DISRUPTION OF CDC42 EFFECTORS IN YEAST FOR INCREASED ALCOHOL AND LYSINE PRODUCTION
20250154535 ยท 2025-05-15
Inventors
Cpc classification
C10L2200/0469
CHEMISTRY; METALLURGY
C12P13/08
CHEMISTRY; METALLURGY
C10L2290/26
CHEMISTRY; METALLURGY
C10L1/02
CHEMISTRY; METALLURGY
International classification
C10L1/02
CHEMISTRY; METALLURGY
Abstract
Described are compositions and methods relating to yeast having a genetic mutation that results in decreased amounts of Cdc42 effector proteins, resulting in increased alcohol and lysine production. Such yeast is well-suited for use commercial alcohol production to increase yields and to increase the value of Such yeast is well-suited for use commercial alcohol production to increase yields and to increase the value of amino-acid-containing, fermentation-co-products.
Claims
1. A method for producing a modified yeast cell comprising: introducing a genetic alteration into a parental yeast cell, which genetic alteration reduces or prevents the production of functional Cdc42 effector polypeptides compared to the parental cells, thereby producing modified yeast cells that produce during fermentation an increased amount of alcohol and/or lysine compared to the parental cells under equivalent fermentation.
2. The method of claim 1, wherein the genetic alteration reduces or prevents the production of functional Gic1 and/or Gic2 polypeptides compared to the parental cells.
3. The method of claim 1, wherein the modified yeast cells produce a reduced amount, or do not produce a measurable amount of, Gic1 and/or Gic2 polypeptides.
4. The method of any one of claims 1-3, wherein the genetic alteration comprises a disruption of a YHR061c gene, or homolog, thereof, encoding a Gic1 polypeptide and/or disruption of a YDR309c gene, or homolog, thereof, encoding a Gic2 polypeptide, present in the parental cells.
5. The method of claim 4, wherein the disruption is the result of deletion of all or part of the YHR061c gene, or homolog, thereof, and/or a YDR309c gene, or homolog, thereof, respectively.
6. The method of claim 4, wherein the disruption is the result of deletion of a portion of genomic DNA comprising the YHR061c gene, or homolog, thereof, and/or the YDR309c gene, or homolog, thereof, respectively.
7. The method of claim 4, wherein the disruption is the result of mutagenesis of the YHR061c gene, or homolog, thereof, and/or the YDR309c gene, or homolog, thereof, respectively.
8. The method of any one of claims 4-7, wherein disruption of the YHR061c gene, or homolog, thereof, and/or the YDR309c gene, or homolog, thereof, respectively, is performed in combination with introducing a gene of interest at a corresponding genetic locus.
9. The method of any one of claims 1-8, wherein the modified yeast cells further comprise one or more genes of the phosphoketolase pathway.
10. The method of claim 9, wherein the genes of the phosphoketolase pathway are selected from the group consisting of phosphoketolase, phosphotransacetylase and acetylating acetyl dehydrogenase.
11. The method of any one of claims 1-10, wherein the modified yeast cells further comprise an exogenous gene encoding a carbohydrate processing enzyme.
12. The method of any one of claims 1-11, wherein the modified yeast cells further comprise an alteration in the glycerol pathway and/or the acetyl-CoA pathway.
13. The method of any one of claims 1-12, wherein the modified yeast cells further comprise an alternative pathway for making ethanol.
14. The method of any of claims 1-13, wherein the modified yeast cells are of a Saccharomyces spp.
15. A method for increasing the amount of lysine present in a post-fermentation product, comprising: (i) hydrolyzing a starch-containing feedstock with an -amylase to produce a starch liquefact; (ii) saccharifying the starch liquefact with a glucoamylase to produce glucose; (iii) fermenting the glucose with modified yeast cells derived from parental yeast cells, the modified yeast cells comprising a genetic alteration that causes the production of decreased amounts of functional Cdc42 effector polypeptides compared to the parental cells; and (iv) recovering a post-fermentation by-product enriched for lysine compared to post-fermentation by-product recovered from an otherwise identical process using the parental yeast.
16. The method of claim 15, wherein the post-fermentation by-product is selected from the group consisting of fermentation broth, whole stillage, thin stillage, distillers dried grains, distillers dried grains with solutes, condensed distillers solubles or other protein-containing coproducts.
17. The method of claim 15 or claim 16, wherein one or more steps (i)-(iv) are combined, simultaneous or over-lapping.
18. A method for increasing the amount of lysine present in a fermentation product, comprising: (i) fermenting glucose or another sugar with modified yeast cells derived from parental yeast cells, the modified yeast cells comprising a genetic alteration that causes the production of decreased amounts of functional Cdc42 effector polypeptides compared to the parental cells; and (ii) recovering fermentation product enriched for lysine compared to a fermentation product recovered from an otherwise identical process using the parental yeast.
19. Modified yeast cells produced by the method of any of claims 1-14.
20. A fermentation product produced by the method of claim 18.
21. A post-fermentation by-product produced by the method of any one of claims 15-17.
Description
DETAILED DESCRIPTION
I. Overview
[0044] Described are methods relating to yeast having a genetic mutation that results in decreased amounts of Cdc42 effector (or target) proteins, resulting in increased alcohol and lysine production. Such yeast is well-suited for use in commercial alcohol production to increase yields and to increase the value of amino-acid-containing, fermentation products and co-products.
II. Definitions
[0045] Prior to describing the present strains and methods in detail, the following terms are defined for clarity. Terms not defined should be accorded their ordinary meanings as used in the relevant art.
[0046] As used herein, alcohol refers to an organic compound in which a hydroxyl functional group (OH) is bound to a saturated carbon atom.
[0047] As used herein, the phrase degree of polymerization (DP) refers to the number (n) of anhydroglucopyranose units in a given saccharide. Examples of DP1 are the monosaccharides glucose and fructose. Examples of DP2 are the disaccharides maltose and sucrose. The meaning of DP1, DP12, DP3, DP4, DP4+ etc. is well known in science of carbohydrate processing.
[0048] As used herein, yeast cells yeast strains, or simply yeast refer to organisms from the phyla Ascomycota and Basidiomycota. Exemplary yeast is budding yeast from the order Saccharomycetales. Particular examples of yeast are Saccharomyces spp., including but not limited to S. cerevisiae. Yeast include organisms used for the production of fuel alcohol as well as organisms used for the production of potable alcohol, including specialty and proprietary yeast strains used to make distinctive-tasting beers, wines, and other fermented beverages.
