Compositions and methods for protecting hosts against pathogen infections
12305183 ยท 2025-05-20
Assignee
Inventors
Cpc classification
C12N15/8241
CHEMISTRY; METALLURGY
International classification
C12N15/82
CHEMISTRY; METALLURGY
Abstract
A chimeric protein and method of creating genetically altered plant and parts thereof with a chimeric protein wherein the chimeric protein comprises a recognition element and a lysis element connected by a linker wherein the recognition element binds to a pathogen and the lysis element lyses the pathogen and wherein the recognition element is derived from a first protein and the lysis element is derived from a second protein wherein the first protein and the second protein are endogenous to the host to be treated with the chimeric protein.
Claims
1. A chimeric protein comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 4, 5, 6, 7, 30, 31, 32, and 33.
2. A nucleic acid sequence encoding the chimeric protein of claim 1.
3. An expression vector comprising the nucleic acid sequence of claim 2 and an operably linked promoter.
4. A genetically altered plant or seed, comprising the nucleic acid sequence of claim 2 operably linked to a promoter such that the genetically altered plant or a plant that grows from the seed produces the chimeric protein.
5. A plant cell comprising the nucleic acid sequence of claim 2 operably linked to a promoter such that the plant cell produces the chimeric protein.
6. A tissue culture comprising the plant cell of claim 5.
7. An expression vector for agrobacterium-mediated transformation using the polynucleotide in claim 2.
8. A method of treating a plant at risk for infection with Xylella fastidiosa (Xf), comprising: applying the chimeric protein of claim 1 to the plant at risk of infection with Xf.
9. A method of treating a production crop plant that is at risk for becoming infected with a pathogen that will harm the production crop plant, comprising: applying topically a chimeric protein of claim 1 to the production crop plant at risk of becoming infected.
10. A method of treating a production crop plant that is at risk for becoming infected with a pathogen that will harm the production crop plant, comprising: transforming the production crop with a nucleic acid sequence that encodes a chimeric protein of claim 1.
11. The method of claim 10, wherein transforming the production crop comprises transforming a scion cultivar or root stock cultivar.
12. A method of conferring resistance against a disease to a production crop scion cultivar or a production crop rootstock cultivar, comprising: transforming a production crop scion cultivar or production crop rootstock cultivar with a nucleic acid sequence that encodes the chimeric protein of claim 1.
13. A transgenic production crop scion cultivar or transgenic production crop rootstock cultivar transformed with a polynucleotide comprising a nucleic acid sequence that encodes for a chimeric protein of claim 1.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
(1) The accompanying drawings, which are incorporated into and form a part of the specification, illustrate one or more embodiments of the present invention and, together with the description, serve to explain the principles of the invention. The drawings are only for the purpose of illustrating one or more preferred embodiments of the invention and are not to be construed as limiting the invention. In the drawings:
(2)
(3)
(4)
(5)
(6)
DETAILED DESCRIPTION OF THE INVENTION
(7) One embodiment of the present invention provides for treatment of host diseases caused by pathogens such as bacteria for example the xylem-limited bacteria Xylella fastidiosa (Xf) that infects hosts such as grapevines to cause Pierces' disease and Xanthamonas and Pseudomonas strains that cause spot and speck in tomato. Because this invention involves production of genetically altered hosts and compositions for use in transforming hosts and involves recombinant DNA techniques, the following definitions are provided to assist in describing this invention. The terms isolated, purified, or biologically pure as used herein, refer to material that is substantially or essentially free from components that normally accompany the material in its native state or when the material is produced. In an exemplary embodiment, purity and homogeneity are determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A nucleic acid or particular bacteria that are the predominant species present in a preparation is substantially purified. In an exemplary embodiment, the term purified denotes that a nucleic acid or protein that gives rise to essentially one band in an electrophoretic gel. Typically, isolated nucleic acids or proteins have a level of purity expressed as a range. The lower end of the range of purity for the component is about 60%, about 70% or about 80% and the upper end of the range of purity is about 70%, about 80%, about 90% or more than about 90%.
(8) The term nucleic acid as used herein, refers to a polymer of ribonucleotides or deoxyribonucleotides. Typically, nucleic acid polymers occur in either single- or double-stranded form, but are also known to form structures comprising three or more strands. The term nucleic acid includes naturally occurring nucleic acid polymers as well as nucleic acids comprising known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides. Exemplary analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, and peptide-nucleic acids (PNAs). DNA, RNA, polynucleotides, polynucleotide sequence, oligonucleotide, nucleotide, nucleic acid, nucleic acid molecule, nucleic acid sequence, nucleic acid fragment, and isolated nucleic acid fragment are used interchangeably herein.
(9) For nucleic acids, sizes are given in either kilobases (kb) or base pairs (bp). Estimates are typically derived from agarose or acrylamide gel electrophoresis, from sequenced nucleic acids, or from published DNA sequences. For proteins, sizes are given in kilodaltons (kDa) or amino acid residue numbers. Proteins sizes are estimated from gel electrophoresis, from sequenced proteins, from derived amino acid sequences, or from published protein sequences.
