Methods and compositions for vault nanoparticle immobilization of therapeutic molecules and for vault targeting

12305200 ยท 2025-05-20

Assignee

Inventors

Cpc classification

International classification

Abstract

Described herein are compositions and methods for the immobilization of passenger molecules in a dense matrix of ADP-ribose within the vault particle. The present disclosure also describes a method for altering the physicomechanical properties (e.g. density, compressive strength, electrostatic properties, etc.) of packaged vaults for enhanced stability and/or downstream functionality. In addition, the present disclosure also describes compositions and methods for altering amino acid sequence of the vault protein in the vault particle by amino acid mutation, amino acid insertion and/or amino acid deletion to package passenger molecules and/or to target vault particles to specific receptors or ligands.

Claims

1. An engineered vault particle comprising multiple copies of a major vault protein (MVP) which are engineered to comprise a mutation of at least one amino acid of a shoulder domain of a wild-type MVP and wherein the mutated shoulder domain comprises a peptide of interest on the outer-facing surface of the engineered vault particle, wherein the mutated shoulder domain comprises a region spanning from methionine at position 608 to proline at position 620 of SEQ ID NO. 9 or wherein the mutated shoulder domain comprises a region spanning from threonine at position 608 to proline at position 620 of SEQ ID NO. 10, wherein the mutation of at least one amino acid results in an even distribution of the mutation around the shoulder domain or circumference of the shoulder domain of the engineered vault particle, and wherein the mutation of at least one amino acid is an insertion of the peptide of interest which is an epitope tag having the sequence DYKDDDDK (SEQ ID) NO: 6) or a gastrin-releasing peptide receptor (GRP-R)-binding peptide having the sequence QWAVGHLM (SEQ ID NO.: 3).

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1A-FIG. 1D show schematic diagrams of current vault packaging strategies represented as a longitudinal cross-section. FIG. 1A shows the passenger molecules are fused to the caps (carboxyl-terminus) of the vault nanoparticle. FIG. 1B shows the passenger molecules are fused to the waist (amino-terminus) of the vault nanoparticle. FIG. 1C shows the passenger molecules are fused to the mINT domain of PARP4. FIG. 1D shows the passenger molecules are freely encapsulated by the vault during vault assembly.

(2) FIG. 2 shows an ADP-ribosylation reaction. An ester bond forms between the acceptor molecule and the first ADP-ribose of NAD+. Polymerization of an ADP-ribose chain occurs through 2-1 glycosidic bond formation, in a linear fashion, and branching may occur after 20 ADP-ribose units to create a dense matrix.

(3) FIG. 3A shows alignment of the ADP-ribosyltransferase catalytic motif of human PARPs and their activity state. FIG. 3B shows alignment of the catalytic motif of arginine specific ADP-ribosyltransferses (ARTs).

(4) FIG. 4 shows domain architecture of PARP4. PARP4 is composed of a phosphopeptide binding module (BRCT), PARP catalytic domain, a vault protein inter-alpha trypsin (VIT) domain, a von Willebrand A (vWA) domain, a nuclear localization signal (NLS) and a major vault protein interaction (mINT) domain.

(5) FIG. 5A-FIG. 5C show a schematic of different methods for PARP4 catalyzed ADP-ribosylation within the vault cavity. FIG. 5A shows encapsulation of passenger molecules during vault synthesis. FIG. 5B shows co-incubation of passenger molecules with completed vaults. FIG. 5C shows a legend describing features shown in FIGS. 5A and 5B.

(6) FIG. 6A-FIG. 6B show electrophoretic migration of vaults in a native agarose gel. FIG. 6A schematic representation of agarose gel electrophoresis and vault mobility based on charge; vaults containing PARP4 (right lane) and vaults without PARP4 (left lane) following incubation with a small molecule and NAD+ in ADP-ribosylation buffer. FIG. 6B shows migration of vaults in a native agarose gel based on charge; vaults containing PARP4 (right lane) and vaults without PARP4 (left lane) following incubation with a small molecule and NAD+ in ADP-ribosylation buffer.

(7) FIG. 7A shows electron micrographs of uranyl acetate stained vaults that contain passenger molecules. FIG. 7B shows electron micrographs of uranyl acetate stained vaults that are empty.

(8) FIG. 8 shows an exemplary linear and branched ADP ribose polymer.

(9) FIG. 9 shows an alignment of the amino acid sequence of rat MVP

(10) TABLE-US-00001 (NCBIGenBankNP_073206.2)andhumanMVP (SEQ.IDNO.:9) MATEEAIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPVR MVTVPPRHYCIVANPVSRDTQSSVLFDITGQVRLRHADQEIRLAQDPFP LYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEG PGTYIPQKEVEVVEIIQATVIKQNQALRLRARKECFDREGKGRVTGEEW LVRSVGAYLPAVFEEVLDLVDAVILTEKTALHLRALQNFRDLRGVLHRT GEEWLVTVQDTEAHVPDVYEEVLGVVPITTLGPRHYCVILDPMGPDGKN QLGQKRVVKGEKSFFLQPGERLERGIQDVYVLSEQQGLLLKALQPLEEG ESEEKVSHQAGDCWLIRGPLEYVPSAKVEVVEERQAIPLDQNEGIYVQD VKTGKVRAVIGSTYMLTQDEVLWEKELPSGVEELLNLGHDPLADRGQKG TAKPLQPSAPRNKTRVVSYRVPHNAAVQVYDYRAKRARVVFGPELVTLD PEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQL QLAYNWHFELKNRNDPAEAAKLFSVPDFVGDACKAIASRVRGAVASVTF DDFHKNSARIIRMAVFGFEMSEDTGPDGTLLPKARDQAVFPQNGLVVSS VDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARG RLERQKILDQSEAEKARKELLELEAMSMAVESTGNAKAEAESRAEAARI EGEGSVLQAKLKAQALAIETEAELERVKKVREMELIYARAQLELEVSKA QQLANVEAKKFKEMTEALGPGTIRDLAVAGPEMQVKLLQSLGLKSTLIT DGSSPINLFSTAFGLLGLGSDGQPPAQK (NCBIGenBankNP_059447.2) (SEQ.IDNO.:10) MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMR MVTVPPRHYCTVANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFP LYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKDGDKVVAGDEWLFEG PGTYIPRKEVEVVEIIQATIIRQNQALRLRARKECWDRDGKERVTGEEW LVTTVGAYLPAVFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRT GEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKN QLGQKRVVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEG EDEEKVSHQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQD VKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLADRGEKD TAKSLQPLAPRNKTRVVSYRVPHNAAVQVYDYREKRARVVFGPELVSLG PEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQL QLAYNWHFEVNDRKDPQETAKLFSVPDFVGDACKAIASRVRGAVASVTF DDFHKNSARIIRTAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSS VDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARG RLERQKILDQSEAEKARKELLELEALSMAVESTGTAKAEAESRAEAARI EGEGSVLQAKLKAQALAIETEAELQRVQKVRELELVYARAQLELEVSKA QQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQSLGLKSTLIT DGSTPINLENTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQSAQAPQA PGDNHVVPVLR.
Domains are annotated based on the crystal structure of the rat vault solved by Tanaka et al 2009 (Science, 2009, 323 (5912): 384-8).

(11) FIG. 10A-FIG. 10B show cartoon representations of the rat MVP. FIG. 10A shows the domain structure and select inner-facing loops and select amino acid side chains. FIG. 10B shows the binding of a passenger molecule through multiple, engineered non-covalent interactions spread throughout the vault barrel.

(12) FIG. 11A-FIG. 11B shows a cartoon representation of the rat MVP and strategies to insert sequences into the shoulder domain. FIG. 11A shows the shoulder domain and the unstructured outer-facing region in the shoulder domain. FIG. 11B shows two non-limiting example strategies for introducing receptor or ligand peptides into the shoulder domain. FIG. 11B also includes sequences

(13) TABLE-US-00002 (SEQIDNO.:11) GAGATGTCTGAAGACACAGGTCCTGATGGCACACTCCTGCCCAAG, (SEQIDNO.:12) EMSEDTGPDGTLLPK, (SEQIDNO.:13) GAGATGTCTGAAGACACAGGTAGCGCTCCTGATGGCACACTCCTGCCCA AG, (SEQIDNO.:14) EMSEDTGSAPDGTLLPK, (SEQIDNO.:15) GAGAGCGCTAAG, (SEQIDNO.:16) ESAK, (SEQIDNO.:17) GAGATGTCTGAAGACACAGGTAGC, (SEQIDNO.:18) EMSEDTGS, (SEQIDNO.:19) GCTCCTGATGGCACACTCCTCCCCAAG,and (SEQIDNO.:20) APDGTLLPK.

(14) FIG. 12A-FIG. 12B shows assembly and functional activity of rat vault nanoparticles modified to express the gastrin releasing peptide (GRP) ligand in the unstructured region of the shoulder domain. FIG. 12A shows representative immunogold electron micrographs of wild type and gastrin releasing peptide receptor (GRPR) targeting vaults stained with rabbit anti-gastrin releasing peptide and goat anti-rabbit IgG-10 am gold. Frequency of immunogold labeling of vaults is plotted as the mean and standard deviation (Two-tailed T-test) and representative, individual immunogold labeled GRP-Vaults are shown below. FIG. 12B shows an in vitro binding assay with Dylight-488 labeled wild type vaults or Dylight-488 labeled GRPR targeting vaults and a human prostate cancer cell line, PC-3, that expresses GRPR. C, cytoplasm; N, nucleus; arrow, a single vault particle.

TERMINOLOGY

(15) In the following description, certain specific details are set forth in order to provide a thorough understanding of various embodiments. However, one skilled in the art will understand that the embodiments provided may be practiced without these details.

(16) Unless the context requires otherwise, throughout the specification and claims which follow, the word comprise and variations thereof, such as, comprises and comprising are to be construed in an open, inclusive sense, that is, as including, but not limited to.

(17) As used herein, the terms vault, vault particle and vault nanoparticle, are used interchangeably to refer to a complex of major vault proteins (MVP) that are synthesized to form a vault with an internal cavity. In some embodiments, the vault is synthesized with a 3D nanoprinting technique. In some embodiments, the vault has an ovoid shape.