[0049] As used herein, the phrase variant yeast cells, modified yeast cells, or similar phrases (see above), refer to yeast that include genetic modifications and characteristics described herein. Variant/modified yeast do not include naturally occurring yeast.
[0050] As used herein, the phrase substantially free of an activity, or similar phrases, means that a specified activity is either undetectable in an admixture or present in an amount that would not interfere with the intended purpose of the admixture.
[0051] As used herein, the terms polypeptide and protein (and their respective plural forms) are used interchangeably to refer to polymers of any length comprising amino acid residues linked by peptide bonds. The conventional one-letter or three-letter codes for amino acid residues are used herein and all sequence are presented from an N-terminal to C-terminal direction. The polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art.
[0052] As used herein, functionally and/or structurally similar proteins are considered to be related proteins. Such proteins can be derived from organisms of different genera and/or species, or even different classes of organisms (e.g., bacteria and fungi). Related proteins also encompass homologs determined by primary sequence analysis, determined by secondary or tertiary structure analysis, or determined by immunological cross-reactivity.
[0053] As used herein, the term homologous protein refers to a protein that has similar activity and/or structure to a reference protein. It is not intended that homologs necessarily be evolutionarily related. Thus, it is intended that the term encompass the same, similar, or corresponding enzyme(s) (i.e., in terms of structure and function) obtained from different organisms. In some embodiments, it is desirable to identify a homolog that has a quaternary, tertiary and/or primary structure similar to the reference protein. In some embodiments, homologous proteins induce similar immunological response(s) as a reference protein. In some embodiments, homologous proteins are engineered to produce enzymes with desired activity(ies).
[0054] The degree of homology between sequences can be determined using any suitable method known in the art (see, e.g., Smith and Waterman (1981) Adv. Appl. Math. 2:482; Needleman and Wunsch (1970) J. Mol. Biol., 48:443; Pearson and Lipman (1988) Proc. Natl. Acad. Sci. USA 85:2444; programs such as GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group, Madison, WI); and Devereux et al. (1984) Nucleic Acids Res. 12:387-95).
[0055] For example, PILEUP is a useful program to determine sequence homology levels. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair-wise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle, (Feng and Doolittle (1987) J. Mol. Evol. 35:351-60). The method is similar to that described by Higgins and Sharp ((1989) CABIOS 5:151-53). Useful PILEUP parameters including a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps. Another example of a useful algorithm is the BLAST algorithm, described by Altschul et al. ((1990) J. Mol. Biol. 215:403-10) and Karlin et al. ((1993) Proc. Natl. Acad. Sci. USA 90:5873-87). One particularly useful BLAST program is the WU-BLAST-2 program (see, e.g., Altschul et al. (1996) Meth. Enzymol. 266:460-80). Parameters W, T, and X determine the sensitivity and speed of the alignment. The BLAST program uses as defaults a word-length (W) of 11, the BLOSUM62 scoring matrix (see, e.g., Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M5, N-4, and a comparison of both strands.
[0056] As used herein, the phrases substantially similar and substantially identical, in the context of at least two nucleic acids or polypeptides, typically means that a polynucleotide or polypeptide comprises a sequence that has at least about 70% identity, at least about 75% identity, at least about 80% identity, at least about 85% identity, at least about 90% identity, at least about 91% identity, at least about 92% identity, at least about 93% identity, at least about 94% identity, at least about 95% identity, at least about 96% identity, at least about 97% identity, at least about 98% identity, or even at least about 99% identity, or more, compared to the reference (i.e., wild-type) sequence. Percent sequence identity is calculated using CLUSTAL W algorithm with default parameters. See Thompson et al. (1994) Nucleic Acids Res. 22:4673-4680. Default parameters for the CLUSTAL W algorithm are: [0057] Gap opening penalty: 10.0 [0058] Gap extension penalty: 0.05 [0059] Protein weight matrix: BLOSUM series [0060] DNA weight matrix: IUB [0061] Delay divergent sequences %: 40 [0062] Gap separation distance: 8 [0063] DNA transitions weight: 0.50 [0064] List hydrophilic residues: GPSNDQEKR [0065] Use negative matrix: OFF [0066] Toggle Residue specific penalties: ON [0067] Toggle hydrophilic penalties: ON [0068] Toggle end gap separation penalty OFF.
[0069] Another indication that two polypeptides are substantially identical is that the first polypeptide is immunologically cross-reactive with the second polypeptide. Typically, polypeptides that differ by conservative amino acid substitutions are immunologically cross-reactive. Thus, a polypeptide is substantially identical to a second polypeptide, for example, where the two peptides differ only by a conservative substitution. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions (e.g., within a range of medium to high stringency).
[0070] As used herein, the term gene is synonymous with the term allele in referring to a nucleic acid that encodes and directs the expression of a protein or RNA. Vegetative forms of filamentous fungi are generally haploid, therefore a single copy of a specified gene (i.e., a single allele) is sufficient to confer a specified phenotype.
[0071] As used herein, the terms wild-type and native are used interchangeably and refer to genes proteins or strains found in nature.
[0072] As used herein, the term protein of interest refers to a polypeptide that is desired to be expressed in modified yeast. Such a protein can be an enzyme, a substrate-binding protein, a surface-active protein, a structural protein, a selectable marker, or the like, and can be expressed at high levels. The protein of interest is encoded by a modified endogenous gene or a heterologous gene (i.e., gene of interest) relative to the parental strain. The protein of interest can be expressed intracellularly or as a secreted protein.
[0073] As used herein, deletion of a gene, refers to its removal from the genome of a host cell. Where a gene includes control elements (e.g., enhancer elements) that are not located immediately adjacent to the coding sequence of a gene, deletion of a gene refers to the deletion of the coding sequence, and optionally adjacent enhancer elements, including but not limited to, for example, promoter and/or terminator sequences, but does not require the deletion of non-adjacent control elements.
[0074] As used herein, disruption of a gene refers broadly to any genetic or chemical manipulation, i.e., mutation, that substantially prevents a cell from producing a function gene product, e.g., a protein, in a host cell. Exemplary methods of disruption include complete or partial deletion of any portion of a gene, including a polypeptide-coding sequence, a promoter, an enhancer, or another regulatory element, or mutagenesis of the same, where mutagenesis encompasses substitutions, insertions, deletions, inversions, and combinations and variations, thereof, any of which mutations substantially prevent the production of a function gene product. A gene can also be disrupted using RNAi, antisense, or any other method that abolishes gene expression. A gene can be disrupted by deletion or genetic manipulation of non-adjacent control elements.
