MULTIPLEXED-TARGETED ADENOVIRUS VECTORS AND THEIR USE
20250186611 ยท 2025-06-12
Inventors
Cpc classification
C12N2710/10022
CHEMISTRY; METALLURGY
C07K14/70596
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
International classification
A61K48/00
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
Abstract
The present application provides compositions and methods for increasing safety, selectivity, and efficacy of transduction of human cells, including human long-term repopulating and hematopoietic stem cells (LT-HSC) and human cancer cells, by adenovirus vectors through multiplexed targeting of virus attachment and internalization receptors. Multiplexing targeting Ad vector receptor specificities through the combination of i) restricting fiber-specific attachment receptors, ii) deleting the RGD amino acid motif from the penton base protein, and iii) inserting into Ad penton base protein of peptides that lack the RGD amino acid motif and enable vector interaction with integrin classes expressed on target cells, allows for the improvement of safety, selectivity, and efficacy of vector-mediated transduction of human cells in vitro and after intravenous vector administration in vivo.
Claims
1. A method for transducing human cells, comprising: contacting human cells with a recombinant adenovirus, wherein the recombinant adenovirus comprises: (a) a penton base protein, wherein the RGD amino acid motif is deleted; and (b) a penton base protein further comprises an inserted peptide that lacks the RGD amino acid motif and said peptide interacts with non-RGD integrin classes, expressed on human cells; and (c) a fiber protein capable of interacting with CD46 or DSG2 attachment receptors, but not with coxsackievirus and adenovirus receptor, CAR.
2. The method of claim 1, wherein the penton base protein comprises an inserted peptide capable of interacting with integrins of a4-classes, a6-classes, a9-classes, or aD-classes.
3. The method of claim 2, wherein the peptide is inserted into the RGD loop of the penton base protein.
4. The method of claim 3, wherein the peptide has the sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:18, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:28, SEQ ID NO:29 and SEQ ID NO:30.
5. The method of claim 1, wherein the recombinant adenovirus is based on human or animal serotype and comprises a fiber knob domain capable of binding to a CD46 receptor.
6. The method of claim 5, wherein the fiber knob domain comprises SEQ ID NO:13.
7. The method of claim 1, wherein the recombinant adenovirus is based on human or animal serotype and comprises a fiber knob domain capable of binding to a DSG2 receptor.
8. A method of claim 7, wherein the fiber knob domain comprises SEQ ID NO:14.
9. The method of claim 1, wherein the recombinant adenovirus comprises one or several transgenes of interest and wherein the recombinant adenovirus is a replication-deficient, replication-restricted, or gutless adenovirus.
10. The method of claim 1, wherein the human cells are contacted with the recombinant adenovirus ex vitro.
11. The method of claim 1, wherein the human cells are contacted with the recombinant adenovirus in vivo.
12. A recombinant adenovirus, comprising: (a) a penton base protein, wherein the RGD amino acid motif is deleted; and (b) a penton base protein further comprises an inserted peptide that lacks the RGD amino acid motif and said peptide interacts with non-RGD integrin classes, expressed on human cells; and (c) a fiber protein capable of interacting with CD46 or DSG2 attachment receptors, but not with coxsackievirus and adenovirus receptor (CAR).
13. A recombinant adenovirus of claim 12, wherein the penton base protein comprises an inserted peptide capable of interacting with integrins of a4-classes, a6-classes, a9-classes, or aD-classes.
14. A recombinant adenovirus of claim 13, wherein the peptide is inserted into the RGD loop of the penton base protein.
15. A recombinant adenovirus of claim 14, wherein the peptide has the sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:18, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:28, SEQ ID NO:29, and SEQ ID NO:30.
16. The recombinant adenovirus of claim 12, wherein the recombinant adenovirus is based on human or animal serotype and comprises a fiber knob domain capable of binding to a CD46 receptor.
17. The recombinant adenovirus of claim 16, wherein the fiber knob domain comprises SEQ ID NO:13.
18. The recombinant adenovirus of claim 12, wherein the recombinant adenovirus is based on human or animal serotype and comprises a fiber knob domain capable of binding to a DSG2 receptor.