(18) As used herein, the term, ADP-ribosylation, generally refers to the enzyme catalyzed reaction whereby one (mono) or more (poly) ADP-ribose units derived from the substrate are covalently linked to an acceptor molecule, unless otherwise noted.

(19) As used herein, the term, substrate, generally refers to NAD+ or analogs of NAD+, unless otherwise noted.

(20) As used herein, the term, passenger molecule, generally refers to one or more molecules (e.g., proteins, carbohydrates, nucleic acids, lipids, small molecules, active pharmaceutical ingredients etc. and combinations thereof) that are completely or partially enclosed within the vault particle or expressed on the outer-facing surface of the vault particle.

(21) As used in this specification and the appended claims, the singular forms a. an. and the include plural referents unless the content clearly dictates otherwise. It should also be noted that the term or is generally employed in its sense including and/or unless the content clearly dictates otherwise. Further, headings provided herein are for convenience only and do not interpret the scope or meaning of the claimed embodiments.

(22) As used herein the term about refers to an amount that is near the stated amount by about 10%, 5%, or 1%.

(23) As used herein, the terms homologous. homology. percent homologous, or percent homology, when used herein to describe an amino acid sequence or a nucleic acid sequence, relative to a reference sequence, can be determined using the formula described by Karlin and Altschul (Proc. Natl. Acad. Sci. USA 87:2264-2268, 1990, modified as in Proc. Natl. Acad. Sci. USA 90:5873-5877, 1993). Such a formula is incorporated into the basic local alignment search tool (BLAST) programs of Altschul et al. (J. Mol. Biol. 215:403-410, 1990). Percent homology of sequences can be determined using the most recent version of BLAST, as of the filing date of this application.

DETAILED DESCRIPTION OF THE DISCLOSURE

(24) Targeted delivery of therapeutics to cells, such as abnormal or cancerous cells, is critical to minimize off-target effects including toxicity and autoimmune responses. Vault nanoparticles containing passenger molecules (e.g., therapeutics) may be used for such targeted delivery. Targeting a vault nanoparticle to a cell typically requires a receptor or ligand on the outer-facing surface of the vault particle that is accessible to bind to its respective ligand or receptor (e.g., on a target cell) (FIG. 1A). Passenger molecules of interest can be packaged into recombinant vaults by either linking them to the MVP (FIGS. 1A and B) or to the major vault interaction domain (mINT) of PARP4 (FIG. 1C), or by passive encapsulation during vault synthesis (FIG. 1D).

(25) The PARP family of enzymes makes up one subclass of ADP-ribosyltransferases which are capable of mediating ADP-ribosylation. ADP-ribosylation is the addition of ADP-ribose onto an acceptor molecule (see, e.g., FIG. 2). This process is catalyzed by an ADP-ribosyltransferase (e.g., PARP4), and uses NAD+ as the substrate. ADP-ribosylation requires acceptor sites on these acceptor molecules, such as a carboxyl group on aspartic acid, glutamic acid, and an amine group on lysine. MVP, PARP4, NAD+ and NAD+ analogs may serve as acceptors for ADP-ribosylation to some degree. Thus, to achieve ADP-ribosylation inside the vault, acceptor sites may be present on target passenger molecules, passenger excipients, and/or a vault protein (MVP, PARP, TEP).

(26) PARPs are predominately defined by a H-Y-E catalytic motif (see, e.g., FIG. 3A), while the other subclass of ADP-ribosyltransferases have a R-S-E motif (see, e.g., FIG. 3B). PARPs use the H-Y-E catalytic motif to deposit ADP-ribose to carboxylic acid acceptors. ADP-ribosyltransferases containing the R-S-E catalytic motif use the guanidino group as the acceptor.

(27) PARP4 is unique among ADP-ribosyltransferases because it contains a major vault protein interaction (mINT) domain at its C-terminus that binds to the vault (see, e.g., FIG. 4). To accommodate passenger molecules or passenger excipients with guanidino acceptor groups, the catalytic motif of PARP4 may be altered to R-S-E. Moreover, one or more domains within PARP4 may be exchanged, or one or more amino acids may be added, deleted or replaced.

(28) ADP-ribosylation is a reversible post-translational modification that functions in multiple cellular pathways. Functionally, it may either prime the molecule for a specific function or it may silence or protect the molecule until it is delivered to the cell. Release of the ADP-ribosylated vault contents within the cell exposes the vault cargo to glycohydrolases such as poly ADP-ribose glycohydrolase (PARG), which enzymatically cleave the ADP-ribose to release the passenger molecule and/or return the passenger molecule to its original state.

(29) Alternatively, passenger molecules may be accommodated within the internal cavity formed by the vault by using site directed mutagenesis to mutate, delete and/or insert one or more amino acids in the vault structure that enhance non-covalent interactions between the passenger molecule and the vault particle. To accommodate a negatively charged passenger molecule, e.g., DNA or RNA, one or more amino acids with a positively charged side chain, e.g., arginine (Arg. R) or lysine (Lys, K), will be introduced by mutation, deletion and/or insertion in the vault structure to increase the local positive charge (FIG. 10A) thereby enhancing electrostatic interaction between the passenger molecule and the vault (FIG. 10B). To accommodate a positively charged passenger molecule, one or more amino acids with a negatively charged side chain, e.g., aspartic acid (Asp. D) or glutamic acid (Glu, E), will be introduced by mutation, deletion and/or insertion in the vault structure to increase the local negative charge thereby enhancing electrostatic interaction between the passenger molecule and the vault. To accommodate a polar passenger molecule, one or more amino acids with a polar side chain, e.g., asparagine (Asn, N), cysteine (Cys, C), glutamine (Gin, Q), histidine (His, H), serine (Ser, S), threonine (Thr, T), tryptophan (Trp, W) or tyrosine (Tyr, Y), will be introduced by mutation, deletion and/or insertion to increase the local hydrophilicity thereby enhancing hydrophilic interactions between the passenger and the vault. To accommodate a non-polar passenger molecule, one or more amino acids with a hydrophobic side chain, e.g., alanine (Ala, A), glycine (Gly, G), isoleucine (Ile, I), leucine (Leu, L), methionine (Met, M), phenylalanine (Phe, F), proline (Pro, P), or valine (Val, V), will be introduced by mutation, deletion and/or insertion in the vault structure to increase the local hydrophobicity thereby enhancing hydrophobic interactions between the passenger molecule and the vault.

(30) The vault particle contains three separate regions where the structure has not been solved by x-ray crystallography. One of the three unstructured regions is located in the shoulder region and is orientated to the outside of the vault particle (FIG. 11A). To target vaults to specific receptors or ligands, a targeting sequence can be inserted into the unstructured region or can replace the sequence comprising the unstructured region within the shoulder domain of the vault (FIG. 11B). Insertion of a targeting ligand within the unstructured shoulder domain promotes targeting of vaults to cells that express the receptor that recognizes the ligand (see, e.g., FIG. 12).

(31) Compositions comprising vaults are described herein. In some embodiments, the compositions also comprise a passenger molecule. Methods to package smaller passenger molecules and alter physicomechanical properties of the vault particle are also described herein. Some methods described herein generally comprise ADP-ribose matrix formation. Methods to package hydrophobic molecules are also described herein. Methods to package charged molecules are also described herein. Methods to package polar molecules are also described herein. Some methods described herein generally comprise mutation, insertion or deletion of a specific amino acids in the vault structure. Methods to target the vault to specific receptors or ligands are also described herein.

(32) Compositions

(33) Provided herein are compositions that comprise a vault particle. Generally, the vault particles disclosed herein comprise a shell of MVP protein containing one or more engineered region comprised of one or more mutated or inserted amino acids. Generally, the vault particles disclosed herein comprise a cavity that is capable of binding a passenger molecule through non-covalent interactions, i.e., electrostatic interactions, hydrophobic interactions, and polar interactions (hydrogen bonding). Generally, the vault particles disclosed herein comprise an engineered region in the shoulder domain capable of binding to a specific binding partner.

(34) Vault particles disclosed herein may comprise a shell (of MVP proteins), at least one vault-associated protein and an ADP-ribose matrix. In some instances, the passenger molecule is contained within the ADP-ribose matrix. In some instances, the passenger molecule is contained within the ADP-ribose matrix, but not attached to the ADP-ribose matrix. In some instances, the passenger molecule is contained within the ADP-ribose matrix, but not attached to the vault particle. In some instances, the passenger molecule is covalently attached to the ADP-ribose matrix. In some instances, the passenger molecule is free within the ADP-ribose matrix.

(35) Generally, ADP-ribose matrices disclosed herein are the result of ADP-ribosylation. ADP-ribosylation within the vault confers new properties to the vault particle. First, addition of each ADP-ribose monomer contributes two negatively charged phosphate groups (see FIG. 2), which changes the electrostatic properties of the acceptor molecule. At the particle level, the overall change of electrostatic properties can alter the biodistribution, targeting, and cellular uptake of the vault particle. The degree of ADP-ribosylation, and hence the electrostatic changes, can be controlled by regulating the concentration of NAD+, the reaction time and the reaction temperature. Thus, by precisely regulating the degree of ADP-ribosylation within the vault complex different degrees of vault particle functionality can be achieved. For instance, addition of ADP-ribose inside the vault consumes empty space between enclosed molecules. Monomers and/or polymers of ADP-ribose create the ADP-ribose matrix that generates a turgor-like pressure on the vault particle walls, which increases the compressive and tensile strength of the vault, making it less deformable.

(36) In some embodiments, the vault particle or a vault-associated protein is not connected to the passenger molecule. In some embodiments, the passenger molecule is located within the vault particle, but is not connected to the vault particle or vault-associated protein. In some embodiments, the vault particle or vault-associated protein does not possess a domain capable of connecting to the passenger molecule. In some embodiments, the vault particle or vault-associated protein does not possess a peptide capable of connecting to the passenger molecule. In some embodiments, the vault particle or vault-associated protein does not possess an amino acid capable of connecting to the passenger molecule. In some embodiments, the passenger molecule does not possess a feature capable of connecting to the vault particle or vault-associated protein. In some embodiments, the passenger molecule is not covalently connected to the vault particle or vault-associated protein. In some embodiments, the passenger molecule does not covalently interact with the vault particle or vault-associated protein. In some embodiments, the passenger molecule is free within the vault particle. In some embodiments, the passenger molecule is freely encapsulated by the vault during vault assembly. In some embodiments, the passenger molecule is fused to a C-terminus of the vault particle. In some embodiments, the passenger molecule is fused to an N-terminus of the vault nanoparticle. In some embodiments, the passenger molecule is fused to a mINT domain of the vault-associated protein. In some embodiments, the passenger molecule is not fused to a mINT domain of the vault-associated protein.