(10) In one embodiment of the present invention, a chimeric protein is a non-naturally occurring sequence having a recognition element that is derived from a first peptide or protein sequence found in a host to be treated with the chimeric protein and also included in the chimeric protein is a lysis element that is derived from a second peptide or protein found in the host to be treated with the chimeric protein, wherein individually the first peptide or protein and the second peptide or protein provide to the host anti-pathogen activity and wherein the first peptide or protein and the second peptide or protein bind to different targets on the pathogen.
(11) Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), the complementary (or complement) sequence, and the reverse complement sequence, as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (see e.g., Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)). Because the amino acid sequences of D4E1, thionin, pro-thionin, optimized thionin, optimized pro-thionin, linker 1, linker 2, linker 3, linker 4, linker 5, linker 6, and the chimeric proteins are described, one can chemically synthesize a polynucleotide which encodes these polypeptides/chimeric proteins. Because of the degeneracy of nucleic acid codons, one can use various different polynucleotides to encode identical polypeptides. Table 2, infra, contains information about which nucleic acid codons encode which amino acids.
(12) TABLE-US-00001 TABLE 1 Amino acid Nucleic acid codons Amino Acid Nucleic acid codons Ala/A GCT, GCC, GCA, GCG Arg/R CGT, CGC, CGA, CGG, AGA, AGG Asn/N AAT, AAC Asp/D GAT, GAC Cys/C TGT, TGC Gln/Q CAA, CAG Glu/E GAA, GAG Gly/G GGT, GGC, GGA, GGG His/H CAT, CAC Ile/I ATT, ATC, ATA Leu/L TTA, TTG, CTT, CTC, CTA, CTG Lys/K AAA, AAG Met/M ATG Phe/F TTT, TTC Pro/P CCT, CCC, CCA, CCG Ser/S TCT, TCC, TCA, TCG, AGT, AGC Thr/T ACT, ACC, ACA, ACG Trp/W TGG Tyr/Y TAT, TAC Val/V GTT, GTC, GTA, GTG
(13) In addition to the degenerate nature of the nucleotide codons which encode amino acids, alterations in a polynucleotide that result in the production of a chemically equivalent amino acid at a given site, but do not affect the functional properties of the encoded polypeptide, are well known in the art. Conservative amino acid substitutions are those substitutions that are predicted to interfere least with the properties of the reference polypeptide. In other words, conservative amino acid substitutions substantially conserve the structure and the function of the reference protein. Thus, a codon for the amino acid alanine, a hydrophobic amino acid, may be substituted by a codon encoding another less hydrophobic residue, such as glycine, or a more hydrophobic residue, such as valine, leucine, or isoleucine. Similarly, changes which result in substitution of one negatively charged residue for another, such as aspartic acid for glutamic acid, or one positively charged residue for another, such as lysine for arginine or histidine, can also be expected to produce a functionally equivalent protein or polypeptide. Table 3 provides a list of exemplary conservative amino acid substitutions. Conservative amino acid substitutions generally maintain (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a beta sheet or alpha helical conformation, (b) the charge or hydrophobicity of the molecule at the site of the substitution, and/or (c) the bulk of the side chain.
(14) TABLE-US-00002 TABLE 2 Amino Acid Conservative Substitute Amino Acid Conservative Substitute Ala Gly, Ser Arg His, Lys Asn Asp, Gln, His Asp Asn, Glu Cys Ala, Ser Gln Asn, Glu, His Glu Asp, Gln, His Gly Ala His Asn, Arg, Gln, Glu Ile Leu, Val Leu Ile, Val Lys Arg, Gln, Glu Met Ile, Leu Phe His, Leu, Met, Trp, Tyr Ser Cys, Thr Thr Ser, Val Trp Phe, Tyr Tyr His, Phe, Trp Val Ile, Leu, Thr
(15) Oligonucleotides and polynucleotides that are not commercially available can be chemically synthesized e.g., according to the solid phase phosphoramidite triester method first described by Beaucage and Caruthers, Tetrahedron Letts. 22:1859-1862 (1981), or using an automated synthesizer, as described in Van Devanter et al., Nucleic Acids Res. 12:6159-6168 (1984). Other methods for synthesizing oligonucleotides and polynucleotides are known in the art. Purification of oligonucleotides is by either native acrylamide gel electrophoresis or by anion-exchange HPLC as described in Pearson & Reanier, J. Chrom. 255:137-149 (1983).
(16) The term recombinant when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, organism, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native/endogenous nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells may express genes that are not found within the native (non-recombinant or wild-type) form of the cell or express native genes, proteins or portions thereof that are otherwise abnormally expressedover-expressed, under-expressed or not expressed at all for example a peptide or protein of the form of the chimeric protein or a nucleotide sequence coding for the chimeric protein sequence.
(17) The terms transgenic, transformed, transformation, and transfection are similar in meaning to recombinant. Transformation, transgenic, and transfection refer to the transfer of a polynucleotide into the genome of a host organism or into a cell. Such a transfer of polynucleotides can result in genetically stable inheritance of the polynucleotides, or the polynucleotides remaining extra-chromosomally (not integrated into the chromosome of the cell). Genetically stable inheritance may potentially require the transgenic organism or cell to be subjected for a period of time to one or more conditions which require the transcription of some or all of the transferred polynucleotide in order for the transgenic organism or cell to live and/or grow. Polynucleotides that are transformed, transfected or transferred into a cell but are not integrated into the host's chromosome remain as an expression vector within the cell. One may need to grow the cell under certain growth or environmental conditions in order for the expression vector to remain in the cell or the cell's progeny. Further, for expression to occur the organism or cell may need to be kept under certain conditions. Host organisms or cells containing the recombinant polynucleotide can be referred to as transgenic or transformed organisms or cells or simply as transformants, as well as recombinant organisms or cells.