19. The recombinant adenovirus of claim 18, wherein the fiber knob domain comprises SEQ ID NO:14.
20. A pharmaceutical composition comprising: a) the recombinant adenovirus of claim 12; and b) a pharmaceutically acceptable carrier.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
SUMMARY
[0053] The present application provides compositions and methods for increasing selectivity and efficacy of transduction of human cells, including human long-term repopulating and hematopoietic stem cells (LT-HSC), lineage-committed human cells of hematopoietic origin, human cells of non-hematopoietic origin, and human cancer cells, by adenovirus vectors through multiplexed targeting of virus attachment and internalization receptors. The multiplexed targeted adenovirus vectors of the invention attach to cells via mutated or native fibers comprising fiber knob domains that interact with CD46 or DSG2 receptors, but not with coxsackie-adenovirus receptor, and enter human cells via mutated pentons that have the RGD amino acid motif deleted, and that were further engineered to interact with non-RGD-binding integrin classes expressed on the surface of target cells.
[0054] Multiplexing targeting Ad vector receptor specificities through the combination of restricted fiber-specific attachment receptors, deletion of RGD amino acids from the penton base protein, and insertion into Ad penton base of peptides that lack the RGD amino acid motifs and enable vector interaction with integrin classes expressed on human cells, allows for the improvement of selectivity and efficacy of vector-mediated transduction of human cells, including LT-HSC cells, in vitro and after intravenous vector administration in vivo.
[0055] In a preferred embodiment of present application, the Ad vector, if based on human Ad serotype HAdv-C5, comprises mutated penton base with deleted RGD amino acid motifs and further modified by the substitution of the RGD loop of the HAdv-C5 penton base protein with a short artificial a6-integrin interacting peptide containing amino acids SIKVAV (SEQ ID NO:1).
[0056] In some embodiments, the a6-integrin-interacting peptide is inserted into the surface-exposed region of the penton base capsid protein from an Ad vector of a human or animal serotype, encoding mutated or a native fiber protein, comprising at least the fiber knob domain that is able to interact with CD46 as a cell attachment receptor. Such fiber knob domain or the native fiber may be derived from, but not limited to, human adenovirus serotypes HAdv-B11, HAdv-B16, HAdv-B21, HAdv-B34, HAdv-B35, and HAdv-B50.
[0057] In a more preferred embodiments, the 6-integrin-interacting peptide is inserted into the surface-exposed region of the penton base capsid protein from an Ad vector of a human or animal serotype, encoding mutated or a native fiber protein, comprising at least the fiber knob domain that is able to interact with DSG2 as a cell attachment receptor. Such fiber knob domain or the native fiber may be derived from, but not limited to, human adenovirus serotypes HAdv-B3. HAdv-B7, HAdv-B14, and HAdv-B55.
[0058] In some embodiments, the modified Ad vectors comprising the non-RGD-integrin interacting peptide and the fiber knob domain that binds to CD46 or DSG2 further comprise one or more optional mutations in the adenovirus hexon to reduce virus toxicity, avoid neutralization by humoral factors of innate and adaptive immunity, and improve in vivo virus pharmacokinetics and pharmacodynamics after intravenous administration.
[0059] In some embodiments, the modified Ad vectors of the present application can additionally or alternatively include peptide insertions to confer interactions with non-RGD-interacting integrin classes, other than a6-integrins, including non-RGD-interacting integrin classes expressed on the surface of human lymphocytes.
[0060] The Ad vectors of the invention can be used for in vitro and in vivo delivery of reporter genes, therapeutic genes, cytotoxic genes, genes expressing shRNA, anti-sense RNA, Linc-RNA, guide RNA, genes expressing genomic DNA- or RNA-editing enzymes, or any combination of these genes for gene therapy applications, where targeted expression of such genes may provide therapeutic benefits to patients with genetic or acquired diseases.
[0061] The invention also provides methods of administering an Ad of the invention with therapeutic intent to patients with genetic or acquired diseases seeking treatment, wherein the method comprises administering a patient seeking treatment with such a vector.
[0062] The invention also provides methods of delivering a gene to a non-hepatic mammalian cell with the Ads of the invention through contacting the host cell with the Ad in vivo.
DETAILED DESCRIPTION
[0063] Before the present compounds, compositions, articles, devices, and/or methods are disclosed and described, it is to be understood that they are not limited to specific synthetic methods or specific recombinant biotechnology methods unless otherwise specified, or to particular reagents unless otherwise specified, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting.