(37) In some instances, the MVP or vault-associated protein is based on a wild type MVP or vault-associated protein, respectively. In some instances, at least one of the MVP and vault-associated protein comprises an amino acid substitution relative to a wild type MVP or vault-associated protein, respectively. In some instances, at least one of the MVP and vault-associated protein comprises an amino acid insertion relative to a wild type occurring MVP or vault-associated protein, respectively. In some instances, at least one of the MVP and vault-associated protein comprises an amino acid deletion relative to a wild type MVP or vault-associated protein, respectively. Such substitution, insertions, and deletions may be referred to herein as amino acid modifications.

(38) In some embodiments, at least one of the MVP and vault-associated protein comprises an amino acid modification resulting in a mutation of a wild type amino acid to an amino acid that has a charged side chain, e.g., arginine (Arg, R), aspartic acid (Asp, D), glutamic acid (Glu, E) or lysine (Lys, K). In some embodiments, one or more amino acids with a charged side group, e.g., arginine (Arg, R), aspartic acid (Asp. D), glutamic acid (Glu, E) or lysine (Lys, K) are inserted into an inner-facing surface. In some embodiments, the mutations and/or insertions result in a local, spatially clustered negative charge in the engineered region. In some embodiments, the mutations and/or insertions result in a local, spatially clustered positive charge in the engineered region. In some embodiments, the passenger molecule non-covalently binds to the negatively charged engineered region. In some embodiments, the passenger molecule non-covalently binds to the positively charged engineered region. In some embodiments, the passenger molecule is a DNA or a RNA molecule. In some embodiments, the passenger molecule is a protein or peptide molecule. In some embodiments, the passenger molecule is a small molecule.

(39) In some embodiments, at least one of the MVP and vault-associated protein comprises an amino acid modification resulting in a mutation of an amino acid to an amino acid that has a hydrophobic side chain, e.g., alanine (Ala, A), glycine (Gly, G), isoleucine (Ile, I), leucine (Leu, L), methionine (Met, M), phenylalanine (Phe, F), proline (Pro. P), or valine (Val, V). In some embodiments, one or more amino acids with a hydrophobic side group, e.g., alanine (Ala, A), glycine (Gly, G), isoleucine (Ile. I), leucine (Leu, L), methionine (Met, M), phenylalanine (Phe, F), proline (Pro, P), or valine (Val, V) are inserted into an inner-facing surface. In some embodiments, the mutations and/or insertions result in a local, spatially clustered hydrophobic patch. In some embodiments, the passenger molecule non-covalently binds to the engineered hydrophobic patch. In some embodiments, the passenger molecule is a DNA or a RNA molecule. In some embodiments, the passenger molecule is a protein or peptide molecule. In some embodiments, the passenger molecule is a small molecule.

(40) In some embodiments, at least one of the MVP and vault-associated protein comprises an amino acid modification resulting in a mutation of an amino acid to an amino acid that has a polar side chain, e.g., asparagine (Asn, N), cysteine (Cys, C), glutamine (Gln, Q), histidine (His, H), serine (Ser, S), threonine (Thr, T), tryptophan (Trp, W) or tyrosine (Tyr, Y). In some embodiments, one or more amino acids with a polar side group, e.g., asparagine (Asn, N), cysteine (Cys, C), glutamine (Gln, Q), histidine (His, H), serine (Ser, S), threonine (Thr, T), tryptophan (Trp, W) or tyrosine (Tyr, Y) are inserted into an inner-facing surface. In some embodiments, the mutations and/or insertions result in a local, spatially clustered polar patch capable of hydrogen bonding. In some embodiments, the passenger molecule non-covalently binds to the engineered polar patch. In some embodiments, the passenger molecule is a DNA or a RNA molecule. In some embodiments, the passenger molecule is a protein or peptide molecule. In some embodiments, the passenger molecule is a small molecule.

(41) In some instances, vault particles disclosed herein comprise at least one amino acid modification in the interior of the vault particle that results in non-covalent binding of a passenger molecule to the interior of the vault particle. Non-covalent binding may occur through an electrostatic interaction. Non-covalent binding may occur through a hydrophobic interaction. Non-covalent binding may occur through a polar interaction. The modification may comprise a specific amino acid sequence. The modification may comprise a non-specific amino acid sequence. The modification may comprise a modification of a motif or domains described herein.

(42) Amino acid sequences, motifs and domains may comprise a modification allowing a passenger molecule, such as a nucleic acid, a protein, or a small molecule, to bind specifically or non-specifically, through at least one of an electrostatic interaction, a hydrophobic interaction and a polar interaction. By way of non-limiting example, electrostatic interactions between amino acids with positively charged side groups, e.g., arginine (Arg, R) and lysine (Lys, K), may promote binding with negatively charged molecules such as phosphate groups found within nucleic acids and amino acids with negatively charged side groups, e.g., aspartic acid (Asp, D) und glutamic acid (Gla, E), found within peptides or proteins. Similarly, hydrophobic interactions between hydrophobic amino acids, e.g., alanine (Ala, A), glycine (Gly, G), isoleucine (Ile, I), leucine (Lea, L), methionine (Met, M), phenylalanine (Phe, F), proline (Pro, P), and valine (Val, V) may promote binding to hydrophobic nitrogenous bases found within nucleic acids, hydrophobic small molecules and to complementary hydrophobic amino acids in proteins and peptides of passenger molecules. Polar interactions, leading to hydrogen bonding, between polar amino acids, e.g., asparagine (Asn, N), cysteine (Cys, C), glutamine (Gln, Q), histidine (His, H), serine (Ser, S), threonine (Thr, T), tryptophan (Trp, W) and tyrosine (Tyr, Y), as well as charged amino acids, may promote binding to nitrogenous bases in passenger molecules, such as nucleic acids, polar small molecules and to other polar amino acids in proteins and peptides.

(43) In some instances, amino acid modifications are located on a loop that faces an internal vault particle cavity. In some instances, amino acid modifications are located on a side chain that faces an internal vault particle cavity. Loops and side chains, based on the crystal structures such as those described herein, that face the internal vault particle cavity may be key sites (FIG. 10A) for the mutation or insertion of charged, hydrophobic or polar amino acids to create discrete areas or patches for binding passenger molecules. In some instances, two or more amino acid modifications are spatially adjacent. In some instances, two or more amino acid modifications are sequentially adjacent. In some instances, a single site may not have the binding strength alone to immobilize a passenger molecule. In some instances, a single amino acid modification may not have the binding strength alone to immobilize a passenger molecule. In some instances, a combination of sites has the binding strength to immobilize a passenger molecule. In some instances, a combination of amino acids resulting from amino acid modifications has the binding strength to immobilize a passenger molecule. In some instances, an MVP chain comprises a plurality of amino acid modifications. In some instances, each of the MVP chains comprises an amino acid modification, as exemplified by FIG. 10A. The passenger molecule may become sufficiently tacked to the internal cavity of the vault particle throughout the entire vault structure (FIG. 10B).

(44) In some instances, vault particles disclosed herein comprise a shell of MVP protein and a peptide inserted within a shoulder domain of the MVP. In some instances, the shoulder domain is an engineered shoulder domain that is capable of specific binding to receptors or ligands expressed on cells. In some instances, the shoulder domain is capable of binding to receptor or ligands not expressed on cells.

(45) In some instances, an amino acid modification is present on an outer facing domain of the major vault protein, wherein the outer facing domain is a shoulder domain. In some instances, the outer facing domain is flexible as compared to surrounding domains that are more rigid. In some instances, domains that are more rigid comprise at least one secondary protein structure, such as an alpha helix or beta strand. In some instances, domains that are more rigid comprise at least one tertiary protein structure, such as an alpha helix or beta strand. In some instances, domains that are flexible comprise a loop region. In some instances, domains that are flexible do not comprise a secondary or tertiary protein structure. By way of non-limiting example, the crystal structure of the rat vault particle reveals an outer-facing region is present within the shoulder domain and extends from Met608 to Pro620 for which the structure has not been solved (FIG. 11A). The unstructured nature of this region indicates that the chain is flexible and may accommodate an addition to or complete replacement of the intervening sequence providing an opportunity to insert a peptide for targeting the vault particle to specific cells. By inserting the peptide into the flexible region of the shoulder domain, the peptide may be anchored by amino acids flanking the flexible region, which are structured by the formation of an alpha helix and a beta strand (see FIG. 11A). In addition, insertion of a peptide into the shoulder domain may evenly distribute the peptide along a circumference of about 1256.6 as opposed to a maximum circumference of 157 at the cap-ring, making more of it available to a target cell.

(46) Vault-Associated Proteins

(47) Generally, compositions disclosed herein comprise a vault particle and a vault-associated protein. In some embodiments, the vault-associated protein comprises a major vault protein interaction domain that provides for an interaction between the vault-associated protein and a major vault protein. In some embodiments, the vault-associated protein comprises a poly-adenosine diphosphate (ADP)-ribose polymerase (referred to herein as a PARP). In some embodiments, the vault-associated protein consists essentially of a PARP. In some embodiments, the PARP is PARP4, also known in the field as vault PARP (VPARP). In some embodiments, the vault-associated protein comprises an arginine specific ADP-ribosyltransferses (ART). In some embodiments, the vault-associated protein consists essentially of an ART. In some embodiments, the vault-associated protein comprises a member of the poly (A) polymerase family. In some embodiments, the vault-associated protein comprises a glycosyltransferase. In some embodiments, the vault-associated protein comprises a fatty acid synthase. In some embodiments, the vault-associated protein comprises a farnesyltransferase. In some embodiments, the vault-associated protein is an enzyme that catalyzes the formation of a polymer. In some embodiments, the enzyme is passively encapsulated by the vault particle. In some embodiments, the enzyme is passively encapsulated during vault assembly in an in vitro cell-free protein expression system. In some embodiments, the enzyme is associated with the vault after vault assembly in an in vitro cell-free protein expression system. In some embodiments, the enzyme is associated with the vault after vault assembly in a cell-based protein expression system. In some embodiments, the enzyme is attached to the mINT domain of PARP4. For each enzyme, a different substrate is required, thus the resulting matrix may be dependent on the enzyme and substrate.