(18) A genetically altered organism is any organism with any change to its genetic material, whether in the nucleus or cytoplasm (organelle). As such, a genetically altered organism can be a recombinant or transformed organism. A genetically altered organism can also be an organism that was subjected to one or more mutagens or the progeny of an organism that was subjected to one or more mutagens and has changes in its DNA caused by the one or more mutagens, as compared to the wild-type organism (i.e, organism not subjected to the mutagens). Also, an organism that has been bred to incorporate a mutation into its genetic material is a genetically altered organism. For the purposes of this invention, the organism is a plant.
(19) The term vector refers to some means by which DNA, RNA, a protein, or polypeptide can be introduced into a host. The polynucleotides, protein, and polypeptide which are to be introduced into a host can be therapeutic or prophylactic in nature; can encode or be an antigen; can be regulatory in nature; etc. There are various types of vectors including virus, plasmid, bacteriophages, cosmids, and bacteria.
(20) An expression vector is nucleic acid capable of replicating in a selected host cell or organism. An expression vector can replicate as an autonomous structure, or alternatively can integrate, in whole or in part, into the host cell chromosomes or the nucleic acids of an organelle, or it is used as a shuttle for delivering foreign DNA to cells, and thus replicate along with the host cell genome. Thus, an expression vector are polynucleotides capable of replicating in a selected host cell, organelle, or organism, e.g., a plasmid, virus, artificial chromosome, nucleic acid fragment, and for which certain genes on the expression vector (including genes of interest) are transcribed and translated into a polypeptide or protein within the cell, organelle or organism; or any suitable construct known in the art, which comprises an expression cassette. In contrast, as described in the examples herein, a cassette is a polynucleotide containing a section of an expression vector of this invention. The use of the cassettes assists in the assembly of the expression vectors. An expression vector is a replicon, such as plasmid, phage, virus, chimeric virus, or cosmid, and which contains the desired polynucleotide sequence operably linked to the expression control sequence(s).
(21) A polynucleotide sequence is operably linked to an expression control sequence(s) (e.g., a promoter and, optionally, an enhancer) when the expression control sequence controls and regulates the transcription and/or translation of that polynucleotide sequence.
(22) Transformation and generation of genetically altered monocotyledonous and dicotyledonous plant cells is well known in the art. See, e.g., Weising, et al., Ann. Rev. Genet. 22:421-477 (1988); U.S. Pat. No. 5,679,558; Agrobacterium Protocols, ed: Gartland, Humana Press Inc. (1995); and Wang, et al. Acta Hort. 461:401-408 (1998). The choice of method varies with the type of plant to be transformed, the particular application and/or the desired result. The appropriate transformation technique is readily chosen by the skilled practitioner.
(23) Exemplary transformation/transfection methods available to those skilled in the art include, but are not limited to: direct uptake of foreign DNA constructs (see, e.g., EP 295959); techniques of electroporation (see, e.g., Fromm et al., Nature 319:791 (1986)); and high-velocity ballistic bombardment with metal particles coated with the nucleic acid constructs (see, e.g., Kline, et al., Nature 327:70 (1987) and U.S. Pat. No. 4,945,050). Specific methods to transform heterologous genes into commercially important crops (to make genetically altered plants) are published for rapeseed (De Block, et al., Plant Physiol. 91:694-701 (1989)); sunflower (Everett, et al., Bio/Technology 5:1201 (1987)); soybean (McCabe, et al., Bio/Technology 6:923 (1988), Hinchee, et al., Bio/Technology 6:915 (1988), Chee, et al., Plant Physiol. 91:1212-1218 (1989), and Christou, et al., Proc. Natl. Acad. Sci USA 86:7500-7504 (1989)); rice (Hiei, et al., Plant J. 6:271-282 (1994)), and corn (Gordon-Kamm, et al., Plant Cell 2:603-618 (1990), and Fromm, et al., Biotechnology 8:833-839 (1990)). Other known methods are disclosed in U.S. Pat. Nos. 5,597,945; 5,589,615; 5,750,871; 5,268,526; 5,262,316; and 5,569,831.
(24) One exemplary method includes employing Agrobacterium tumefaciens or Agrobacterium rhizogenes as the transforming agent to transfer heterologous DNA into the plant. Agrobacterium tumefaciens-meditated transformation techniques are well described in the scientific literature. See, e.g., Horsch, et al. Science 233:496-498 (1984), and Fraley, et al. Proc. Natl. Acad. Sci. USA 80:4803 (1983). Typically, a plant cell, an explant, a meristem or a seed is infected with Agrobacterium tumefaciens transformed with the expression vector/construct which contains the heterologous nucleic acid operably linked to a promoter. Under appropriate conditions known in the art, the transformed plant cells are grown to form shoots, roots, and develop further into genetically altered plants. In some embodiments, the heterologous nucleic acid can be introduced into plant cells, by means of the Ti plasmid of Agrobacterium tumefaciens. The Ti plasmid is transmitted to plant cells upon infection by Agrobacterium tumefaciens, and is stably integrated into the plant genome. See, e.g., Horsch, et al. (1984), and Fraley, et al. (1983).
