 5. Lusiak-Szelachowska, M., Zaczek, M., Weber-Dabrowska, B., Miedzybrodzki, R., Klak, M., Fortuna, W., Letkiewicz, S., Rogoz, P., Szufnarowski, K., Jonczyk-Matysiak, E., et al. (2014). Phage Neutralization by Sera of Patients Receiving Phage Therapy. Viral Immunol 27, 295-304. [0146] 6. Weber-Dabrowska, B., Jonczyk-Matysiak, E., Zaczek, M., Lobocka, M., Lusiak-Szelachowska, M., and Gorski, A. (2016). Bacteriophage Procurement for Therapeutic Purposes. Front Microbiol 7, 1177. [0147] 7. Lu, T. K., and Koeris, M. S. (2011). The next generation of bacteriophage therapy. Curr Opin Microbiol 14, 524-531. [0148] 8. Lenneman, B. R., Fembach, J., Loessner, M. J., Lu, T. K., and Kilcher, S. (2020). Enhancing phage therapy through synthetic biology and genome engineering. Curr Opin Biotechnol 68, 151-159. [0149] 9. Ando, H., Lemire, S., Pires, D. P., and Lu, T. K. (2015). Engineering Modular Viral Scaffolds for Targeted Bacterial Population Editing. Cell Syst 1, 187-196. [0150] 10. Mahichi, F., Synnott, A. J., Yamamichi, K., Osada, T., and Tanji, Y. (2009). Site-specific recombination of T2 phage using IP008 long tail fiber genes provides a targeted method for expanding host range while retaining lytic activity. FEMS Microbiol Lett 295, 211-217. [0151] 11. Matsuda, T., Freeman, T. A., Hilbert, D. W., Duff, M., Fuortes, M., Stapleton, P. P., and Daly, J. M. (2005). Lysis-deficient bacteriophage therapy decreases endotoxin and inflammatory mediator release and improves survival in a murine peritonitis model. Surgery 137, 639-646. [0152] 12. Monteiro, R., Pires, D. P., Costa, A. R., and Azeredo, J. (2019). Phage Therapy: Going Temperate?Trends Microbiol 27, 368-378. [0153] 13. Kilcher, S., and Loessner, M. J. (2019). Engineering Bacteriophages as Versatile Biologics. Trends Microbiol 27, 355-367. [0154] 14. Marinelli, L. J., Hatfull, G. F., and Piuri, M. (2012). Recombineering: A powerful tool for modification of bacteriophage genomes. Bacteriophage 2, 5-14. [0155] 15. Deveau, H., Gameau, J. E., and Moineau, S. (2010). CRISPR/Cas system and its role in phage-bacteria interactions. Annu Rev Microbiol 64, 475-493. [0156] 16. Hille, F., Richter, H., Wong, S. P., Bratovic, M., Ressel, S., and Charpentier, E. (2018). The Biology of CRISPR-Cas: Backward and Forward. Cell 172, 1239-1259. [0157] 17. Samson, J. E., Magadan, A. H., Sabri, M., and Moineau, S. (2013). Revenge of the phages: defeating bacterial defences. Nat Rev Microbiol 11, 675-687. [0158] 18. Malone, L. M., Birkholz, N., and Fineran, P. C. (2020). Conquering CRISPR: how phages overcome bacterial adaptive immunity. Curr Opin Biotechnol 68, 30-36. [0159] 19. Mendoza, S. D., Nieweglowska, E. S., Govindarajan, S., Leon, L. M., Berry, J. D., Tiwari, A., Chaikeeratisak, V., Pogliano, J., Agard, D. A., and Bondy-Denomy, J. (2020). A bacteriophage nucleus-like compartment shields DNA from CRISPR nucleases. Nature 577, 244-248. [0160] 20. Malone, L. M., Warring, S. L., Jackson, S. A., Warnecke, C., Gardner, P. P., Gumy, L. F., and Fineran, P. C. (2020). A jumbo phage that forms a nucleus-like structure evades CRISPR-Cas DNA targeting but is vulnerable to type III