(48) In some embodiments, the PARP protein comprises an amino acid sequence for a PARP. In some embodiments, the PARP protein consists essentially of an amino acid sequence for a PARP. In some embodiments, the PARP protein comprises an amino acid sequence for PARP4. In some embodiments, the PARP4 protein consists essentially of an amino acid sequence for PARP4. A person skilled in the art understands that due to population variation, there are many amino acid sequences for PARP4. However, non-limiting examples of PARP4 proteins are NCBI GenBank XP 011533233.1, NCBI GenBank XP_011533234.1, and NCBI GenBank NP_006428.2 (SEQ ID NO.: 2, see Table 1)

(49) In some embodiments, the PARP4 protein is represented by SEQ ID NO.: 2. In some embodiments, the PARP4 protein is represented by a sequence that is at least about 95% homologous to SEQ ID NO.: 2. In some embodiments, the PARP4 protein is represented by a sequence that is at least about 90% homologous to SEQ ID NO.: 2. In some embodiments, the PARP4 protein is represented by a sequence that is at least about 85% homologous to SEQ ID NO.: 2. In some embodiments, the PARP4 protein is represented by a sequence that is at least about 80% homologous to SEQ ID NO.: 2. In some embodiments, the PARP4 protein is represented by a sequence that is at least about 75% homologous to SEQ ID NO.: 2.

(50) In some embodiments, the PARP4 protein is encoded by SEQ ID NO.: 1 (see Table 1). In some embodiments, the PARP4 protein is encoded by a sequence that is at least about 95% homologous to SEQ ID NO.: 1. In some embodiments, the PARP4 protein is encoded by a sequence that is at least about 90% homologous to SEQ ID NO.: 1. In some embodiments, the PARP4 protein is encoded by a sequence that is at least about 85% homologous to SEQ ID NO.: 1. In some embodiments, the PARP4 protein is encoded by a sequence that is at least about 80% homologous to SEQ ID NO.: 1. In some embodiments, the PARP4 protein is encoded by a sequence that is at least about 75% homologous to SEQ ID NO.: 1.

(51) In some embodiments, the PARP protein comprises a modified PARP protein comprising an amino acid sequence that has been modified from a wild type amino acid sequence for a PARP. In some embodiments, the modified PARP protein is referred to herein as an engineered variant of the PARP. In some embodiments, the PARP protein contains at least one modified amino acid in one or more domains or one or more motifs of the PARP. In some embodiments, the domain or motif is selected from a phosphopeptide binding module (BRCT), a PARP catalytic domain, a vault protein inter-alpha trypsin (VIT) domain, a von Willebrand A (vWA) domain, a nuclear localization signal (NLS) and a major vault protein interaction (mINT) domain. Methods of modifying protein sequences are well known in the art, and include modifying a nucleic acid encoding the protein sequence. In some embodiments, the modified PARP protein is capable of performing at least one activity performed by unmodified PARP protein. In some embodiments, the modified PARP protein is capable of performing the at least one activity better than the unmodified PARP protein. In some embodiments, the modified PARP protein is not capable of performing the at least one activity as well as the unmodified PARP protein.

(52) In some embodiments, the modified PARP protein comprises a deletion of at least one amino acid relative to an unmodified PARP protein. In some embodiments, the modified PARP protein comprises a substitution of at least one amino acid relative to an unmodified PARP protein. In some embodiments, the modified PARP protein comprises an addition of at least one amino acid relative to an unmodified PARP protein.

(53) In some embodiments, the vault-associated protein is a telomerase-associated protein. In some embodiments, the telomerase-associated protein is telomerase-associated protein 1 (TEP1).

(54) In some embodiments, compositions comprise the vault particle, a telomerase-associated protein and a PARP. In some embodiments, compositions comprise the vault particle, TEP1 and PARP4.

(55) Additional Vault Components

(56) Compositions disclosed herein may comprise additional vault components beyond the major vault protein and vault associated protein. In some embodiments, the vault particle comprises a non-coding vault ribonucleic acid (vtRNA). vtRNA has been well described by those in the field. Briefly, vtRNA generally has a length of about 80 to about 150 bases, depending on the species of origin. Non-limiting examples of human vtRNA include hvg1 (98 bases), hvg2 (88 bases), and hvg3 (88 bases). vtRNAs may have secondary structures selected from, but not limited to, arches, hollow barrel-like frameworks, and stem loops. The stem loops may connect the 5 and 3 ends of the vtRNA. Thus, vtRNAs are capable of siRNA activity.

(57) In some embodiments, the vault particle comprises an ADP-ribose matrix. In some embodiments, an ADP-ribose matrix is composed of ADP-ribose monomers, each monomer occupying an approximate volume of about 0.6 nm.sup.3 to about 1.5 nm.sup.3. In some embodiments, an ADP-ribose matrix is composed of polymers formed by the addition of ADP-ribose in a linear fashion. In some embodiments, an ADP-ribose matrix is composed of polymers formed by the addition of ADP-ribose in a linear and branched fashion. In some embodiments, an ADP-ribose matrix is composed of a combination of ADP-ribose monomers and linear and/or branched ADP-ribose polymers. In some embodiments, the ADP-ribose matrix is composed of about 1,000 to about 55,000 ADP-ribose monomers and linear and/or branched ADP-ribose polymers. In some embodiments, the ADP-ribose matrix is composed of about 1,000 to about 5,000 ADP-ribose monomers and linear and/or branched ADP-ribose polymers. In some embodiments, the ADP-ribose matrix is composed of about 5,000 to about 10,000 ADP-ribose monomers and linear and/or branched ADP-ribose polymers. In some embodiments, the ADP-ribose matrix is composed of about 10,000 to about 50,000 ADP-ribose monomers and linear and/or branched ADP-ribose polymers. FIG. 8 illustrates exemplary linear and/or branched ADP-ribose polymers. In some embodiments, the ADP-ribose matrix is formed by contacting a vault particle with oxidized nicotinamide adenine dinucleotide (NAD+) to produce a dense matrix of ADP-ribose monomers and/or polymers. In some embodiments, the ADP-ribose matrix is formed by contacting a vault particle with an analog of NAD+. Non-limiting examples analogs of NAD+ include oxidized forms of: nicotinamide 1,N.sup.6-ethenoadenine dinucleotide, nicotinamide guanine dinucleotide, nicotinamide hypoxanthine dinucleotide, and nicotinamide hypoxanthine dinucleotide.

(58) In some embodiments, compositions comprise an acceptor site for ADP-ribosylation. In some embodiments, the acceptor site is located on a passenger molecule of interest. In some embodiments, the acceptor site is located on an excipient passenger molecule. In some embodiments, the acceptor site is NAD+ or an NAD+ analog. In some embodiments, the acceptor site is located on the MVP. In some embodiments, the acceptor site is located on the vault-associated protein. In some embodiments, the acceptor site is located on a PARP4, wherein the PARP4 is associated with the vault particle of the composition. In some embodiments, the PARP4 is an engineered variant of PARP4.

(59) In some embodiments, the passenger molecule comprises an acceptor site for ADP-ribose. In some embodiments, the method comprises contacting a vault protein of the vault particle with an excipient molecule that has an acceptor site for ADP-ribose. In some embodiments, a vault protein of the vault particle comprises an acceptor for ADP-ribose.

(60) In some embodiments, the compositions disclosed herein comprise a cofactor to enhance matrix formation and stability. Non-limiting examples of cofactors include calcium, or other multivalent cations, and ATP. In some embodiments, the composition comprises a lipid (not as a passenger molecule), wherein the lipid alters the physicomechanical properties of the vault.

(61) Passenger Molecules

(62) In some embodiments, the compositions disclosed herein comprise a passenger molecule. In some embodiments, the passenger molecule is trapped within the ADP-ribose matrix within the cavity of the vault. In some embodiments, the passenger molecule would otherwise readily diffuse out of the vault particle if it was not trapped. In some embodiments, the passenger molecule is too large to diffuse out of the cavity of the vault particle. In some embodiments, the passenger molecule is too large to diffuse out of the ADP-ribose matrix within the cavity of the vault.

(63) In some embodiments, the compositions disclosed herein comprise a PARP protein, an ADP-ribose matrix, and a passenger molecule that is large enough to be retained within the vault cavity (e.g., too big to diffuse out of the vault complex). In some embodiments, the compositions disclosed herein comprise a PARP protein, an ADP-ribose matrix, and a passenger molecule that is trapped in the cavity by the ADP-ribose matrix.

(64) Non-limiting examples of passenger molecules include peptides (generally less than 100 amino acids), proteins, carbohydrates, nucleic acids, lipids, small molecules (molecules generally less than 900 daltons), and active pharmaceutical ingredients. In some embodiments, the passenger molecule is selected from a peptide, a protein, a carbohydrate, a nucleic acid, a lipid, a small molecule, an active pharmaceutical ingredient, and a combination thereof.

(65) The passenger molecule may have a molecular weight between about 100 daltons and about 10 mega daltons. The passenger molecule may have a molecular weight between about 100 daltons and about 900 daltons. The passenger molecule may have a molecular weight between about 100 daltons and about 900 daltons. The passenger molecule may have a molecular weight between about 900 daltons and about 90,000 daltons. The passenger molecule may have a molecular weight that is less than about 1000 daltons. The passenger molecule may have a molecular weight that is less than about 900 daltons. The passenger molecule may have a molecular weight that is less than about 800 daltons. The passenger molecule may have a molecular weight that is less than about 700 daltons. The passenger molecule may have a molecular weight that is less than about 600 daltons. The passenger molecule may have a molecular weight that is less than about 500 daltons. The passenger molecule may have a molecular weight that is greater than about 900 daltons. The passenger molecule may have a molecular weight that is greater than about 500 daltons. The passenger molecule may have a molecular weight that is greater than about 900 daltons. The passenger molecule may have a molecular weight that is greater than about 1000 daltons. The passenger molecule may have a molecular weight that is greater than about 1200 daltons. The passenger molecule may have a molecular weight that is greater than about 1500 daltons.