(25) Transformed plant cells which are derived by any of the above transformation techniques can be cultured to regenerate a whole plant which possesses the desired transformed phenotype. Such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium, typically relying on a biocide and/or herbicide marker which has been introduced together with the desired nucleotide sequences. Plant regeneration from cultured protoplasts is described in Evans et al., Protoplasts Isolation and Culture, in Handbook of Plant Cell Culture, pp. 124-176, MacMillan Publishing Company, New York, 1983; and Binding, Regeneration of Plants, in Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985. Regeneration can also be obtained from plant callus, explants, organs, or parts thereof. Such regeneration techniques are described generally in Klee, et al., Ann. Rev. of Plant Phys. 38:467-486(1987).
(26) This invention utilizes routine techniques in the field of molecular biology. Basic texts disclosing the general methods of use in this invention include Green and Sambrook, 4th ed. 2012, Cold Spring Harbor Laboratory; Kriegler, Gene Transfer and Expression: A Laboratory Manual (1993); and Ausubel et al., eds., Current Protocols in Molecular Biology, 1994-current, John Wiley & Sons. Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology maybe found in e.g., Benjamin Lewin, Genes IX, published by Oxford University Press, 2007 (ISBN 0763740632); Krebs, et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8).
(27) The term plant includes whole plants, plant organs, progeny of whole plants or plant organs, embryos, somatic embryos, embryo-like structures, protocorms, protocorm-like bodies (PLBs), and suspensions of plant cells. Plant organs comprise, e.g., shoot vegetative organs/structures (e.g., leaves, stems and tubers), roots, flowers and floral organs/structures (e.g., bracts, sepals, petals, stamens, carpels, anthers and ovules), seed (including embryo, endosperm, and seed coat) and fruit (the mature ovary), plant tissue (e.g., vascular tissue, ground tissue, and the like) and cells (e.g., guard cells, egg cells, trichomes and the like). The class of plants that can be used in the method of the invention is generally as broad as the class of higher and lower plants amenable to the molecular biology and plant breeding techniques described herein, specifically angiosperms (monocotyledonous (monocots) and dicotyledonous (dicots) plants including eudicots. It includes plants of a variety of ploidy levels, including aneuploid, polyploid, diploid, haploid and hemizygous. The genetically altered plants described herein can be monocot crops, such as, sorghum, maize, wheat, rice, barley, oats, rye, millet, and triticale. The genetically altered plants described herein can also be dicot crops, such as apple, grape, pear, peach, plum, orange, lemon, lime, grapefruit, pomegranate, olive, peanut, tobacco, etc. Also, the genetically altered plants (or plants with altered genomic DNA) can be horticultural plants such as rose, marigold, primrose, dogwood, pansy, geranium, etc. In some embodiments, the genetically altered plants are citrus plants. In other embodiments, the genetically altered plants are N. benthamiana or tobacco plants.
(28) Once a genetically altered plant has been generated, one can breed it with a wild-type plant and screen for heterozygous F1 generation plants containing the genetic change present in the parent genetically altered plant. Then F2 generation plants can be generated which are homozygous for the genetic alteration. These heterozygous F1 generation plants and homozygous F2 plants, progeny of the original genetically altered plant, are considered genetically altered plants, having the altered genomic material from the genetically altered parent plant.
(29) After one obtains a genetically altered plant expressing the chimeric protein, one can efficiently breed the genetically altered plant with other plants containing desired traits. One can use molecular markers (i.e., polynucleotide probes) based on the sequence of the chimeric protein as described above to determine which offspring of crosses between the genetically altered plant and the other plant have the polynucleotide encoding the chimeric protein. This process is known as Marker Assisted Rapid Trait Introgression (MARTI). Briefly, MARTI involves (1) crossing the genetically altered plant with a plant line having desired phenotype/genotype (elite parent) for introgression to obtain F1 offspring. The F1 generation is heterozygous for chimeric protein trait. (2) Next, an F1 plant is be backcrossed to the elite parent, producing BC1F1 which genetically produces 50% wild-type and 50% heterozygote chimeric protein. (3) PCR using the polynucleotide probe is performed to select the heterozygote genetically altered plants containing polynucleotide encoding the chimeric protein. (4) Selected heterozygotes are then backcrossed to the elite parent to perform further introgression. (5) This process of MARTI is performed for another four cycles. (6) Next, the heterozygote genetically altered plant is self-pollinated by bagging to produce BC6F2 generation. The BC6F2 generation produces a phenotypic segregation ratio of 3 wild-type parent plants to 1 chimeric protein genetically altered plant. (7) One selects genetically altered chimeric protein plants at the BC6F2 generation at the seedling stage using PCR with the polynucleotide probe and can optionally be combined with phenotypic selection at maturity. These cycles of crossing and selection can be achieved in a span of 2 to 2.5 years (depending on the plant), as compared to many more years for conventional backcrossing introgression method now in use. Thus, the application of MARTI using PCR with a polynucleotide probe significantly reduces the time to introgress the chimeric protein genetic alteration into elite lines for producing commercial hybrids. The final product is an inbred plant line almost identical (99%) to the original elite in-bred parent plant that is the homozygous for the polynucleotide encoding the chimeric protein.