RNA-based immunity. Nat Microbiol 5, 48-55. [0161] 21. Guan, J., and Bondy-Denomy, J. (2020). Intracellular Organization by Jumbo Bacteriophages. J Bacteriol 203. [0162] 22. Abudayyeh, O. O., Gootenberg, J. S., Konermann, S., Joung, J., Slaymaker, I. M., Cox, D. B., Shmakov, S., Makarova, K. S., Semenova, E., Minakhin, L., et al. (2016). C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector. Science 353, aaf5573. [0163] 23. Meeske, A. J., Jia, N., Cassel, A. K., Kozlova, A., Liao, J., Wiedmann, M., Patel, D. J., and Marraffini, L. A. (2020). A phage-encoded anti-CRISPR enables complete evasion of type VI-A CRISPR-Cas immunity. Science 369, 54-59. [0164] 24. Abudayyeh, O. O., Gootenberg, J. S., Essletzbichler, P., Han, S., Joung, J., Belanto, J. J., Verdine, V., Cox, D. B. T., Kellner, M. J., Regev, A., et al. (2017). RNA targeting with CRISPR-Cas13. Nature 550, 280-284. [0165] 25. Al-Shayeb, B., Sachdeva, R., Chen, L. X., Ward, F., Munk, P., Devoto, A., Castelle, C. J., Olm, M. R., Bouma-Gregson, K., Amano, Y., et al. (2020). Clades of huge phages from across Earth's ecosystems. Nature 578, 425-431. [0166] 26. Aylett, C. H., Izore, T., Amos, L. A., and Lowe, J. (2013). Structure of the tubulin/FtsZ-like protein TubZ from Pseudomonas bacteriophage PhiKZ. J Mol Biol 425, 2164-2173. [0167] 27. Chaikeeratisak, V., Nguyen, K., Egan, M. E., Erb, M. L., Vavilina, A., and Pogliano, J. (2017). The Phage Nucleus and Tubulin Spindle Are Conserved among Large Pseudomonas Phages. Cell Rep 20, 1563-1571. [0168] 28. Chaikeeratisak, V., Khanna, K., Nguyen, K. T., Sugie, J., Egan, M. E., Erb, M. L., Vavilina, A., Nonejuie, P., Nieweglowska, E., Pogliano, K., et al. (2019). Viral Capsid Trafficking along Treadmilling Tubulin Filaments in Bacteria. Cell 177, 1771-1780 e1712. [0169] 29. Kraemer, J. A., Erb, M. L., Waddling, C. A., Montabana, E. A., Zehr, E. A., Wang, H., Nguyen, K., Pham, D. S., Agard, D. A., and Pogliano, J. (2012). A phage tubulin assembles dynamic filaments by an atypical mechanism to center viral DNA within the host cell. Cell 149, 1488-1499. [0170] 30. Chaikeeratisak, V., Nguyen, K., Khanna, K., Brilot, A. F., Erb, M. L., Coker, J. K., Vavilina, A., Newton, G. L., Buschauer, R., Pogliano, K., et al. (2017). Assembly of a nucleus-like structure during viral replication in bacteria. Science 355, 194-197. [0171] 31. Wu, W., Thomas, J. A., Cheng, N., Black, L. W., and Steven, A. C. (2012). Bubblegrams reveal the inner body of bacteriophage phiKZ. Science 335, 182. [0172] 32. Thomas, J. A., Weintraub, S. T., Wu, W., Winkler, D. C., Cheng, N., Steven, A. C., and Black, L. W. (2012). Extensive proteolysis of head and inner body proteins by a morphogenetic protease in the giant Pseudomonas aeruginosa phage phiKZ. Mol Microbiol 84, 324-339. [0173] 33. Chan, B. K., Turner, P. E., Kim, S., Mojibian, H. R., Elefteriades, J. A., and Narayan, D. (2018). Phage treatment of an aortic graft infected with Pseudomonas aeruginosa. Evol Med Public Health 2018, 60-66. [0174] 34. Sepulveda-Robles, O., Kameyama, L., and Guarneros, G. (2012). High diversity and novel species of Pseudomonas aeruginosa bacteriophages. Appl