(66) Methods of Producing Vault Particles

(67) Provided herein are methods for producing a vault particle, wherein the methods comprise ADP-ribosylation of a vault enclosed passenger molecule resulting in an ADP-ribose matrix that immobilizes the vault-enclosed passenger molecule. In some embodiments. ADP-ribosylation of a vault enclosed passenger molecule occurs following synthesis of a vault particle in an in vitro cell-free protein expression system. In some embodiments, ADP-ribosylation of a vault enclosed passenger molecule occurs following synthesis of a vault particle in a cell-based protein expression system.

(68) In some embodiment, the ADP-ribosylation is catalyzed by a PARP. In some embodiment, the ADP-ribosylation is catalyzed by PARP4. In some embodiments, the ADP-ribosylation is catalyzed by an ART. In some embodiments, methods comprise use of NAD+ or an NAD+ analog as a substrate for ADP-ribosylation. Methods disclosed herein may also be referred to as a reaction.

(69) In some embodiments, methods comprise immobilizing passenger molecules by incubating nicotinamide adenine dinucleotide (NAD+) or NAD+ analogs and the enzyme PARP4 or engineered PARP4 variants to create a dense matrix of ADP-ribose monomers and/or polymers.

(70) In some embodiments, method comprise labeling passenger molecules with ADP-ribose, monomers and/or polymers, derived from the substrate NAD+ or NAD+ analogs and catalyzed by the PARP4 enzyme or engineered PARP4 variants.

(71) In some embodiments, methods comprise enclosing the passenger molecule in the vault while producing the vault particle. In some embodiments, methods comprise enclosing the passenger molecule in the vault after producing the vault particle.

(72) In some embodiments, the methods comprise incubating a vault-associated protein with a vault prior to the addition of a substrate (e.g., NAD+) or passenger molecule to be contained within the vault particle. In some embodiments, PARP4, or an engineered PARP4 variant, is incubated with a vault that contains the passenger molecule, before a substrate is added.

(73) In some embodiments, methods comprise adding about 0.1 M to about 20 mM of the substrate (e.g., NAD+, or analog thereof) to the vault-associated protein. In some embodiments, methods comprise adding about 0.1 M to about 1 M of the substrate to the vault-associated protein. In some embodiments, methods comprise adding about 1 M to about 10 M of the substrate to the vault-associated protein. In some embodiments, methods comprise adding about 10 M to about 100 M of the substrate to the vault-associated protein. In some embodiments, methods comprise adding about 0.1 mM to about 1 mM of the substrate to the vault-associated protein. In some embodiments, methods comprise adding about 1 mM to about 10 mM of the substrate to the vault-associated protein. In some embodiments, methods comprise adding about 10 mM to about 20 mM of the substrate to the vault-associated protein.

(74) In some embodiments, the reaction has a duration. The duration may be defined as the time that the substrate is added to the vault-associated protein until the time that an ADP ribose matrix is formed. The duration may be defined as the time that the substrate is added to the vault-associated protein until the time an ADP ribose matrix is formed, wherein the ADP ribose matrix formed has select properties (e.g., density, compressive strength, stability, electrostatic properties). In some embodiments, the duration is about 5 minutes to about 24 hours. In some embodiments, the duration is about 5 minutes to about 10 minutes. In some embodiments, the duration is about 5 minutes to about 30 minutes. In some embodiments, the duration is about 30 minutes to about 1 hour. In some embodiments, the duration is about 1 hour to about 4 hours. In some embodiments, the duration is about 4 hours to about 8 hours. In some embodiments, the duration is about 8 hours to about 12 hours. In some embodiments, the duration is about 12 hours to about 18 hours. In some embodiments, the duration is about 18 hours to about 24 hours.

(75) In some embodiments, the methods comprise incubating a vault-associated protein, vault and substrate in a buffered solution. The buffered solution may be a Tris buffer. In some embodiments, the concentration of Tris buffer in the buffered solution is about 10 mM to about 100 mM. In some embodiments, the concentration of Tris buffer in the buffered solution is about 10 mM to about 20 mM. In some embodiments, the concentration of Tris buffer in the buffered solution is about 20 mM to about 30 mM. In some embodiments, the concentration of Tris buffer in the buffered solution is about 30 mM to about 40 mM. In some embodiments, the concentration of Tris buffer in the buffered solution is about 40 mM to about 50 mM. In some embodiments, the concentration of Tris buffer in the buffered solution is about 50 mM to about 60 mM. In some embodiments, the concentration of Tris buffer in the buffered solution is about 60 mM to about 70 mM. In some embodiments, the concentration of Tris buffer in the buffered solution is about 70 mM to about 80 mM. In some embodiments, the concentration of Tris buffer in the buffered solution is about 80 mM to about 90 mM. In some embodiments, the concentration of Tris buffer in the buffered solution is about 90 mM to about 100 mM.

(76) In some embodiments, the reaction occurs at about 20 C. to about 37 C. In some embodiments, the reaction occurs at about 20 C. In some embodiments, the reaction occurs at about 25 C. In some embodiments, the reaction occurs at about 37 C.

(77) In some embodiments, the vault particle is synthesized using an in vitro cell-free protein expression system. In some embodiments, the vault particle is synthesized in a cell-based protein expression system.

(78) Further provided herein are methods for ADP-ribosylation of a vault enclosed passenger molecule, wherein ADP-ribosylation is catalyzed by a vault-associated protein and results in an ADP-ribose matrix that traps the passenger molecule. In some embodiments, the vault-associated protein is a PARP. In some embodiments, the vault-associated protein is PARP4 or an engineered variant of PARP4.

(79) In some embodiments, methods comprise altering the physicomechanical properties of the vault particle. In some embodiments, methods comprise adding cofactors, such as Ca.sup.2+ or ATP, to alter the physicomechanical properties of the vault particle. In some embodiments, methods comprise adding a lipid molecule to alter the physicomechanical properties of the vault particle.

(80) In some embodiments, production of ADP-ribose monomers and/or polymers (resulting from ADP-ribosylation) alters the density of the content of the vault particle. In some embodiments, addition of ADP-ribose monomers and/or polymers alters the electrostatic properties of the vault particle. In some embodiments, addition of ADP-ribose monomers and/or polymers strengthens the vault particle against compression. In some embodiments, addition of ADP-ribose monomers and/or polymers stabilizes the vault particle. In some embodiments, calcium ions, or other multivalent cations, and/or ATP act as cofactors to enhance matrix formation and stability. In some embodiments, lipids are added to alter the physicomechanical properties of the vault. In some embodiments, immobilization of passenger molecules in the ADP-ribose matrix enhances their delivery to a cell.

(81) In some embodiments, immobilization of passenger molecules in the ADP-ribose matrix enhances their delivery to the nucleus of a cell. ADP-ribose matrix within the vault may play an important role in the delivery of the enclosed passenger molecules to the cell. The ADP-ribose matrix may promote nuclear transport of the passenger molecules from the vault interior. The association of the vault with the nuclear pore might induce the opening of the vault cap(s), and the difference in osmotic pressure between the cytoplasm and the nucleus will induce expulsion of the ADP-ribose matrix with its content from the vault particle into the nucleus.

(82) In some embodiments, methods comprise fusing the passenger molecule to a carboxyl-terminus of the vault particle, also referred to as the cap of the vault, see, e.g., FIG. 1A. In some embodiments, methods comprise fusing the passenger molecule to an amino-terminus of the vault nanoparticle, also referred to as the waist of the vault see, e.g., FIG. 1B.

(83) Provided herein are methods for producing a vault particle, wherein the methods comprise sequence and structural analysis, site-directed mutagenesis and cloning resulting in an engineered vault that contains multiple non-covalent binding regions. In some embodiments, an engineered vault particle is synthesized in an in vitro cell-free protein expression system. In some embodiments, an engineered vault particle is synthesized in a cell-based protein expression system.

(84) In some embodiments, the inner-facing loops and chains contain one or more charged, hydrophobic or polar amino acids and additional like amino acids are introduced by mutation of sequence adjacent or spatially adjacent amino acids. In some embodiments, the inner-facing loops and chains do not contain one or more charged, hydrophobic or polar amino acids and additional like amino acids are introduced by mutation of sequence adjacent or spatially adjacent amino acids.

(85) In some embodiments, the inner-facing loops and chains contain one or more charged, hydrophobic or polar amino acids and additional like amino acids are introduced by insertion of sequence adjacent or spatially adjacent amino acids. In some embodiments, the inner-facing loops and chains do not contain one or more charged, hydrophobic or polar amino acids and additional like amino acids are introduced by insertion of sequence adjacent or spatially adjacent amino acids. In some embodiments, about one to about 10 amino acids are inserted. In some embodiments, about 10 to about 50 amino acids are inserted. In some embodiments, about 50 to about 100 amino acids are inserted. In some embodiments, about 100 to about 200 amino acids are inserted. In some embodiments, about 200 to about 300 amino acids are inserted.

(86) In some embodiments, the amino acid sequence inserted into the unstructured region of the shoulder domain results in a receptor binding peptide. In some embodiments, the amino acid sequence inserted into the shoulder domain results in a ligand binding peptide. In some embodiments, the amino acid sequence inserted into the unstructured region of the shoulder domain results in a receptor binding peptide that binds a receptor expressed by a cell. In some embodiments, the amino acid sequence inserted into the unstructured region of the shoulder domain results in a ligand binding peptide that binds a ligand expressed by a cell. In some embodiments, the amino acid sequence inserted into the unstructured region of the shoulder domain results in a receptor binding peptide that binds a receptor not expressed by a cell. In some embodiments, the amino acid sequence inserted into the unstructured region of the shoulder domain results in a ligand binding peptide that binds a ligand not expressed by a cell.

(87) In some embodiments, the inserted peptide is composed of about 2 to about 10 amino acids. In some embodiments, the inserted peptide is composed of about 10 to about 50 amino acids. In some embodiments, the inserted peptide is composed of about 50 to about 100 amino acids. In some embodiments, the inserted peptide is composed of about 100 to about 200 amino acids. In some embodiments, the inserted peptide is composed of about 200 to about 500 amino acids. In some embodiments, the amino acids within the unstructured region of the shoulder domain are retained. In some embodiments, the amino acids within the unstructured region of the shoulder domain are removed.