[0075] As used herein, the terms genetic manipulation and genetic alteration are used interchangeably and refer to the alteration/change of a nucleic acid sequence. The alteration can include but is not limited to a substitution, deletion, insertion or chemical modification of at least one nucleic acid in the nucleic acid sequence.
[0076] As used herein, a primarily genetic determinant refers to a gene, or genetic manipulation thereof, that is necessary and sufficient to confer a specified phenotype in the absence of other genes, or genetic manipulations, thereof. However, that a particular gene is necessary and sufficient to confer a specified phenotype does not exclude the possibility that additional effects to the phenotype can be achieved by further genetic manipulations.
[0077] As used herein, a functional polypeptide/protein is a protein that possesses an activity, such as an enzymatic activity, a binding activity, a surface-active property, or the like, and which has not been mutagenized, truncated, or otherwise modified to abolish or reduce that activity. Functional polypeptides can be thermostable or thermolabile, as specified.
[0078] As used herein, a functional gene is a gene capable of being used by cellular components to produce an active gene product, typically a protein. Functional genes are the antithesis of disrupted genes, which are modified such that they cannot be used by cellular components to produce an active gene product, or have a reduced ability to be used by cellular components to produce an active gene product.
[0079] As used herein, yeast cells have been modified to prevent the production of a specified protein if they have been genetically or chemically altered to prevent the production of a functional protein/polypeptide that exhibits an activity characteristic of the wild-type protein. Such modifications include, but are not limited to, deletion or disruption of the gene encoding the protein (as described, herein), modification of the gene such that the encoded polypeptide lacks the aforementioned activity, modification of the gene to affect post-translational processing or stability, and combinations, thereof.
[0080] As used herein, fermentation broth is the product of an ethanol production facility following fermentation with yeast but prior to distillation.
[0081] As used herein, whole stillage is the byproduct an ethanol production facility following distillation.
[0082] As used herein, thin stillage is the liquid portion of whole stillage following separation of solid materials.
[0083] As used herein, distillers' grains (DG) is the solid/slurry component of whole stillage.
[0084] As used herein, distillers' dried grains (DDG) is DG that have been dried.
[0085] As used herein, distillers' dried grains with solutes (DDGS) is DG that has been dried along with the concentrated thin stillage for added nutritional value.
[0086] As used herein, a wet by-product of distillation contains at least 20% water by weight.
[0087] As used herein, a dried by-product of distillation contains less than 20% water by weight.
[0088] As used herein, aerobic fermentation refers to growth in the presence of oxygen.
[0089] As used herein, anaerobic fermentation refers to growth in the absence of oxygen.
[0090] As used herein, the singular articles a, an, and the encompass the plural referents unless the context clearly dictates otherwise. All references cited herein are hereby incorporated by reference in their entirety. The following abbreviations/acronyms have the following meanings unless otherwise specified: [0091] C. degrees Centigrade [0092] DG distillers' grains [0093] DDG distillers' dried grains [0094] DDGS distillers' dried grains with solutes [0095] DNA deoxyribonucleic acid [0096] DP degree of polymerization [0097] DS dry solids [0098] EtOH ethanol [0099] g or gm gram [0100] g/L grams per liter [0101] GA glucoamylase [0102] GAU/g DS glucoamylase units per gram dry solids [0103] HPLC high performance liquid chromatography [0104] hr or h hour [0105] kDa kilodalton [0106] M molar [0107] mg milligram [0108] mL or ml milliliter [0109] ml/min milliliter per minute [0110] mM millimolar [0111] N normal [0112] Na not applicable [0113] PCR polymerase chain reaction [0114] ppm parts per million [0115] SAPU/g DS protease units per gram dry solids [0116] SSCU/g DS fungal -amylase units per gram dry solids [0117] relating to a deletion [0118] g microgram [0119] L and l microliter [0120] M and m micromolar
III. Modified Yeast Cells Expressing Reduced Levels of Cdc42 Target Polypeptides
[0121] Cdc42 is Rho-family GTPase that functions as a master regulator of cytoskeleton remodeling in many cell types, including budding yeast. Activated Cdc42 concentrates in a region of the cell cortex, where it recruits effector proteins to remodel the cytoskeleton in a polarized manner. At least in yeast cells, polarization involves a positive feedback loop. in which effectors, including those referred to as p21-activated kinases (PAK), recruit a guanine nucleotide exchange factor (GEF), resulting in a further local increase of GTP-Cdc42 concentration. Additional effector proteins include Gic1 and Gic2, which are implicated in regulation of the actin and septin cytoskeleton.
[0122] Applicants have discovered that yeast having a genetic alteration that decreases Gic1 or Gic2 production demonstrate increased ethanol production in fermentations, compared to otherwise identical yeast. Moreover, applicants have discovered that yeast having such a genetic alteration demonstrate increased lysine production in fermentations, compared to otherwise identical yeast.
[0123] Reduction in the amount of functional Gic polypeptides can result from disruption of a gene encoding the Gic1 polypeptide (e.g., YDR309c) and/or a gene encoding the Gic2 polypeptide (e.g., 2YHR061c) in Saccharomyces cerevisiae. Because disruption of a gene encoding a Gic polypeptide is a primary genetic determinant for conferring the altered alcohol and lysine production phenotype to the modified cells, in some embodiments the modified cells need only comprise such a disrupted gene, while all other genes can remain intact. In other embodiments, the modified cells can optionally include additional genetic alterations compared to the parental cells from which they are derived. While such additional genetic alterations are not necessary to confer the described phenotype, they may confer other advantages to the modified cells.
[0124] Disruption of a gene encoding a Gic polypeptide can be performed using any suitable methods that substantially prevent expression of functional Gic polypeptides. Exemplary methods of disruption as are known to one of skill in the art include but are not limited to: complete or partial deletion of a gene encoding a Gic polypeptide, including complete or partial deletion of, e.g., a Gic-coding sequence, the promoter, the terminator, an enhancer, or another regulatory element; and complete or partial deletion of a portion of the chromosome that includes any portion of a gene encoding a Gic polypeptide. Particular methods of disrupting a gene encoding a Gic polypeptide gene include making nucleotide substitutions or insertions in any portion of such a gene, e.g., a gene encoding a Gic polypeptide-coding sequence, the promoter, the terminator, an enhancer, or another regulatory element.