(30) The terms approximately and about refer to a quantity, level, value or amount that varies by as much as 30%, or in another embodiment by as much as 20%, and in a third embodiment by as much as 10% to a reference quantity, level, value or amount. As used herein, the singular form a, an, and the include plural references unless the context clearly dictates otherwise. For example, the term a bacterium includes both a single bacterium and a plurality of bacteria.
(31) Having described the invention in general terms, below are examples illustrating the generation and efficacy of the invention.
(32) Referring to
(33) Referring now to
(34) Referring now to
(35) Referring now to
(36) Referring now to
(37) TABLE-US-00003 TABLE3 SequenceListing SEQ ID NO ID Name AA/nucleotide 1 XM0022 Subtilisinstb6.1 1MTLGRRLACLFLACVLPALL 80906.3 orsubtilisin LGGTASASERGLWEKGYTGAKVKMAIFDTG (vitisvinifera) IRANHPHFRN Thedomain204-469 61IKERTNWTNEDTLNDNLGHG aminoacidofthe TFVAGVIAGQYDECLGFAPDTEIYAFRVFT 1046aminoacid DAQVSYTSWF longprotein 121LDAFNYAIATNMDVLNLSIG Subtilisin GPDYLDLPVFEKVWELTANNIIMVSAIGND Sequence GPLYGTLNNP *fromHuman 181ADQSDVIGVIDYGDHIASFS neutrophil SRGMSTWEIPHGYGRVKPDVVAYGREIMGS elastase SISANCKSLS NM001972.3 241GTSVASPVVAGVVCLLVSVI PEHDRKNILNPASMKQALVEGAARLPDANM YEQGAGR 2 XM0106 54727.2 Gammathionin (vitisvinifera)
(38) The chimera protein of an embodiment of the present invention may be produced using any of a number of systems to obtain the desired quantities of the protein. There are many expression systems well known in the art. (See, e.g., Gene Expression Systems, Fernandes and Hoeffler, Eds. Academic Press, 1999; Ausubel, supra.) Typically, the polynucleotide that encodes the chimera or component thereof is placed under the control of a promoter that is functional in the desired host cell. An extremely wide variety of promoters are available, and can be used in the expression vectors of the invention, depending on the particular application. Ordinarily, the promoter selected depends upon the cell in which the promoter is to be active. Other expression control sequences such as ribosome binding sites, transcription termination sites and the like are also optionally included. Constructs that include one or more of these control sequences are termed expression cassettes or constructs. Accordingly, the nucleic acids that encode the joined polypeptides are incorporated for high level expression in a desired host cell.
(39) The production of CHAMPs as secreted proteins in plant, insect and mammalian expression systems is generally preferred, since the active components of the chimera will typically require various post-translational modifications to produce correctly-folded, biologically active polypeptides. In particular, given that defensins contain up to four disulfide bridges that are required for functional activity, and SRDs may contain glycosylation sites and disulfide bonds, expression of SRD/defensin chimeras as secreted proteins is preferred in order to take advantage of the robust structural integrity rendered by these post-translational modifications.
(40) For example, insect cells possess a compartmentalized secretory pathway in which newly synthesized proteins that bear an N-terminal signal sequence transit from the endoplasmic reticulum (ER), to the Golgi apparatus, and finally to the cell surface via vesicular intermediates. The compartments of the secretory pathway contain specialized environments that enhance the ability of proteins that pass through to fold correctly and assume a stable conformation. For example, the ER supports an oxidizing environment that catalyzes disulfide bond formation, and both the ER and Golgi apparatus contains glycosylation enzymes that link oligosaccharide chains to secretory proteins to impart stability and solubility. In general, secreted proteins receive these modifications as a way of stabilizing protein structure in the harsher environment of the cell surface, in the presence of extracellular proteases and pH changes. One example of an insect expression system that may be used to express the chimeras of the invention is a Bacculovirus expression system (see below). The use of a Bacculovirus expression system to express a prototype SRD/defensin chimera is illustrated in Example 3, infra.
(41) To illustrate, chimeras may be expressed in a Baculovirus system as follows. Briefly, DNA expressing a chimera are cloned into a modified form of the Baculovirus transfer vector pAcGP67B (Pharmingen, San Diego, Calif.). This plasmid contains the signal sequence for gp67, an abundant envelope surface glycoprotein on Autographa californica nuclear polyhedrosis virus (AcNPV) that is essential for the entry of Baculovirus particles into target insect cells. Insertion of the chimera gene into this vector will yield expression of a gp67 signal peptide fusion to the chimera, under the control of the strong Baculovirus polyhedrin promoter. The signal peptide will direct the entire protein through the secretory pathway to the cell surface, where the signal peptide is cleaved off and the chimera protein can be purified from the cell supernatant.