(88) Uses of Vault Particles and Methods of Treatment

(89) Provided herein are methods that comprise delivering a vault particle to a cell, wherein the vault particle comprises an enclosed, immobilized passenger molecule within a matrix of ADP-ribose. In some embodiments, the vault particle localizes to the nucleus of the cell. Further provided herein are methods of treating a condition in a subject in need thereof, comprising administering a vault particle to the subject. In some instances, the vault particle comprises an enclosed, immobilized passenger molecule within a matrix of ADP-ribose. In some instances, the vault particle comprises an enclosed passenger molecule non-covalently bound to the inner surface of the vault cavity.

(90) In some embodiments, the cell or subject is affected by a disease or condition. Non-limiting examples of diseases and conditions are autoimmune diseases (e.g., arthritis), metabolic diseases (e.g., diabetes, cardiovascular disease), neurological conditions (e.g., Alzheimer's Disease, Parkinson's Disease, multiple sclerosis), and cancers (e.g., solid tumors, leukemias).

(91) In some embodiments, the cell is a cancer cell. In some embodiments, the cell is affected by a cancer. In some embodiments, the cell comprises a genetic mutation due to a cancer. In some embodiments, the cancer cell originates from a cancer.

(92) In some instances, methods comprise delivering a vault particle to a cell, the vault particle comprising one or more engineered regions, wherein the engineered region is achieved by introducing a mutation to a region of a vault particle protein of the particle, and wherein the mutation increases a non-covalent binding property of the region. Non-limiting examples of non-covalent binding properties are electrostatic interactions, hydrophobic interactions, and polar interactions.

(93) In some instances, methods comprise delivering a vault particle to cell, wherein the vault particle comprises a major vault protein and a peptide inserted in an unstructured region of a shoulder domain of the major vault protein. In some embodiments, the peptide is a non-engineered peptide. In some embodiments, the peptide is an engineered peptide. In some embodiments, the peptide is synthetic. In some embodiments, the peptide is at least a portion of a receptor that has affinity for a ligand. In some embodiments, the peptide is at least a portion of a ligand that has affinity for a receptor. In some embodiments, the vault particle comprises an engineered peptide from a receptor or ligand and comprises a passenger molecule. In some embodiments, the vault particle localizes to the nucleus of the cell.

(94) TABLE-US-00003 TABLE1 ExemplaryhumanPARP4NucleicacidandAminoacidSequences SEQ ID NO Sequence 1 ATGGTGATGGGAATCTTTGCAAATTGTATCTTCTGTTTGAAAGTGAAGTACTTACCTC AGCAGCAGAAGAAAAAGCTACAAACTGACATTAAGGAAAATGGCGGAAAGTTTTCC TTTTCGTTAAATCCTCAGTGCACACATATAATCTTAGATAATGCTGATGTTCTGAGTC AGTACCAACTGAATTCTATCCAAAAGAACCACGTTCATATTGCAAACCCAGATTTTA TATGGAAATCTATCAGGGAAAAGAGACTCTTGGATGTAAAGAATTATGATCCTTATA AGCCCCTGGACATCACACCACCTCCTGATCAGAAGGCGAGCAGTTCTGAAGTGAAA ACAGAAGGTCTATGCCCGGACAGTGCCACAGAGGAGGAAGACACTGTGGAACTCAC TGAGTTTGGTATGCAGAATGTTGAAATTCCTCATCTTCCTCAAGATTTTGAAGTTGCA AAATATAACACCTTGGAGAAAGTGGGAATGGAGGGAGGCCAGGAAGCTGTGGTGGT GGAGCTTCAGTGTTCGCGGGACTCCAGGGACTGTCCTTTCCTGATATCCTCACACTTC CTCCTGGATGATGGCATGGAGACTAGAAGACAGTTTGCTATAAAGAAAACCTCTGA AGATGCAAGTGAATACTTTGAAAATTACATTGAAGAACTGAAGAAACAAGGATTTC TACTAAGAGAACATTTCACACCTGAAGCAACCCAATTAGCATCTGAACAATTGCAAG CATTGCTTTTGGAGGAAGTCATGAATTCAAGCACTCTGAGCCAAGAGGTGAGCGATT TAGTAGAGATGATTTGGGCAGAGGCCCTGGGCCACCTGGAACACATGCTTCTCAAGC CAGTGAACAGGATTAGCCTCAACGATGTGAGCAAGGCAGAGGGGATTCTCCTTCTA GTAAAGGCAGCACTGAAAAATGGAGAAACAGCAGAGCAATTGCAAAAGATGATGA CAGAGTTTTACAGACTGATACCTCACAAAGGCACAATGCCCAAAGAAGTGAACCTG GGACTATTGGCTAAGAAAGCAGACCTCTGCCAGCTAATAAGAGACATGGTTAATGT CTGTGAAACTAATTTGTCCAAACCCAACCCACCATCCCTGGCCAAATACCGAGCTTT GAGGTGCAAAATTGAGCATGTTGAACAGAATACTGAAGAATTTCTCAGGGTTAGAA AAGAGGTTTTGCAGAATCATCACAGTAAGAGCCCAGTGGATGTCTTGCAGATATTTA GAGTTGGCAGAGTGAATGAAACCACAGAGTTTTTGAGCAAACTTGGTAATGTGAGG CCCTTGTTGCATGGTTCTCCTGTACAAAACATCGTGGGAATCTTGTGTCGAGGGTTGC TTTTACCCAAAGTAGTGGAAGATCGTGGTGTGCAAAGAACAGACGTCGGAAACCTT GGAAGTGGGATTTATTTCAGTGATTCGCTCAGTACAAGTATCAAGTACTCACACCCG GGAGAGACAGATGGCACCAGACTCCTGCTCATTTGTGACGTAGCCCTCGGAAAGTGT ATGGACTTACATGAGAAGGACTTTTCCTTAACTGAAGCACCACCAGGCTACGACAGT GTGCATGGAGTTTCGCAAACAGCCTCTGTCACCACAGACTTTGAGGATGATGAATTT GTTGTCTATAAAACCAATCAGGTTAAAATGAAATATATTATTAAATTTTCCATGCCTG GAGATCAGATAAAGGACTTTCATCCTAGTGATCATACTGAATTAGAGGAATACAGAC CTGAGTTTTCAAATTTTTCAAAGGTTGAAGATTACCAGTTACCAGATGCCAAAACTT CCAGCAGCACCAAGGCCGGCCTCCAGGATGCCTCTGGGAACTTGGTTCCTCTGGAGG ATGTCCACATCAAAGGGAGAATCATAGACACTGTAGCCCAGGTCATTGTTTTTCAGA CATACACAAATAAAAGTCACGTGCCCATTGAGGCAAAATATATCTTTCCTTTGGATG ACAAGGCCGCTGTGTGTGGCTTCGAAGCCTTCATCAATGGGAAGCACATAGTTGGAG AGATTAAAGAGAAGGAAGAAGCCCAGCAAGAGTACCTAGAAGCCGTGACCCAGGG CCATGGCGCTTACCTGATGAGTCAGGATGCTCCGGACGTTTTTACTGTAAGTGTTGG AAACTTACCCCCTAAGGCTAAGGTTCTTATAAAAATTACCTACATCACAGAACTCAG CATCCTGGGCACTGTTGGTGTCTTTTTCATGCCCGCCACCGTAGCACCCTGGCAACA GGACAAGGCTTTGAATGAAAACCTTCAGGATACAGTAGAGAAGATTTGTATAAAAG AAATAGGAACAAAGCAAAGCTTCTCTTTGACTATGTCTATTGAGATGCCGTATGTGA TTGAATTCATTTTCAGTGATACACATGAACTGAAACAAAAGCGCACAGACTGCAAA GCTGTCATTAGCACCATGGAAGGCAGCTCCTTAGACAGCAGTGGATTTTCTCTCCAC ATCGGTTTGTCTGCTGCCTATCTCCCAAGAATGTGGGTTGAAAAACATCCAGAAAAA GAAAGCGAGGCTTGCATGCTTGTCTTTCAACCCGATCTCGATGTCGACCTCCCTGAC CTAGCCAGTGAGAGCGAAGTGATTATTTGTCTTGACTGCTCCAGTTCCATGGAGGGT GTGACATTCTTGCAAGCCAAGCAAATCGCCTTGCATGCGCTGTCCTTGGTGGGTGAG AAGCAGAAAGTAAATATTATCCAGTTCGGCACAGGTTACAAGGAGCTATTTTCGTAT CCTAAGCATATCACAAGCAATACCATGGCAGCAGAGTTCATCATGTCTGCCACACCT ACCATGGGGAACACAGACTTCTGGAAAACACTCCGATATCTTAGCTTATTGTACCCT GCTCGAGGGTCACGGAACATCCTCCTGGTGTCTGATGGGCACCTCCAGGATGAGAGC CTGACATTACAGCTCGTGAAGAGGAGCCGCCCGCACACCAGGTTATTCGCCTGCGGT ATCGGTTCTACAGCAAATCGTCACGTCTTAAGGATTTTGTCCCAGTGTGGTGCCGGA GTATTTGAATATTTTAATGCAAAATCCAAGCATAGTTGGAGAAAACAGATAGAAGA CCAAATGACCAGGCTATGTTCTCCGAGTTGCCACTCTGTCTCCGTCAAATGGCAGCA ACTCAATCCAGATGTGCCCGAGGCCCTGCAGGCCCCAGCCCAGGTGCCGTCCTTGTT TCTCAATGATCGACTCCTTGTCTATGGATTCATTCCTCACTGCACACAGGCAACTCTG TGTGCACTAATTCAAGAGAAAGAATTTCGTACAATGGTGTCGACTACTGAGCTTCAG AAGACAACTGGAACTATGATCCACAAGCTGGCAGCCCGAGCTCTAATCAGAGATTA TGAAGATGGCATTCTTCACGAAAATGAAACCAGTCATGAGATGAAAAAACAAACCT TGAAATCTCTGATTATTAAACTCAGTAAAGAAAACTCTCTCATAACACAATTTACAA GCTTTGTGGCAGTTGAGAAAAGGGATGAGAATGAGTCGCCTTTTCCTGATATTCCAA AAGTTTCTGAACTTATTGCCAAAGAAGATGTAGACTTCCTGCCCTACATGAGCTGGC AGGGGGAGCCCCAAGAAGCCGTCAGGAACCAGTCTCTTTTAGCATCCTCTGAGTGGC CAGAATTACGTTTATCCAAACGAAAACATAGGAAAATTCCATTTTCCAAAAGAAAA ATGGAATTATCTCAGCCAGAAGTTTCTGAAGATTTTGAAGAGGATGGCTTAGGTGTA CTACCAGCTTTCACATCAAATTTGGAACGTGGAGGTGTGGAAAAGCTATTGGATTTA AGTTGGACAGAGTCATGTAAACCAACAGCAACTGAACCACTATTTAAGAAAGTCAG TCCATGGGAAACATCTACTTCTAGCTTTTTTCCTATTTTGGCTCCGGCCGTTGGTTCCT ATCTTCCCCCGACTGCCCGCGCTCACAGTCCTGCTTCCTTGTCTTTTGCCTCATATCGT CAGGTAGCTAGTTTCGGTTCAGCTGCTCCTCCCAGACAGTTTGATGCATCTCAATTCA GCCAAGGCCCTGTGCCTGGCACTTGTGCTGACTGGATCCCACAGTCGGCGTCTTGTC CCACAGGACCTCCCCAGAACCCACCTTCTTCACCCTATTGTGGCATTGTTTTITCAGG GAGCTCATTAAGCTCTGCACAGTCTGCTCCACTGCAACATCCTGGAGGCTTTACTAC CAGGCCTTCTGCTGGCACCTTCCCTGAGCTGGATTCTCCCCAGCTTCATTTCTCTCTT CCTACAGACCCTGATCCCATCAGAGGTTTTGGGTCTTATCATCCCTCTGCTTCCTCTC CTTTTCATTTTCAACCTTCCGCAGCCTCTTTGACTGCCAACCTTAGGCTGCCAATGGC CTCTGCTTTACCTGAGGCTCTTTGCAGTCAGTCCCGGACTACCCCAGTAGATCTCTGT CTTCTAGAAGAATCAGTAGGCAGTCTCGAAGGAAGTCGATGTCCTGTCTTTGCTTTTC AAAGTTCTGACACAGAAAGTGATGAGCTATCAGAAGTACTTCAAGACAGCTGCTTTT TACAAATAAAATGTGATACAAAAGATGACAGTATCCTGTGCTTTCTGGAAGTAAAAG AAGAGGATGAAATAGTGTGCATACAACACTGGCAGGATGCTGTGCCTTGGACAGAA CTCCTCAGTCTACAGACAGAGGATGGCTTCTGGAAACTTACACCAGAACTGGGACTT ATATTAAATCTTAATACAAATGGTTTGCACAGCTTTCTTAAACAAAAAGGCATTCAA TCTCTAGGTGTAAAAGGAAGAGAATGTCTCCTGGACCTAATTGCCACAATGCTGGTA CTACAGTTTATTCGCACCAGGTTGGAAAAAGAGGGAATAGTGTTCAAATCACTGATG AAAATGGATGACGCTTCTATTTCCAGGAATATTCCCTGGGCTTTTGAGGCAATAAAG CAAGCAAGTGAATGGGTAAGAAGAACTGAAGGACAGTACCCATCTATCTGCCCACG GCTTGAACTGGGGAACGACTGGGACTCTGCCACCAAGCAGTTGCTGGGACTCCAGC CCATAAGCACTGTGTCCCCTCTTCATAGAGTCCTCCATTACAGTCAAGGCTAA 2 MVMGIFANCIFCLKVKYLPQQQKKKLQTDIKENGGKFSFSLNPQCTHIILDNADVLSQYQ LNSIQKNHVHIANPDFIWKSIREKRLLDVKNYDPYKPLDITPPPDQKASSSEVKTEGLCPD SATEEEDTVELTEFGMQNVEIPHLPQDFEVAKYNTLEKVGMEGGQEAVVVELQCSRDS RDCPFLISSHFLLDDGMETRRQFAIKKTSEDASEYFENYIEELKKQGFLLREHFTPEATQL ASEQLQALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEHMLLKPVNRISLNDVSKAEG ILLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQLIRDMV NVCETNLSKPNPPSLAKYRALRCKIEHVEQNTEEFLRVRKEVLQNHHSKSPVDVLQIFRV GRVNETTEFLSKLGNVRPLLHGSPVQNIVGILCRGLLLPKVVEDRGVQRTDVGNLGSGIY FSDSLSTSIKYSHPGETDGTRLLLICDVALGKCMDLHEKDFSLTEAPPGYDSVHGVSQTA SVTTDFEDDEFVVYKTNQVKMKYIIKFSMPGDQIKDFHPSDHTELEEYRPEFSNFSKVED YQLPDAKTSSSTKAGLQDASGNLVPLEDVHIKGRIIDTVAQVIVFQTYTNKSHVPIEAKYI FPLDDKAAVCGFEAFINGKHIVGEIKEKEEAQQEYLEAVTQGHGAYLMSQDAPDVFTVS VGNLPPKAKVLIKITYITELSILGTVGVFFMPATVAPWQQDKALNENLQDTVEKICIKEIG TKQSFSLTMSIEMPYVIEFIFSDTHELKQKRTDCKAVISTMEGSSLDSSGFSLHIGLSAAYL PRMWVEKHPEKESEACMLVFQPDLDVDLPDLASESEVIICLDCSSSMEGVTFLQAKQIAL HALSLVGEKQKVNIIQFGTGYKELFSYPKHITSNTMAAEFIMSATPTMGNTDFWKTLRY LSLLYPARGSRNILLVSDGHLQDESLTLQLVKRSRPHTRLFACGIGSTANRHVLRILSQCG AGVFEYFNAKSKHSWRKQIEDQMTRLCSPSCHSVSVKWQQLNPDVPEALQAPAQVPSL FLNDRLLVYGFIPHCTQATLCALIQEKEFRTMVSTTELQKTTGTMIHKLAARALIRDYED GILHENETSHEMKKQTLKSLIIKLSKENSLITQFTSFVAVEKRDENESPFPDIPKVSELIAKE DVDFLPYMSWQGEPQEAVRNQSLLASSEWPELRLSKRKHRKIPFSKRKMELSQPEVSED FEEDGLGVLPAFTSNLERGGVEKLLDLSWTESCKPTATEPLFKKVSPWETSTSSFFPILAP AVGSYLPPTARAHSPASLSFASYRQVASFGSAAPPRQFDASQFSQGPVPGTCADWIPQSA SCPTGPPQNPPSSPYCGIVFSGSSLSSAQSAPLQHPGGFTTRPSAGTFPELDSPQLHFSLPTD PDPIRGFGSYHPSASSPFHFQPSAASLTANLRLPMASALPEALCSQSRTTPVDLCLLEESV GSLEGSRCPVFAFQSSDTESDELSEVLQDSCFLQIKCDTKDDSILCFLEVKEEDEIVCIQH WQDAVPWTELLSLQTEDGFWKLTPELGLILNLNTNGLHSFLKQKGIQSLGVKGRECLLD LIATMLVLQFIRTRLEKEGIVFKSLMKMDDASISRNIPWAFEAIKQASEWVRRTEGQYPSI CPRLELGNDWDSATKQLLGLQPISTVSPLHRVLHYSQG SEQ ID NO. 1: Nucleotide sequence for human PARP4 mRNA (NCBI GenBank NM_006437.3) SEQ ID NO. 2: Amino acid sequence for human PARP4 (NCBI GenBank NP_006428.2)