[0125] Mutations in a gene encoding a Gic polypeptide can reduce the efficiency of a promoter, reduce the efficiency of an enhancer, interfere with the splicing or editing of a mRNA, interfere with the translation of a mRNA, introduce a stop codon into a Gic-coding sequence to prevent the translation of full-length Gic protein, change the coding sequence of a Gic protein to produce a less active or inactive protein or reduce Gic interaction with other proteins, or DNA, change the coding sequence of a Gic protein to produce a less stable protein or target the protein for destruction, cause a Gic protein to misfold or be incorrectly modified (e.g., by glycosylation), or interfere with cellular trafficking of a Gic protein. In some embodiments, these and other genetic manipulations act to reduce or prevent the expression of a functional Gic protein, or reduce or prevent the normal function of Gic1 or Gic2.
[0126] Preferably, disruption of a gene encoding a Gic polypeptide is performed by genetic manipulation using sequence-specific molecular biology techniques, as opposed to chemical mutagenesis, which is generally not targeted to specific nucleic acid sequences. However, chemical mutagenesis is not excluded as a method for making modified yeast cells.
[0127] The exemplary Gic1 polypeptide described, herein, is represented by Genbank Accession No. NP 011928 and SEQ ID NO: 2, below:
TABLE-US-00001 MTEGKRLQQMELPQMKSIWIDEDQEMEKLYGFQVRQRFMN GPSTDSDEDADEDLGIVLVDSKKLALPNKNNIKLPPLPNY MTINPNINSNHKSLTNKKKNFLGMFKKKDLLSRRHGSAKT AKQSSISTPFDFHHISHANGKREDNPLESHEEKHDVESLV KFTSLAPQPRPDSNVSSKYSNVVMNDSSRIVSSSTIATTM DSHHDGNETNNTPNGNKQLDSPTDLEMTLEDLRNYTFPSV LGDSVSEKTNPSSPSVSSFSGKFKPRELSALHTPELGNCF NVDQSLNSPGNRISVDDVLKFYYQCSETSTPRNT
[0128] The exemplary Gic2 polypeptide described, herein, is represented by Genbank Accession No. NP_010595 and SEQ ID NO: 2, below:
TABLE-US-00002 MTSASITNTGNETMNLPQMRSIWLDEDEEAEKLYGLQAQQ FMGSDDEENLGITFINSDKPVLSNKKNIELPPLSPNSHPS CHHRRSNSNSAKSKESSSSSSSANKTNHKKVFLKLNLLKK KLLGAQPDIRGKGISTPFDFQHISHADTRNGFQDEQLQEP SSLSTEIKDDYTSSSSKRDSKSLNKAFVTERIPANRESKL ISRSHENKTSRLSVARSISVTSSNYSKNTQGNNHSINGRV VSTSTMATSIFEYSPNASPKQFKNKSHALGHRYTNSTDSS ESSLDFLKNYNFPTLLEDKPILDFLPRSQRSSAYRSLLET PNSNKDSAKAFFPSRQSPLPKRRNSIATPSPQSKFSYSDS PVNHRKSFDDVLYSFNQLEPLQT
[0129] It is expected that the present compositions and methods are applicable to other structurally similar Gic polypeptides, as well as other related proteins, homologs, and functionally similar polypeptides.
[0130] In some embodiments of the present compositions and methods, the amino acid sequence of the Gic protein that is altered in production levels has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or 2, e.g., at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NO: 1 or 2.
[0131] In some embodiments of the present compositions and methods, the gene encoding a Gic polypeptide that is disrupted encodes a Gic protein that has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or 2, e.g., at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NO: 1 or 2.
[0132] In some embodiments of the present compositions and methods, the gene encoding a Gic polypeptide that is disrupted is YDR309c (SEQ ID NO: 3, infra), which encodes Gic2. In some embodiments, the gene encoding a Gic polypeptide that is disrupted is YHR061c (SEQ ID NO: 4, infra), which encodes Gic1. In some embodiments the gene encoding a Gic polypeptide that is disrupted has a specified degree of overall amino acid sequence identity to the nucleic acid sequence of SEQ ID NO: 3 or 4, e.g., at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NO: 3 or 4.
[0133] The amino acid and nucleic acid sequence information provided, herein, readily allows the skilled person to identify a Gic protein, and the nucleic acid sequence encoding a Gic protein, in any yeast, and to make appropriate disruptions in a gene encoding a Gic polypeptide to affect the production of the Gic protein.
[0134] In some embodiments, the decrease in the amount of functional Gic1 and/or Gic2 polypeptide in the modified cells is a decrease of at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or more, compared to the amount of functional Gic polypeptide in parental cells growing under the same conditions. In some embodiments, the reduction of expression of functional Gic1 and/or Gic2 protein in the modified cells is a reduction of at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or more, compared to the amount of functional Gic polypeptide in parental cells growing under the same conditions.
[0135] In some embodiments, the increase in alcohol production by the modified cells is an increase of at least 1%, at least 1.5%, at least 2%, at least 2.5%, at least 3%, at least 3.5%, at least 4%, at least 4.5%, at least 5%, or more, compared to the amount of alcohol produced in parental cells growing under the same conditions.
[0136] In some embodiments, the increase in lysine production by the modified cells is an increase of at least 1.1-fold, at least 1.2-fold, at least 1.3-fold, at least 1.4-fold, at least 1.4-fold, at least 1.5-fold, at least 1.6-fold, at least 1.7-fold, at least 1.8-fold, at least 1.9-fold or even at least 2-fold, or more, compared to the amount of lysine produced in parental cells growing under the same conditions. In particular embodiments, the increase is under high-DS conditions.
[0137] In some embodiments, the parental cell that is modified already includes a gene of interest, such as a gene encoding a selectable marker, carbohydrate-processing enzyme, or other polypeptide.
[0138] In some embodiments, a gene of introduced is subsequently introduced into the modified cells.
[0139] In some embodiments, the modified cells include other genes or other modifications that increase lysine production.