(42) The Baculovirus transfer vector pAcGP67B may be modified by inserting a myc epitope and 6.times.His tag at the 3 end of the multiple cloning region for identification and purification purposes (pAcGP67B-MH). Chimera genes inserted into pAcGP67B-MH may be co-transfected with Baculogold DNA into Sf21 cells using the Baculogold transfection kit (Pharmingen). Recombinant viruses formed by homologous recombination are amplified, and the protein purified from a final amplification in High Five cells (Invitrogen, Carlsbad, Calif.), derived from Trichoplusia ni egg cell homogenates. High Five cells have been shown to be capable of expressing significantly higher levels of secreted recombinant proteins compared to Sf9 and Sf21 insect cells.
(43) Various transgenic plant expression systems may also be utilized for the generation of the chimera proteins of the invention, including without limitation tobacco and potato plant systems (e.g., see Mason et al., 1996, Proc. Natl. Acad. Sci. USA 93: 5335-5340).
(44) Optionally, a bioreactor may be employed, such as the CELLine 350 bioreactor (Integra Biosciences). This particular bioreactor provides for culturing the plant cells within a relatively low-volume, rectangular chamber (5 ml), bounded by an oxygen-permeable membrane on one side, and a protein-impermeable, 10 kD molecular weight cut-off membrane on the other side, separating the cell compartment from the larger (350 ml) nutrient medium reservoir. The use of such a bioreactor permits simple monitoring of protein concentrations in the cell chamber, as a function of time, and simple characterization of proteins secreted into the medium using SDS-PAGE. Thus, such bioreactors also facilitate the expression of heterologous proteins in plant expression systems. Various other bioreactor and suspension-culture systems may be employed. See, for example, Decendit et al., 1996, Biotechnol. Lett. 18: 659-662.
(45) Generation of Xf Resistent Transgenic Plants:
(46) Genes encoding the anti-Xf chimeras of the invention may be introduced into grapevines using several types of transformation approaches developed for the generation of transgenic plants (see, for example, Szankowski et al., 2003 Plant Cell Rep. 22: 141-149). Standard transformation techniques, such as Agrobacterium-mediated transformation, particle bombardment, microinjection, and electroporation may be utilized to construct stably-transformed transgenic plants (Hiatt et al., 1989, Nature 342: 76-78). In addition, recombinant viruses which infect grapevine plants may be used to express the heterologous chimera protein of interest during viral replication in the infected host (see, for example, Kumagai et al., 1993, Proc. Natl. Acad. Sci. USA 90: 427-430).
(47) Vectors capable of facilitating the expression of a transgene in embryogenic cells of grapevine plants are known, several of which are shown in
(48) As shown by the results of the study described in Example 4, supra, transgenic grape plants expressing a test protein in the plant's xylem can be generated using standard methodologies. In one embodiment, the genetic information necessary to express an anti-Xf chimera may be introduced into grapevine embryonic cells to generate transgenic grapevines expressing the chimera using standard transgenic methodologies. In preferred embodiments, DNA encoding the chimera is fused to a xylem targeting sequence or a secretion leader peptide from a xylem-expressed plant protein or precursor. In view of the success achieved with the test protein, pear PGIP (see Example 4, supra), a specific embodiment utilizes the PGIP secretion leader peptide:
(49) TABLE-US-00004 (SEQIDNO.26) MELKFSTFLSLTLLFSSVLNPALS.
(50) Another example of a secretion leader which may be employed is the rice alpha-amylase leader:
(51) TABLE-US-00005 (SEQIDNO.25) MGKHHVTLCCVVFAVLCLASSLAQA.
(52) As is known in the art, different organisms preferentially utilize different codons for generating polypeptides. Such codon usage preferences may be used in the design of nucleic acid molecules encoding the chimeras of the invention in order to optimize expression in a particular host cell system.
(53) Another embodiment provides for treating infected plants with topical chimera protein as described herein. The signal sequence at the N-terminus will not be present in the protein chimera for topical use. Topical treatment will clear Xf from infected plants according to one embodiment. The ability to produce the chimeras on a large scale will also allow topical delivery to cure grapevines already infected with Xf and block PD. We also have the ability to further improve the activity of (BPI/LBP and defensin) and (subtilisin and defensin) chimeras.
(54) Treatment of Pierce's Disease:
(55) The anti-Xylella fastidiosa chimeras of the invention may be used for the treatment of Pierce's Disease in grapevines. Candidate chimeras may be initially evaluated using cell survival assays capable of assessing Xf killing. Chimeras showing activity in such in vitro assay systems may be further evaluated in plant assay systems. Chimeras demonstrating Xf killing in these systems may be used for the therapeutic treatment of symptomatic or asymptomatic grapevines or for the prophylactic treatment of vines exposed to Xf or at risk of being exposed to Xf.
(56) For therapeutic treatment, an anti-pathogen chimera (for example an anti-Xf chimera) is administered to the affected plant in a manner that permits the chimera to gain access to the xylem, where Xf colonies are located. Accordingly, the chimera may be administered directly to the xylem system, for example, via microinjection into the plant (e.g., stem, petiole, trunk). In one embodiment, anti-Xf chimera composition is injected directly into an infected grapevine, in one embodiment via a plugged, approximately 0.5 cm hole drilled into the vine, through which a syringe containing the composition may be inserted to deliver the composition to the xylem.