EXAMPLES

(95) While preferred embodiments of the present disclosure have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the disclosure. It should be understood that various alternatives to the embodiments of the disclosure described herein may be employed in practicing the disclosure.

Example 1. Immobilization of Molecules by ADP-Ribosylation

(96) To achieve ADP-ribosylation of vault enclosed passenger molecules, vaults are synthesized using either an in vitro cell-free protein expression system or a cell-based protein expression system. Vaults are passively loaded with large passenger molecules (see FIG. 5A) during synthesis. Alternatively, or additionally, small passenger molecules that can readily diffuse into the vault are loaded after synthesis (see FIG. 5B). ADP-ribosylation is carried out by adding a PARP4 or engineered PARP4 variant during vault synthesis or to the completed vault and incubating the vault in the presence of the substrate, NAD+, and an acceptor molecule. Vaults produced in cell-based systems contain a profile of cytoplasmic molecules from the producing cell which may be of interest in certain applications, and additionally may accommodate small passenger molecules after vault synthesis is complete. To initiate ADP-ribosylation, PARP4 or engineered PARP4 variants are added to vaults before or after purification and then incubated in the presence of NAD+.

(97) The passenger molecule of interest naturally contains an acceptor site for ADP-ribosylation. Alternatively, the passenger molecule does not contain an acceptor site, and an inert molecule, or excipient, is added in addition to the molecule of interest. Alternatively, a vault protein contains the acceptor site.

Example 2. Altering the Physicomechanical Properties of Vault Particles

(98) ADP-ribosylation was carried out based on previously described methods (Kickhoefer, Siva, et al., 1999; Tulin, 2011). 14 g of purified vaults with or without human PARP4, synthesized in a cell-free or a cell-based protein expression system, was added to 15 l of ADP-ribosylation reaction buffer (50 mM Tris-HCl, pH 8.0, 4 mM MgCl.sub.2, 0.4 mM dithiothreitol (DTT) and 1 l of tartrazine (a small molecule (533 daltons) from TCI Chemicals, at 40 mg/ml in water). The reaction was initiated by the addition of 1 l of the substrate NAD+ (MilliporeSigma, at 75.36 mM in water) and was incubated at room temperature for 15-60 minutes. Changes in the physicomechanical properties was measured by native agarose gel electrophoresis. The completed reaction was mixed with 6X glycerol bromophenol blue loading dye, applied to respective wells of a 0.7% agarose-Tris-boric acid-EDTA (TBE) gel and a voltage was applied. Electrophoretic mobility was visualized by Coomassie blue staining and LI-COR imaging. Vaults containing PARP4 and incubated with tartrazine and NAD+ migrated faster through the agarose gel than vaults without PARP4. As agarose gel electrophoresis separates molecules based on charge (see FIG. 6B), vaults containing an ADP-ribose matrix are more negatively charged and thus migrate faster.