IV. Combination of Decreased Cdc42 Effectors with Other Mutations that Affect Alcohol Production
[0140] In some embodiments, in addition to expressing decreased amounts of Cdc42 effector polypeptides, the present modified yeast cells further include additional modifications that affect alcohol production.
[0141] In particular embodiments the modified yeast cells include an artificial or alternative ethanol-producing pathway resulting from the introduction of a heterologous phosphoketolase (PKL) gene, a heterologous phosphotransacetylase (PTA) gene and a heterologous acetylating acetyl dehydrogenase (AADH), as described in WO2015148272 (Miasnikov et al.), to channel carbon flux away from the glycerol pathway and toward the synthesis of acetyl-CoA, which is then converted to ethanol.
[0142] The modified cells may further include mutations that result in attenuation of the native glycerol biosynthesis pathway, which are known to increase alcohol production. Methods for attenuation of the glycerol biosynthesis pathway in yeast are known and include reduction or elimination of endogenous NAD-dependent glycerol 3-phosphate dehydrogenase (GPD) or glycerol phosphate phosphatase activity (GPP), for example by disruption of one or more of the genes GPD1, GPD2, GPP1 and/or GPP2. See, e.g., U.S. Pat. No. 9,175,270 (Elke et al.), 8,795,998 (Pronk et al.) and 8,956,851 (Argyros et al.).
[0143] The modified yeast may further feature increased acetyl-CoA synthase (also referred to acetyl-CoA ligase) activity (EC 6.2.1.1) to scavenge (i.e., capture) acetate produced by chemical or enzymatic hydrolysis of acetyl-phosphate (or present in the culture medium of the yeast for any other reason) and converts it to Ac-CoA. This avoids the undesirable effect of acetate on the growth of yeast cells and may further contribute to an improvement in alcohol yield. Increasing acetyl-CoA synthase activity may be accomplished by introducing a heterologous acetyl-CoA synthase gene into cells, increasing the expression of an endogenous acetyl-CoA synthase gene and the like. A particularly useful acetyl-CoA synthase for introduction into cells can be obtained from Methanosaeta concilii (UniProt/TrEMBL Accession No.: WP_013718460). Homologs of this enzymes, including enzymes having at least 85%, at least 90%, at least 92%, at least 95%, at least 97%, at least 98% and even at least 99% amino acid sequence identity to the aforementioned acetyl-CoA synthase from Methanosaeta concilii, are also useful in the present compositions and methods.
[0144] In some embodiments the modified cells may further include a heterologous gene encoding a protein with NAD.sup.+-dependent acetylating acetaldehyde dehydrogenase activity and/or a heterologous gene encoding a pyruvate-formate lyase. The introduction of such genes in combination with attenuation of the glycerol pathway is described, e.g., in U.S. Pat. No. 8,795,998 (Pronk et al.).
[0145] In some embodiments, the present modified yeast cells may further overexpress a sugar transporter-like (STL1) polypeptide (see, e.g., Ferreira et al. (2005) Mol Biol Cell 16:2068-76; Dukov et al. (2015) Mol Microbiol 97:541-59 and WO 2015023989 A1) to increase ethanol production and reduce acetate.
[0146] In some embodiments, the present modified yeast cells may further overexpress a polyadenylate-binding protein, e.g., PAB1, to increase alcohol production and reduce acetate production.
[0147] In some embodiments, the present modified yeast cells further comprise a butanol biosynthetic pathway. In some embodiments, the butanol biosynthetic pathway is an isobutanol biosynthetic pathway. In some embodiments, the isobutanol biosynthetic pathway comprises a polynucleotide encoding a polypeptide that catalyzes a substrate to product conversion selected from the group consisting of: (a) pyruvate to acetolactate; (b) acetolactate to 2,3-dihydroxyisovalerate; (c) 2,3-dihydroxyisovalerate to 2-ketoisovalerate; (d) 2-ketoisovalerate to isobutyraldehyde; and (e) isobutyraldehyde to isobutanol. In some embodiments, the isobutanol biosynthetic pathway comprises polynucleotides encoding polypeptides having acetolactate synthase, keto acid reductoisomerase, dihydroxy acid dehydratase, ketoisovalerate decarboxylase, and alcohol dehydrogenase activity.
[0148] In some embodiments, the modified yeast cells comprising a butanol biosynthetic pathway further comprise a modification in a polynucleotide encoding a polypeptide having pyruvate decarboxylase activity. In some embodiments, the yeast cells comprise a deletion, mutation, and/or substitution in an endogenous polynucleotide encoding a polypeptide having pyruvate decarboxylase activity. In some embodiments, the polypeptide having pyruvate decarboxylase activity is selected from the group consisting of: PDC1, PDC5, PDC6, and combinations thereof. In some embodiments, the yeast cells further comprise a deletion, mutation, and/or substitution in one or more endogenous polynucleotides encoding FRA2, ALD6, ADH1, GPD2, BDH1, and YMR226C.
V. Combination of Decreased Cdc42 Effectors with Other Beneficial Mutations
[0149] In some embodiments, in addition to expressing reduced amounts of Cdc42 effector polypeptides, optionally in combination with other genetic modifications that benefit alcohol production, the present modified yeast cells further include any number of additional genes of interest encoding proteins of interest. Additional genes of interest may be introduced before, during, or after genetic manipulations that result in reduced expression of Cdc42 effector polypeptides. Proteins of interest, include selectable markers, carbohydrate-processing enzymes, and other commercially-relevant polypeptides, including but not limited to an enzyme selected from the group consisting of a dehydrogenase, a transketolase, a phosphoketolase, a transladolase, an epimerase, a phytase, a xylanase, a -glucanase, a phosphatase, a protease, an -amylase, a -amylase, a glucoamylase, a pullulanase, an isoamylase, a cellulase, a trehalase, a lipase, a pectinase, a polyesterase, a cutinase, an oxidase, a transferase, a reductase, a hemicellulase, a mannanase, an esterase, an isomerase, a pectinases, a lactase, a peroxidase and a laccase. Proteins of interest may be secreted, glycosylated, and otherwise-modified.
VI. Yeast Cells Suitable for Modification
[0150] Yeasts are unicellular eukaryotic microorganisms classified as members of the fungus kingdom and include organisms from the phyla Ascomycota and Basidiomycota. Yeast that can be used for alcohol production include, but are not limited to, Saccharomyces spp., including S. cerevisiae, as well as Kluyveromyces, Lachancea and Schizosaccharomyces spp. Numerous yeast strains are commercially available, many of which have been selected or genetically engineered for desired characteristics, such as high alcohol production, rapid growth rate, and the like. Some yeasts have been genetically engineered to produce heterologous enzymes, such as glucoamylase or -amylase.