(57) In one embodiment, a method of treating Pierce's Disease in a Vitus vinifera plant infected with Xf, comprises spraying the Vitus vinifera plant with an adherent composition containing an anti-Xf chimera. Various adherent compositions are known, and typically are formulated in liquid for ease of application with a sprayer. Adherent powders or semi-liquids may also be employed. A related embodiment is a method of preventing the development of Pierce's Disease in a Vitus vinifera plant, and comprises spraying the Vitus vinifera plant with an adherent composition containing an anti-Xf chimera.
(58) Alternatively, an expressible gene encoding the chimera may be introduced into a plant virus capable of infecting grapevine plants, and the recombinant virus used to infect the plant, resulting in the expression of the chimera in the plant. In such applications, the use of xylem secretory signals may be used to target the chimera product to the infected plant's xylem.
(59) The chimera may also be administered to the plant via the root system, in order to achieve systemic administration and access to primary xylem chambers. Similarly, the chimera may be administered to vine trunks, directly into primary xylem chambers, in order to deliver the chimera to upstream xylem throughout the plant.
(60) The treatment of Pierce's Disease using the chimeras of the invention may also target the insect vectors responsible for the spread of Pierce's Disease. In this aspect of the invention, anti-Xf chimeras are introduced into the insect vector itself, so that the chimera can kill the Xf colonies residing in the insect, thereby inhibiting the further spread of the pathogen. In one embodiment, plants susceptible to feeding by a Xf vector insect (e.g., glassy winged sharpshooter) are sprayed with a composition that comprises the chimera and a carrier capable of adhering to the surface of the vine plants. When the vector insect feeds upon the treated plant, some of the composition is both ingested by the insect and injected into the plant. In effect, the insect thereby mediates the injection of the composition into the plant's xylem sap as it feeds on the plant. Accordingly, the anti-microbial composition then has the opportunity to inhibit the development of Xf colonies in the newly infected plant by killing bacteria at the feeding insertion site. Additionally, the ingestion of the composition by the insect also provides an opportunity to target and kill Xf colonies residing inside the vector insect, thereby inhibiting further spread.
(61) Variations of this approach are contemplated. For example, a composition comprising an anti-Xf chimera of an embodiment of the present invention, an insect food source, and/or a biological or chemical insect attractant may be placed locally in regions at risk for, or known to be susceptible to, insect-vectored Xf (e.g., vineyards, groves). In one embodiment, such a composition comprises an anti-Xf chimera solubilized in a sucrose solution. In another embodiment, the anti-Xf composition may be solubilized or suspended in a sap or sap-containing solution, preferably using sap from the insect vector's natural food sources. The composition may be exposed to the insect vector in any number of ways, including for example by placing appropriate feeder vessels in susceptible vineyards, adjacent crop areas, inhabited groves or in breeding habitats. In this regard, the glassy-winged sharpshooter inhabits citrus and avocado groves and some woody ornamentals in unusually high numbers. At immediate risk are vineyards near citrus orchards.
(62) In addition to the treatment of established Xf infections, diseases caused by Xf may be prevented or inhibited using the chimeras of the invention in a prophylactic treatment approach, using the same or similar methods as described above. In one approach, for example, plants which are not susceptible to Xf infection and/or Xf-caused disease, but which are used by Xf insect vectors to breed or feed, may be sprayed with a composition containing an anti-Xf chimera of the invention. Insect vectors feeding upon such plants, for example, will ingest the composition, which is then available to kill Xf present in the insect vector, thereby preventing the spread of new infections to susceptible or carrier plants.
Example 1
(63) Human proteinase K is very well characterized and the cleavage analysis shows that it is more active on Xf mopB than HNE. Proteainase K homologs in grape belong to subtilisin family and they have 43% sequence similarity to human proteinase K. Subtilisin-like protease SBT6.1 from Vitis vinifera with the sequence shown in
(64) The preceding examples can be repeated with similar success by substituting the generically or specifically described reactants and/or operating conditions of this invention for those used in the preceding examples.
(65) Although the invention has been described in detail with particular reference to examples, and one or more embodiments, other embodiments can achieve the same results. Identity can be calculated by known methods. Identity, or homology, percentages as mentioned herein are those that can be calculated with the Blast or GAP program, running under GCG (Genetics Computer Group Inc., Madison, Wis., USA). Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith & Waterman, Adv. Appl. Math. 2:482, 1981; Needleman & Wunsch, J. Mol. Biol. 48:443, 1970; Pearson & Lipman, Proc. Nat. Acad Sci. USA 85:2444, 1988; Higgins & Sharp, Gene, 73:23744, 1988; Higgins & Sharp, CABIOS 5:151-3, 1989; Corpet et al., Nuc. Acids Res. 16:10881-90, 1988; Huang et al. Computer Appls. in the Biosciences 8, 155-65, 1992; and Pearson et al., Meth Mol. Bio. 24:307-31, 1994. Altschul et al., J. Mol. Biol. 215:403-10, 1990, presents a detailed consideration of sequence alignment methods and homology calculations. A chimera protein of the disclosure can have about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% amino acid sequence homology to at least one of the SEQ ID Nos 4-7 and 30-33. A sequence that forms part of the chimera protein of the disclosure can have 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% amino acid sequence homology to a subtilisin, BPI/LBP or definsin amino acid sequence as disclosed herein. A chimera protein expressed in the host can be mature and not include the signal sequence.