(99) Quantitative measurement of electrostatic charge is measured as the zeta potential, using the qNANO GOLD (Izon Science, Christchurch, New Zealand).

(100) Vault encapsulated tartrazine is quantified by extracting the vault band from the agarose, measuring the absorbance at 427 nm, for tartrazine, and 280 nm, for protein. The concentration of tartrazine is determined using a tartrazine standard curve, and is compared between reactions with and without PARP4 and reactions with and without NAD+.

Example 3. Assessing the Physicomechanical Properties of Altered Vault Particles

(101) To assess compressive strength conferred by an ADP-ribose matrix (e.g., as described in Example 1) within the vault particle, uranyl acetate staining and electron microscopy is used. ADP-ribosylation within the vault particle is carried with 10-15 g of vaults, with and without PARP4, 1 l of tartrazine (TCI Chemicals, 40 mg/ml in water), 1 l of the substrate NAD+ (MilliporeSigma, 3.75 mM) in 15 l ADP-ribosylation reaction buffer (50 mM Tris-HCl, pH 8.0, 4 mM MgCl.sub.2, 0.4 mM dithiothreitol (DTT). The reaction is incubated for 30 minutes at room temperature. Vaults are purified by agarose gel electrophoresis and gel extraction. Purified vaults are adsorbed onto carbon-coated holey film grids for 1 min at 4 C., stained with 1% uranyl acetate for 5 min at 4 C., and the resulting grids will be dried on filter paper. Uranyl acetate stained samples are evaluated by electron microscopy. Vault particles with greater density and compressive strength display an ovoid shape with smoother sides (FIG. 7A), whereas empty vaults or vaults without an ADP-ribose matrix are flatter and have pronounced invaginations at the waist (FIG. 7B).

Example 4. Assessing Vault Association with Target Cell Nuclei

(102) Vaults disclosed herein may advantageously associate with a nucleus of a target cell. To demonstrate this, the fluorescent molecule Cy3 carboxylic acid, trisulfo is incubated with vaults that contain PARP4 in the presence of NAD+. After incubation, immobilization of Cy3 carboxylic acid, trisulfo is characterized by electrophoretic mobility in agarose gel and typhoon imaging. The vault band is excised and eluted from the gel. Gel purified vaults is incubated with the human monocytic THP-1 cells grown on a glass slide or with the human epithelial 293T cells, human breast epithelial MCF7 cells, or human osteosarcoma U2OS cells. After 30 minutes, and 1, 2 and 6 hours, cells are washed, stained and fixed with paraformaldehyde. Confocal microscopy is used to determine the subcellular localization of the Cy3 carboxylic acid, trisulfo molecules. Relative intensity of Cy3 in subcellular compartments, particularly the nucleus, is compared between treatments.

Example 5. Comparing Efficacy of Free Therapeutic Agent to Vault-Delivered Therapeutic Agent

(103) Doxorubicin is immobilized within a vault particle described herein and agarose gel purified as described. Vaults containing immobilized doxorubicin or free doxorubicin is applied to MCF7 breast cancer cells and incubated for 2, 6 and 24 hours. After 2 and 6 hours, cells are prepared for confocal microscopy. The cells are washed 3 with phosphate buffered saline (PBS) to remove free doxorubicin or doxorubicin immobilized vaults, fixed with 2% paraformaldehyde for 15 min at room temperature, washed 2 with PBS and incubated with the nuclear stain Hoechst 33342 (5 ng/ml in PBS) for 10 min at room temperature. The subcellular location of doxorubicin is visualized by doxorubicin autofluorescence with 488 nm excitation and Hoechst 33342 emission with 350 nm excitation. Doxorubicin delivered by vaults will enter the nucleus more rapidly and reach a higher nuclear concentration compared to free doxorubicin as the vault will shield the doxorubicin molecules from cellular drug efflux pumps. After 24 hours, the MTT assay is used to measure cell viability; ADP-ribose matrix immobilized doxorubicin within the vault particle will be compared to free doxorubicin. Doxorubicin delivered by vaults will be more effective than free doxorubicin.

Example 6. Packaging of DNA, RNA or Protein Molecules by Electrostatic Interactions

(104) Charged, hydrophobic and/or polar molecules accessible in the inner vault cavity in the rat MVP crystal structure (PBD ID: 4V60) and other MVP structures are identified using coordinates public databases (e.g., RCSB PDB, www.resb.org) and molecular visualization software (e.g., Pymol, www.pymol.org). Based on the properties of the passenger molecule, amino acids within Regions I-III (FIG. 10A) are mutated, or additional amino acids are inserted, to yield a local change in electrostatic, hydrophobic or polar properties. To reduce improper folding of the MVP chain/vault particle, insertions primarily occur within internal loops.

(105) Passenger molecules are added to the vault assembly reaction or after vault assembly as described herein. Passenger molecules include plasmid DNA (e.g., CRISPR plasmids), RNA (e.g., non-coding RNA, mRNA), proteins and peptides. Packaging and release of passenger molecules is measured with standard methods.

Example 7. Delivery of Vault Particles Engineered to Express a Peptide Ligand in the Shoulder Domain

(106) In many types of cancer, including breast, ovarian and prostate cancer, gastrin-releasing peptide receptor (GRP-R) is overexpressed which makes GRP-R a suitable target for both therapy and imaging. An 8-amino acid peptide of the ligand GRP having the sequence Gin-Trp-Ala-Val-Gly-His-Leu-Met (SEQ ID NO.: 3)-NH2 has been found to have affinity for the GRP-R (Accardo et al., EJNMMI Research 2016 Dec. 6 (1): 17). To target vaults to GPR-R overexpressing cells, the 8-amino acid peptide was cloned into the unstructured shoulder region following Gly613 to extend the region by eight amino acids by In-Fusion PCR Cloning System (Takara Bio USA, Mountain View, CA). The expression vector, pEU E01-MCS (Cell Free Sciences, Yokohama, Japan) containing the rat major vault protein (MVP) sequence engineered with an AfeI restriction site (AGCGCT) in the shoulder region between Gly613 and Pro614 was digested with AfeI (FIG. 11B). Complementary 57-mer oligonucleotides coding for the 8-amino acid peptide flanked by homologous sequences for In-Fusion cloning into the open vector were hybridized to create the insert

(107) TABLE-US-00004 (SEQIDNO.:4) (forwardoligonucleotide, CTGAAGACACAGGTAGCGATTACAAAGATGACGATGATAAGGCTCCTGAT GGCACAC, and (SEQIDNO.:5) reverseoligonucleotide, GTGTGCCATCAGGAGCCTTATCATCGTCATCTTTGTAATCGCTACCTGTG TCTTCAG).
Insertion was confirmed by sequence analysis.

(108) Vault particles were produced by an in vitro cell-free translation using WEPRO 7240 wheat germ extract and SUBAMIX translation buffer (Cell Free Sciences, Yokohama, Japan). Assembly of GRP-Vaults was confirmed by immunogold electron microscopy. Wild type (WT) or GRP-Vaults were adsorbed to a formvar coated Nickel grid, stabilized with carbon. Grids were washed twice and blocked with blocking buffer (50 mM Tris-HCL, pH 8.0-100 mM NaCl-1% BSA). Grids were applied to rabbit anti-GRP, Cat #ab22623, (Abcam, Cambridge, MA), diluted 1:20 in blocking buffer and incubated for 1 hour at room temperature, then washed twice. The grids were applied to goat anti-rabbit IgG H&L-10 nm gold, Cat #ab27234, (Abcam, Cambridge, MA), diluted 1:20 in blocking buffer and incubated for 1 hour at room temperature, then washed twice. The grids were stained with 1% uranyl acetate then visualized by transmission electron microscopy using a JEM1200EX electron microscope (JEOL, Tokyo, Japan) (FIG. 12A).

(109) Specific targeting (e.g., to ORP-R overexpressing cells) was measured by performing in vitro binding experiments with GRP-R expressing PC-3 human prostate cancer cells (FIG. 12B) and GRP-R negative cell line (negative control). Cells were plated in an 8-well chamber slide (Nalge Nunc, Rochester, New York) and incubated overnight. Both cell lines are treated with DyLight-488 (ThermoFisher Scientific, Waltham, MA) labeled vault particles, one set with bombesin peptide and another set without the bombesin peptide (negative control). Incubation was carried out at 4 C. for 1 hour. Cells were washed three times with 1% FBS-PBS and fixed with paraformaldehyde for 5 min. EMS Immuno Mount DAPI and DABCO, Cat #17989-97 (Electron Microscopy Sciences, Hatfield, PA) was applied to the slide and a coverslip was added. Images were acquired with an epifluorescence microscope at 1000 magnification (FIG. 12B).

Example 8. Vault Particles Engineered to Express an Epitope Tag in the Shoulder Domain

(110) Epitope tags are ligands commonly used to label proteins for which a well-established repertoire of antibodies and other reagents have been developed to detect them. The hydrophilic 8 amino acid peptide, DYKDDDDK (SEQ ID NO.: 6), was inserted into the unstructured should domain using strategy 1 outlined in FIG. 11B. Complementary 57-mer oligonucleotides coding for the 8-amino acid peptide flanked by homologous sequences were hybridized to create the insert

(111) TABLE-US-00005 (SEQIDNO.:7) (forwardoligonucleotide, CTGAAGACACAGGTAGCGAGTGGGCGGTGGGGCACTTAATGGCTCCTGAT GGCACAC, and (SEQIDNO.:8) reverseoligonucleotide, GTGTGCCATCAGGAGCCATTAAGTGCCCCACCGCCCACTCGCTACCTGTG TCTTCAG),
and cloned into the AfeI digested rat MVP-pEU-E01-MCS vector by In-Fusion cloning. Insertion was confirmed by sequence analysis. DYKDDDDK (SEQ ID NO.: 6) tagged vault particles were produced by an in vitro cell-free translation using WEPRO 7240 wheat germ extract and SUBAMIX translation buffer (Cell Free Sciences, Yokohama, Japan). DYKDDDDK (SEQ ID NO.: 6)-vault particle assembly was confirmed by native agarose gel electrophoresis and Coomassie Blue staining.