REFERENCE TO ELECTRONIC SEQUENCE LISTING
[0064] The application contained a Sequence Listing which has been submitted electronically in. XML format and is hereby incorporated by reference in its entirety. Said. XML copy, created Jul. 23, 2024, is names 2023-007 CIP.xml and is 46,132 bytes in size. The sequence listing contained in this .XML file is part of the specification and is hereby incorporated by reference herein in its entirety.
I. Definitions
[0065] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. For purposes of the present application, the following terms are defined below.
[0066] As used in the specification and the appended claims, the singular forms a, an and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a pharmaceutical carrier includes mixtures of two or more such carriers, and the like.
[0067] As used herein, the term adenovirus vector should be construed as additionally referring to an adenovirus particle or virion, unless the context clearly suggests otherwise. In addition, where the phrase stated adenovirus vector comprising [a protein], the phrase should be construed as an adenovirus vector encoding the protein.
[0068] Ranges can be expressed herein as from about one particular value, and/or to about another particular value. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent about, it will be understood that the particular value forms another embodiment. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint. It is also understood that there are a number of values disclosed herein, and that each value is also herein disclosed as about that particular value in addition to the value itself. For example, if the value 10 is disclosed, then about 10 is also disclosed. It is also understood that when a value is disclosed that less than or equal to the value, greater than or equal to the value and possible ranges between values are also disclosed, as appropriately understood by the skilled artisan. For example, if the value 10 is disclosed the less than or equal to 10 as well as greater than or equal to 10 is also disclosed. It is also understood that throughout the application, data is provided in a number of different formats, and that this data, represents endpoints and starting points, and ranges for any combination of the data points. For example, if a particular data point 10 and a particular data point 15 are disclosed, it is understood that greater than, greater than or equal to, less than, less than or equal to, and equal to 10 and 15 are considered disclosed as well as between 10 and 15. It is also understood that each unit between two particular units are also disclosed. For example, if 10 and 15 are disclosed, then 11, 12, 13, and 14 are also disclosed.
[0069] As used herein, the terms homology and % identity should be construed as being equivalent to similarity. Thus, for example, if the use of the word homology is used between two non-natural sequences, this should not be construed as necessarily indicating an evolutionary relationship between these two sequences, but rather the similarity or relatedness between the two sequences. Many of the methods for determining homology between two evolutionarily related molecules are routinely applied to any two or more nucleic acids or proteins for the purpose of measuring sequence similarity regardless of whether they are evolutionarily related or not.
[0070] In general, one way to define any known variants and derivatives or those that might arise from the disclosed genes and proteins herein is through defining the variants and derivatives in terms of homology to specific known sequences. Variants of the genes, proteins, and peptides disclosed herein typically have at least, about 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99 percent homology (or identity) to the stated sequence or the native sequence. Those of skill in the art can readily determine the homology of two nucleic acid or amino acid sequences. For example, the homology can be calculated after aligning the two sequences so that the homology is at its highest level. It should be understood that any of the methods typically used can in certain instances produce slightly different results. Consequently, to the extent that a % identity is determined from one of these methods, the sequences would be said to have the stated identity resulting therefrom.
[0071] In this specification and in the claims which follow, reference will be made to a number of terms which shall be defined to have the following meanings: Optional and optionally mean that the subsequently described event or circumstance may or may not occur, and that the description includes instances where said event or circumstance occurs and instances where it does not.
[0072] Throughout this application, various publications are referenced. The disclosures of these publications in their entireties are hereby incorporated by reference into this application in order to more fully describe the state of the art to which this pertains. The references disclosed are also individually and specifically incorporated by reference herein for the material contained in them that is discussed in the sentence in which the reference is relied upon.
II. Compositions of the Present Application
[0073] Disclosed are structural components for preparing and using the compositions of the present application, as well as the compositions themselves to be used within the methods disclosed herein. It should be understood that where combinations, subsets, interactions, groups, etc. of these elements are disclosed, where specific reference to various individual and collective combinations and permutations of these compounds may not be explicitly disclosed, each is specifically contemplated and described herein.