Environ Microbiol 78, 4510-4515. [0175] 35. Cruz-Plancarte, I., Cazares, A., and Guarneros, G. (2016). Genomic and Transcriptional Mapping of PaMx41, Archetype of a New Lineage of Bacteriophages Infecting Pseudomonas aeruginosa. Appl Environ Microbiol 82, 6541-6547. [0176] 36. Skennerton, C. T., Angly, F. E., Breitbart, M., Bragg, L., He, S., McMahon, K. D., Hugenholtz, P., and Tyson, G. W. (2011). Phage encoded H-NS: a potential achilles heel in the bacterial defence system. PLoS One 6, e20095. [0177] 37. Pul, U., Wurm, R., Arslan, Z., Geissen, R., Hofmann, N., and Wagner, R. (2010). Identification and characterization of E. coli CRISPR-cas promoters and their silencing by H-NS. Mol Microbiol 75, 1495-1512. [0178] 38. Hampton, H. G., Watson, B. N. J., and Fineran, P. C. (2020). The arms race between bacteria and their phage foes. Nature 577, 327-336. [0179] 39. Vlot, M., Houkes, J., Lochs, S. J. A., Swarts, D. C., Zheng, P., Kunne, T., Mohanraju, P., Anders, C., Jinek, M., van der Oost, J., et al. (2018). Bacteriophage DNA glucosylation impairs target DNA binding by type I and II but not by type V CRISPR-Cas effector complexes. Nucleic Acids Res 46, 873-885. [0180] 40. Bryson, A. L., Hwang, Y., Sherrill-Mix, S., Wu, G. D., Lewis, J. D., Black, L., Clark, T. A., and Bushman, F. D. (2015). Covalent Modification of Bacteriophage T4 DNA Inhibits CRISPR-Cas9. mBio 6, e00648. [0181] 41. Liu, Y., Dai, L., Dong, J., Chen, C., Zhu, J., Rao, V. B., and Tao, P. (2020). Covalent Modifications of the Bacteriophage Genome Confer a Degree of Resistance to Bacterial CRISPR Systems. J Virol 94. [0182] 42. Davidson, A. R., Lu, W. T., Stanley, S. Y., Wang, J., Mejdani, M., Trost, C. N., Hicks, B. T., Lee, J., and Sontheimer, E. J. (2020). Anti-CRISPRs. Protein Inhibitors of CRISPR-Cas Systems. Annu Rev Biochem 89, 309-332. [0183] 43. van Beljouw, S. P. B., Haagsma, A. C., Rodriguez-Molina, A., van den Berg, D. F., Vink, J. N. A., and Brouns, S. J. J. (2021). The gRAMP CRISPR-Cas effector is an RNA endonuclease complexed with a caspase-like peptidase. Science 373, 1349-1353. [0184] 44. Ozcan, A., Krajeski, R., Ioannidi, E., Lee, B., Gardner, A., Makarova, K. S., Koonin, E. V., Abudayyeh, O. O., and Gootenberg, J. S. (2021). Programmable RNA targeting with the single-protein CRISPR effector Cas7-11. Nature 597, 720-725. [0185] 45. Mayo-Munoz, D., He, F., Jorgensen, J. B., Madsen, P. K., Bhoobalan-Chitty, Y., and Peng, X. (2018). Anti-CRISPR-Based and CRISPR-Based Genome Editing of Sulfolobus islandicus Rod-Shaped Virus 2. Viruses 10. [0186] 46. Krylov, V. N., Smirnova, T. A., Minenkova, I. B., Plotnikova, T. G., Zhazikov, I. Z., and Khrenova, E. A. (1984). Pseudomonas bacteriophage phi KZ contains an inner body in its capsid. Can J Microbiol 30, 758-762.
[0187] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, one of skill in the art will appreciate that certain changes and modifications may be practiced within the scope of the appended claims. In addition, each reference provided herein is incorporated by reference in its entirety to the same extent as if each reference was individually incorporated by reference.