(66) Variations and modifications of the present invention will be obvious to those skilled in the art and it is intended to cover in the appended claims all such modifications and equivalents. The entire disclosures of all references, applications, patents, and publications cited above are hereby incorporated by reference.
LITERATURE CITED
(67) Paradigms: examples from the bacterium Xylella fastidiosa. Purcell A. Annu Rev Phytopathol. 2013; 51:339-56. doi: 10.1146/annurev-phyto-082712-102325. The biology of xylem fluid-feeding insect vectors of Xylella fastidiosa and their relation to disease epidemiology. Redak R A, Purcell A H, Lopes J R, Blua M J, Mizell R F 3rd, Andersen P C. Annu Rev Entomol. 2004; 49:243-70. Pierce's Disease, Special Notices, Pierce's Disease Brochure: A Decade of Progress, 2009, http://www.wineinstitute.org/initiatives/issuesandpolicy/piercesdisease The Costs of Pierce's Disease in the California Winegrape Industry, Kabir P. Tumber, Julian M. Alston, and Kate B. Fuller, 2012, CWE Working Paper number 1204, published by Robert Mandavi Institute, Center for Wine Economics; see also http://californiaagriculture.ucanr.edu/landingpage.cfm?article=ca.v068n01p20&fulltext=yes, Pierce's disease costs California $104 million per year by Kabir P. Tumber, Julian M. Alston and Kate B. Fuller Economic Consequences of Pierce's Disease and Related Policy in the California Wine grape Industry, Julian M. Alston, Kate B. Fuller, Jonathan D. Kaplan. and Kabir P. Tumber, Journal of Agricultural and Resource Economics 38(2):269-297. An engineered innate immune defense protects grapevines from Pierce disease. Dandekar A M, Gouran H, Ibifez A M, Uratsu S L, Agilero C B, McFarland S, Borhani Y, Feldstein P A, Bruening G, Nascimento R, Goulart L R, Pardington P E, Chaudhary A, Norvell M, Civerolo E, Gupta G. Proc Natl Acad Sci USA. 2012 Mar. 6; 109(10):3721-5. Degradation of outer membrane protein A in Escherichia coli killing by neutrophil elastase. Belaaouaj A, Kim K S, Shapiro S D. Science. 2000 Aug. 18; 289(5482):1185-8. Broad activity against porcine bacterial pathogens displayed by two insect antimicrobial peptides moricin and cecropin B. Hu H, Wang C, Guo X, Li W, Wang Y, He Q. Mol Cells. 2013 February; 35(2):106-14. Galvez, L. C., Korus, K., Fernandez, J., Behn, J. L., and Banjara, N. 2010. The Threat of Pierce's Disease to Midwest Wine and Table Grapes. Online. APSnet Features. doi:10.1094/APSnetFeature-2010-1015. Natural hosts of Xylella fastidiosa in Florida. Hopkins D. L., Adlerz W. C., 1988. Plant Disease 72: 429-431. Identification and characterization of the defensin-like gene family of grapevine. Giacomelli L, Nanni V. Lenzi L, Zhuang J, Dalla Serra M Banfield M J, Town C D, Silverstein K A, Baraldi E, Moser C. Mol Plant Microbe Interact. 2012 August; 25(8):1118-31. Proteinase K and the structure of PrPSc: The good, the bad and the ugly. Silva C J, Vizquez-Fernndez E, Onisko B. Requena J R. Virus Res. 2015 Sep. 2; 207:120-6. The BPI/LBP family of proteins: a structural analysis of conserved regions. Beamer L J, Carroll S F, Eisenberg D. Protein Sci. 1998 April; 7(4):906-14. Look up https://www.ncbi.nlm.nih.gov/protein/XP_002277143.2 for the grape homolog. Genome-wide and molecular evolution analysis of the subtilase gene family in Vitis vinifera. Cao J, Han X, Zhang T, Yang Y, Huang J, Hu X. BMC Genomics. 2014 Dec. 16; 15:1116 Suitability of non-lethal marker and marker-free systems for development of transgenic crop plants: present status and future prospects. Manimaran P, Ramkumar G, Sakthivel K, Sundaram R M, Madhav M S, Balachandran S M. Biotechnol Adv. 2011 November-December; 29(6):703-14. Identification of genomic sites for CRISPR/Cas9-based genome editing in the Vitis vinifera genome. Wang Y, Liu X, Ren C, Zhong G Y, Yang L, Li S, Liang Z. BMC Plant Biol. 2016 Apr. 21; 16:96. expasy.org/tools/peptidecutter PeptideCutter [references/documentation] predicts potential cleavage sites cleaved by proteases or chemicals in a given protein sequence. Plant gamma-thionins: novel insights on the mechanism of action of a multi-functional class of defense proteins. Pelegrini P B, Franco O L. Int J Biochem Cell Biol. 2005 November; 37(11):2239-53. Rapid clearance of bacteria and their toxins: development of therapeutic proteins. Kunkel M, Vuyisich M, Gnanakaran G, Bruening G E, Dandekar A M, Civerolo E, Marchalonis J J, Gupta G. Crit Rev Immunol. 2007; 27(3):233-45. A dual-purpose protein ligand for effective therapy and sensitive diagnosis of anthrax. Vuyisich M, Gnanakaran S. Lovchik J A, Lyons C R, Gupta G. Protein J. 2008 August; 27(5):292-302