[0074] In one aspect, the present invention provides for novel adenovirus (Ad) vectors with modified capsid proteins. Adenovirus is a ubiquitous pathogen causing a wide range of human diseases, which include respiratory tract infections, conjunctivitis, hemorrhagic cystitis, and gastrointestinal diseases. In immunocompetent patients, Ad infections are self-limited, and after resolution of the acute infection, the virus remains latent in lymphoid and renal tissues. In contrast, in immunocompromised patients Ad infections may cause life threatening or even fatal fulminant hepatitis and disseminated infection of other tissues.
[0075] There are currently over 60 characterized human Ad serotypes which are divided into seven species (formally subgroups) from A to G. Although various Ad serotypes may initiate infections via different transmission routes, and utilize distinct virus attachment receptors, the host factors and cell types controlling tissue specificity of Ad infection in vivo remain insufficiently understood.
[0076] The Ad infectious cycle occurs in two steps. The early phase precedes the initiation of replication and makes it possible to produce the early proteins regulating the replication and transcription of the viral DNA. The replication of the genome is followed by the late phase during which the structural proteins that constitute the viral particles are synthesized. The assembly of the new virions takes place in the host cell nucleus. In a first stage, the viral proteins assemble to form empty capsids of icosahedral structure into which the genome is encapsidated. The assembled virus includes a penton base and fiber. The Ads liberated from cells are then capable of infecting other permissive cells. The fiber and the penton base proteins present at the surface of the capsids play a role in the cellular attachment of the virions and their internalization.
[0077] In vitro studies have demonstrated that Ad infection starts with the virus binding to a high affinity primary attachment receptor on the cell surface. The trimeric Ad fiber protein mediates this interaction when its distal knob domain binds to a specific cellular receptor (
[0078] Although human Ads of different serotypes utilize different cell attachment receptors (
[0079] Integrins are transmembrane cellular proteins that are localized at the cell surface and function as heterodimers, which are formed by the a- and b-subunits. Integrins are classified based on their ligand specificity and expression on leukocytes (
[0080] The type of integrins expressed on a particular cell type defines its ability to traffic through the body to or reside in the appropriate niches within specific tissues where cells perform their functions. Although certain selectivity exists in integrin classes that are expressed on any particular cell type, each specific cell type expresses a variety of integrin classes to support diverse cellular functions and ability of cell attachment to various extracellular matrixes in different tissue microenvironments and physiological or pathological contexts. For instance, human airway epithelial cells express eight different integrin heterodimers, including a2b1, a3b1, a6b4, a9b1, a5b1, avb5, avb6, avb8. Human NK cells circulating in the blood express L2, M2, 41, 51, and 61 integrins. Human melanoma tumor cells express a4b1, a2b1, and avb3 integrin classes, which drive differential migration and homing of tumor cells to distant organs, e.g. brain, liver, lung, bone tissue, and lymph nodes.
[0081] The genome-wide transcriptional profiling at a single cell level, using single cell RNA sequencing, allows for a determination of expression of any gene of interest and complexity among early hematopoietic progenitor cell populations using UMAP plots (as reported in (Ranzoni et al., 2021)). Using single cell transcriptomics data, reported by (Ranzoni et al, 2021), one can visualize the distribution of cells, expressing any particular gene of interest on the UMAP plots revealing how broadly a particular gene is expressed in the analyzed cell pool or in a defined cell population. Specifically, visualization of cells expressing human PROCR gene allows to determine localization of human LT-HSC cells among other human hematopoietic progenitor cell populations (
[0082] Analysis of expression of adenovirus attachment and internalization receptors on human LT-HSCs showed that adenovirus attachment receptors CD46 and DSG2 are highly expressed in LT-HSCs (
[0083] As shown in
[0084] The Ad vectors of the present application comprise fiber protein that is able to utilize CD46 or DSG2 receptors, but not CAR, to mediate virus attachment to mammalian cells. Ad vectors of the invention comprise fiber proteins of the general structure shown in
[0085] In some embodiments, the fiber shaft domain may be derived from any serotype and containing a fiber knob domain binding to the CD46 or DSG2 cell attachment receptors as shown in
[0086] Non-limiting examples of adenovirus fibers recognizing the CD46 cell attachment receptor include fibers naturally occurring in human adenoviruses of the following serotypes: HAdv-B11 (SEQ ID NO:3), HAdv-B16 (SEQ ID NO:4), HAdv-B21 (SEQ ID NO:5), HAdv-B34 (SEQ ID NO:6), HAdv-B-35 (SEQ ID NO:7), and HAdv-B50 (SEQ ID NO:8).