VII. Substrates and Conditions
[0151] Alcohol production from a number of carbohydrate substrates, including but not limited to corn starch, sugar cane, cassava, and molasses, is well known, as are innumerable variations and improvements to enzymatic and chemical conditions and mechanical processes. The present compositions and methods are believed to be fully compatible with such substrates and conditions.
[0152] Numerous variations of ethanol production process exist, including cold cook, or no cook, involving liquefaction at or below the gelatinization temperature, simultaneous saccharification and fermentation, fractionation processes, and the like. None are expected to be incompatible with the present compositions and methods.
VIII. Fermentation Products and Co-Products
[0153] Typical alcohol fermentation products include organic compound having a hydroxyl functional group (OH) is bound to a carbon atom. Exemplary alcohols include but are not limited to methanol, ethanol, n-propanol, isopropanol, n-butanol, isobutanol, n-pentanol, 2-pentanol, isopentanol, and higher alcohols. The most commonly made fuel alcohols are ethanol, and butanol. Using the present modified yeast, an increase of at least 1%, at least 1.5%, at least 2%, at least 2.5%, at least 3%, at least 3.5%, at least 4%, at least 4.5%, at least 5%, or more, can be realized.
[0154] Valuable by-products (or co-products) of alcohol production, and particularly dry-grind ethanol production, are products for animal feed, usually in the form of distillers' dried grains (DDG) or, more commonly, distillers' dried grains with solutes (DDGS). Such animal feed products are in many ways more nutritional than the initial feed-stocks used for ethanol production as they are depleted for carbohydrates but enriched for amino acids derived both from the feed-stock and the fermenting organism (i.e., ethanolagen).
[0155] The specific amino acid composition of DDGS or other corn co-product is important to the quality of animal feed as some amino acids are far more important than others. Lysine is an essential amino acid for most farm animals and, if not provided in adequate amounts by adequately by DDG, DDGS, or other post fermentation co-products, must be supplemented to maximize feed conversion. Synthetic lysine is expensive and represents a significant cost of animal feed.
[0156] Because yeast can represent a significant component of post-fermentation products, the amino acid content of the yeast may significantly affect the amino acid content of fermentation broth, whole stillage, thin stillage, distillers dried grains, distillers dried grains with solutes, condensed distillers solubles or other protein-containing post fermentation coproducts. Replacing convention yeast with the present yeast increases the amounts of lysine in such post-fermentation products, thereby increasing their value as animal feed products. Using the present modified yeast, an increase in lysine of at least 1.1-fold, at least 1.2-fold, at least 1.3-fold, at least 1.4-fold, at least 1.4-fold, at least 1.5-fold, at least 1.6-fold, at least 1.7-fold, at least 1.8-fold, at least 1.9-fold or even at least 2-fold, or more, can be realized.
[0157] These and other aspects and embodiments of the present strains and methods will be apparent to the skilled person in view of the present description. The following examples are intended to further illustrate, but not limit, the strains and methods.
EXAMPLES
Example 1: Deletion of Gic2 in Yeast
[0158] Using standard molecular biology techniques, the YDR309c gene was disrupted by deleting essentially the entire coding sequence for Gic2 in FERMAX Gold (Martrex, Inc., Chaska, MN, USA, herein FG), a commercially available strain of Saccharomyces cerevisiae used for large-scale ethanol production. All procedures were based on the publicly available nucleic acid sequence of YDR309c, which is provided below as SEQ ID NO: 3; 9SGDID:S000002717; chrIV:1079048 . . . 1080199; the corresponding Gic2 effector polypeptide is represented, supra, as SEQ ID NO: 2):
TABLE-US-00003 ATGACTAGTGCAAGTATTACCAATACTGGAAACGAAACCATGAACCTTCC ACAGATGCGGTCGATTTGGCTGGATGAAGATGAAGAAGCTGAAAAACTCT ACGGTCTGCAGGCCCAGCAATTCATGGGATCTGATGATGAAGAAAACCTA GGCATTACTTTCATCAACAGCGATAAACCTGTGCTGAGTAACAAGAAAAA CATTGAGTTGCCTCCACTTTCACCAAATTCACATCCGTCTTGCCACCACA GGAGAAGTAATTCTAACTCTGCAAAGTCTAAAGAATCATCGTCATCATCG TCCAGCGCCAACAAGACAAATCACAAAAAGGTTTTCCTTAAGCTTAATTT GTTGAAGAAAAAGTTGCTTGGTGCCCAACCGGACATAAGAGGTAAAGGTA TCTCCACACCATTTGATTTTCAACATATTTCACATGCTGACACTAGAAAT GGATTCCAAGATGAGCAATTGCAGGAACCTTCATCGCTGTCCACAGAGAT TAAGGACGACTATACCTCCTCCTCAAGCAAGCGGGATTCGAAATCACTAA ATAAAGCTTTTGTCACTGAAAGGATCCCTGCTAATCGTGAAAGCAAACTC ATTTCAAGATCGCACGAAAATAAGACATCAAGACTATCAGTCGCGCGTTC GATCTCAGTAACGTCCTCCAATTACTCTAAAAACACACAAGGAAACAATC ATTCCATTAATGGGAGAGTCGTATCTACGTCAACTATGGCTACATCTATT TTTGAGTATTCCCCAAACGCATCTCCAAAACAATTTAAAAATAAGTCACA CGCTCTGGGTCATAGATACACTAATTCCACGGATTCTAGTGAGTCTTCGC TGGATTTTTTGAAGAACTACAACTTCCCCACACTACTTGAAGATAAGCCT ATTTTAGACTTCTTGCCTCGTTCTCAGAGGTCAAGCGCTTATCGTAGCCT TTTAGAGACCCCAAACTCAAATAAGGACTCAGCAAAAGCCTTCTTTCCTT CACGCCAAAGCCCTCTTCCCAAGAGAAGAAACTCTATAGCTACGCCTTCT CCACAATCTAAATTTTCCTACTCTGACTCCCCTGTAAACCATAGAAAATC TTTCGATGATGTTCTTTATTCTTTCAACCAGCTCGAGCCCCTGCAAACTT AA
[0159] Deletion of the Gic2 gene was confirmed by colony PCR. The modified yeast was grown in non-selective media to remove the plasmid conferring kanamycin resistance used to select transformants, resulting in modified yeast that required no growth supplements compared to the parental yeast. One modified strain, designated FG-Gic2 was selected for further study.
Example 2: Deletion of Gic1 in Yeast
[0160] Using standard molecular biology techniques, the YHR061c gene was disrupted by deleting essentially the entire coding sequence for Gic1 in FG. All procedures were based on the publicly available nucleic acid sequence of YHR061c, which is provided below as SEQ ID NO: 4; SGDID:S000001103; chrVIII:221534 . . . 222478; the corresponding Gic1 effector polypeptide is represented, supra, as SEQ ID NO: 1):
TABLE-US-00004 ATGACTGAAGGAAAGAGGCTGCAACAGATGGAGCTTCCTCAAATGAAATC CATTTGGATTGACGAGGATCAGGAAATGGAAAAATTGTATGGATTCCAAG TAAGGCAACGATTCATGAATGGACCTAGTACGGATTCCGATGAAGACGCC GACGAAGATTTAGGAATTGTTCTCGTTGACAGTAAAAAGCTGGCTTTGCC GAACAAGAACAACATCAAATTGCCCCCTTTGCCCAATTACATGACGATCA ACCCTAACATAAATTCCAATCACAAGTCATTAACTAATAAAAAGAAGAAT TTCCTGGGCATGTTCAAAAAAAAGGACCTGTTGTCGAGGAGACATGGGTC TGCCAAAACCGCAAAACAGTCAAGTATATCTACACCATTTGATTTTCACC ATATTTCGCATGCTAATGGTAAAAGGGAAGACAACCCTCTTGAGTCGCAC GAAGAAAAACATGATGTAGAATCATTAGTCAAATTCACGTCTTTGGCACC GCAACCCCGACCAGATTCAAACGTCTCTTCTAAATATTCCAATGTTGTGA TGAACGATTCGAGCAGAATAGTGTCTTCCTCCACAATAGCTACAACGATG GATTCTCACCACGATGGTAACGAAACCAACAATACCCCAAATGGCAATAA GCAATTAGACTCGCCTACAGATTTGGAAATGACCTTGGAAGACTTGAGAA ATTATACATTTCCTTCTGTTCTTGGAGATAGCGTCAGCGAAAAGACCAAT CCTTCCTCTCCCTCTGTTTCATCATTTTCTGGCAAATTCAAGCCAAGAGA GTTGAGTGCGCTACATACGCCCGAATTAGGAAATTGTTTCAATGTAGATC AGTCGCTAAATTCCCCTGGTAACAGAATATCTGTGGATGACGTGCTAAAA TTCTACTATCAATGTAGTGAAACTAGTACTCCTCGAAATACCTGA
[0161] Deletion of the Gic1 gene was confirmed by colony PCR and the modified yeast was grown in non-selective media to remove the plasmid conferring kanamycin resistance used to select transformants, resulting in modified yeast that required no growth supplements compared to the parental yeast. One modified strain, designated FG-Gic1 was selected for further study.
Example 3: Ethanol Production by Modified Yeast at a Single Temperature
[0162] FG-Gic2 and FG-Gic1 yeast were tested for their ability to produce ethanol compared to the FG benchmark yeast (which is wild-type for both genes) in liquefact at 32 C. Liquefact (i.e., corn flour slurry having a dry solid (DS) value of 33% was prepared by adding 600 ppm urea, 0.124 SAPU/g DS FERMGEN 2.5 (an acid fungal protease), 0.33 GAU/g DS variant Trichoderma reesei glucoamylase and 1.46 SSCU/g DS Aspergillus kawachii -amylase at pH 4.8. [0086]50 grams of liquefact was weighted into 100 ml vessels and inoculated with fresh overnight cultures from colonies of the modified strain or FG strain at 32 C. Samples were harvested at 55.2 hr by centrifugation, filtered through 0.2 m filters, and analyzed for ethanol, glucose, acetate and glycerol content by HPLC (Agilent Technologies 1200 series) using Bio-Rad Aminex HPX-87H columns at 55 C. with an isocratic flow rate of 0.6 ml/min in 0.01 N H.sub.2SO.sub.4 eluent (all numbers are in g/L unless otherwise indicated). A 2.5 l sample injection volume was used. Calibration standards used for quantification included known amounts of DP4+, DP3, DP2, DP1, glycerol and ethanol. The results of the analyses are shown in Table 1. Ethanol increase is reported with reference to the FG strain.
TABLE-US-00005 TABLE 1 Analysis of fermentation broth after fermentation after 55 hours at 32 C. Strain DP2 DP3 DP4+ Glucose Glycerol Acetate EtOH Fold increase FG 3.14 1.27 6 0.53 13.74 0.76 139.26 -0- FG-Gic2 3.24 1.3 6.08 0.51 13.52 0.7 140.83 1.011 FG-Gic1 3.26 1.29 6.07 0.56 13.9 0.73 140.45 1.009
[0163] Yeast harboring disrupted Gic1 or Gic2 genes produced about a 1% increase in ethanol compared the unmodified FG reference strains at 32 C.
Example 4: Ethanol Production by Modified Yeast Under Ramping Temperatures
[0164] FG-Gic2 and FG-Gic1 yeast were tested for their ability to produce ethanol compared to benchmark FG yeast (wild-type for both genes) in liquefact in a 35 C. ramp. Liquefact (as above) was weighted into 100 ml vessels and inoculated with fresh overnight cultures from colonies of the modified strain or FG strain using 35 C. ramp conditions as summarized in Table 2. Samples were harvested by centrifugation after 55.2 hr, filtered through 0.2 m filters, and analyzed as above for ethanol, glucose, acetate and glycerol content by HPLC. The results of the analyses are shown in Table 3. Ethanol increase is reported with reference to the FG strain.
TABLE-US-00006 TABLE 2 Temperature ramp condition Time Temperature (hour) ( C.) 0-10 32.0 10-12 33.0 12-15 34.0 15-17 35.0 17-22 35.5 22-27 34.5 27-31 34.0 31-36 33.5 36-41 33.0 41-55 32.5 55-end 32.0
TABLE-US-00007 TABLE 3 Analysis of fermentation broth following fermentation under ramping conditions Strain DP2 DP3 DP4+ Glucose Glycerol Acetate EtOH Fold increase FG 3.87 1.43 5.87 18.32 14.24 0.93 128.96 -0- FG-Gic2 4.28 1.46 5.86 8.93 13.74 0.97 133.64 1.036 FG-Gic1 4.37 1.46 5.89 10.47 14.02 1.02 132.89 1.030
[0165] As shown in Table 3, yeast harboring the Gic1 or Gic2 deletions produced about 3.0 to 3.6% more ethanol compared the unmodified reference strains at 35 C. ramp.
Example 5: Ethanol Production by Modified Yeast Under High-DS Conditions
[0166] FG-Gic2 and FG-Gic1 yeast were tested for their ability to produce ethanol compared to benchmark FG yeast in high-DS (i.e., 35%) liquefact conditions at 32 C. Liquefact was prepared and analyzed as above. The results of analysis are shown in Table 4. Ethanol increase is reported with reference to the FG strain.
TABLE-US-00008 TABLE 4 Analysis of fermentation broth following fermentation under high-DS conditions Strain DP2 DP3 DP4+ Glucose Glycerol Acetate EtOH Fold increase EtOH/DS FG 4.41 1.69 6.87 20.23 16.82 1.04 141.71 -0- 4.05 FG-Gic2 4.50 1.73 6.80 6.66 16.58 1.10 148.85 1.050 4.25 FG Gic1 4.57 1.73 6.81 7.59 16.77 1.10 148.05 1.045 4.23
[0167] As shown in Table 4, yeast harboring the Gic2 or Gic1 gene deletion produced about 4.5 to 5% more ethanol compared the unmodified reference strains at 35% DS.
Example 6: Lysine Content in Fermentation End Products Using Modified Yeast
[0168] The intracellular free lysine content of FG-Gic2 and FG-Gic1 yeast were tested and compared to benchmark FG yeast (wild-type for both genes) after 24 hrs growth in minimum media. Intracellular metabolites from cell pellet were extracted using standard amino acid extraction conditions with a 60% methanol solution Villas-Boas, S. G. et al., (2005) Biochem J. 388:669-77, and the samples processed using HPLC. Samples were analyzed for L-lysine content following derivatization using o-phthalaldehyde. Derivatized L-lysine was detected by HPLC (Agilent Technologies 1260) using an Eclipse Plus C18 column (4.6150 mm, 3.5-Micron) at 40 C. in a gradient of phosphate buffer, pH 7.8 and acetonitrile:methanol:water (45:45:10). Calibration standards used for quantification included known amounts L-lysine or an amino acid standard mixture (Agilent Technologies) including L-lysine.
[0169] As shown in Table 5, yeast-harboring mutations in produced 1.3 to 1.67-fold more free intracellular lysine compared to the unmodified reference strain.
TABLE-US-00009 TABLE 5 Intracellular free lysine in modified and unmodified cells Intracellular Fold free lysine increase Strain (mM) over FG FG 0.91 na FG-Gic2 1.18 1.3 FG-Gic1 1.52 1.67
Example 7: Bioavailable Lysine Content of Fermentation Co-Products Using Modified Yeast
[0170] The total lysine content of fermentation co-products was tested for using FG-Gic2 and the benchmark strain. Liquefact (corn mash slurry) was prepared by adding 600 ppm of urea, 0.124 SAPU/g ds acid fungal protease, 0.33 GAU/g ds variant Trichoderma reesei glucoamylase and 1.46 SSCU/g ds Aspergillus kawachii -amylase, adjusted to a pH of 4.8 with sulfuric acid. 100 g of prepared corn liquefact was subjected to fermentation with either FG-Gic2 or the benchmark FG strain at 32 C. with shaking at 200 rpm. After 67 hours, the fermentation broth from duplicate fermentation flasks was collected in an 800-mL beaker and placed into a shaking water bath at 95 C. to evaporate off the ethanol. The fermentation broth was allowed to incubate for approximately 3-5 hours until no significant ethanol was detected by HPLC.
[0171] The resulting material (i.e., whole stillage) was spun down at 6,000 rpm for 10 min. The supernatant (i.e., thin stillage) and precipitate (i.e., wet cake) were both collected. Wet cake was dried at 37 C. until reaching a dry solids content of about 34-35%. Thin stillage was weighed into 600 mL beakers and put in a shaking water bath at 97 C. to concentrate the contents by about 5-fold (by weight) to create syrup.
[0172] To make fermentation co-products similar to DDGS samples, wet cake and the corresponding syrup were combined at a 2-to-1 mass ratio (as-is weights) and mixed well. DDGS was spread onto a metal tray and dried in a 99 C. oven for about 3 hours, with occasional mixing to >90% dry solids content.
[0173] To test for bioavailable amino acids, samples of DDGS were incubated with pepsin and pancreatin, based on a previously reported method (Qiao, Y (2001) Routine techniques for monitoring the nutritional value of animal meals, Doctoral thesis at North Carolina State University). Briefly, 0.33 g of DDGS was added to a 20 mL scintillation vial along with 3.33 mL of 0.05 M citrate buffer (pH 2) and approximately 0.012 g pepsin (from porcine gastric mucosa) at 400 units/mg protein. The mixture was allowed to incubate at 38 C. for about 24 hours with shaking at 200 rpm. After this time, 5 mL of phosphate buffer (0.2 M, pH 11.5, with 0.025% w/w sodium azide) and approximately 0.023 g pancreatin (from porcine pancreas, 4UXP specifications) was added to each vial. The vials were placed back into the 38 C. incubator shaking with at 200 rpm for around 66 hours. After this time, samples were taken from each vial, spun down through a 0.2 M filter and analyzed by HPLC for free amino acids.
[0174] The results shown in Table 6 compare the measured bioavailable lysine content in the fermentation co-product produced with the FG-Gic2 strains and the FG benchmark. As shown, a 19% increase in co-product bioavailable lysine was observed for using FG-Gic2 strain.
TABLE-US-00010 TABLE 5 Lysine in fermentation co-product produced by modified and unmodified cells Lysine Fold Strain (% dry weight) increase FG 0.91 na FG-Gic2 1.08 1.19
[0175] Similar results were obtained using yeast harboring an exogenous PKL pathway and yeast expressing and exogenous glucoamylase (data not shown).