[0087] Non-limiting examples of adenovirus fibers binding the DSG2 cell attachment receptor include fibers naturally occurring in human adenoviruses of the following serotypes: HAdv-B3 (SEQ ID NO:9), HAdv-B7 (SEQ ID NO: 10), HAdv-B14 (SEQ ID NO:11), and HAdv-B55 (SEQ ID NO:12).
[0088] A non-limiting example of a mutated, receptor-re-targeted, chimeric adenovirus fiber binding the CD46 cell attachment receptor and containing a fiber tail domain from the human HAdv-C5 serotype includes a chimeric fiber protein comprising fiber knob domain derived from human adenovirus serotype HAdv-B35 and comprising the amino acid sequence of SEQ ID NO: 13.
[0089] A non-limiting example of a mutated, receptor-re-targeted, chimeric adenovirus fiber binding the DSG2 cell attachment receptor and containing a fiber tail domain from the human HAdv-C5 serotype includes a chimeric fiber protein comprising fiber knob domain derived from the human adenovirus serotype HAdv-B14 and comprising the amino acid sequence of SEQ ID NO: 14.
[0090] The adenovirus penton RGD loop comprises the R-G-D amino acid motif of SEQ ID NO: 15, which is present in the penton base protein of human adenovirus serotype HAdv-C5 (
[0091] The preferred embodiments of the invention are Ad vectors comprising the penton RGD amino acid motif deletion and substitution. The non-limiting example of such deletion and substitution is the insertion of an artificial peptide of SEQ ID NO: 18 comprising SIKVAV amino acid motif (SEQ ID NO:1,
[0092] In some embodiments, Ad vectors of the present application include any one of the Ad vectors encoding a modified penton base protein comprising a non-RGD-containing peptide that can mediate virus entry into target cells of interest via receptors expressed on the target cells that may include, without limitation, a4-, a9-, or aD-integrins and further comprise sequences encoding fiber knob domains that are able to utilize CD46 or DSG2, but not CAR, for vector attachment to cells. The non-limiting examples of non-RGD-containing peptides and mutated penton base proteins, comprising such peptides are shown in
[0093] In some embodiments, an Ad vector comprising mutated fiber and mutated penton may be based on any human or animal serotype, other than HAdv-C5, which comprises a native or mutated fiber protein allowing for vector to utilize CD46 or DSG2, but not CAR, as a cell attachment receptor.
[0094] As noted above, the Ad vectors described herein can be based on human Ad serotype 5 (HAdv-C5). However, the Ad vectors can be based on any other human or animal Ad serotype. For example, non-human Ads can include, without limitation, canine, avian, bovine, murine, ovine, porcine, or simian origin. It is understood that if the Ad vector is based on non-human or non-HAdv-C5 serotype, where the natural fiber structure allows for virus binding to CD46 or DSG2, but not CAR, the preferred embodiment of the invention based on such non-human or non-HAdv-C5 serotype should comprise mutated penton base protein with deleted RGD amino acid motif and insertion of a non-RGD-containing peptide in place of the RGD loop of the penton base, allowing for selective and efficient infection of mammalian cells needing therapy, as disclosed herein.
[0095] In certain preferred embodiments, the Ad of the present application can be a recombinant and replication-defective Ad (i.e., incapable of autonomously replicating in a host cell). Such a replication-deficient Ad can include, for example, a mutation or deletion of one or more viral regions, such as, for example, all or part of the E1 region and/or E4 region. The genome of an Ad optionally can include additional deletions or mutations affecting other regions, such as, for example, the E2, E3 and/or L1-L5 regions, including complete deletion of the virus coding sequences and replacement with non-Ad DNA (so called helper-dependent vectors).
[0096] In other preferred embodiments, the Ad vector of the present application can be replication-competent or replication-restricted and engineered to replicate specifically in cancer cells.
[0097] An Ad vector of the present application can include one or more genes of interest contained within a nucleic acid segment that is introduced into an Ad vector. The genes of interest can be placed under the control of the elements necessary for their expression in a specific host cell. The gene of interest is typically a human or non-human heterologous gene (i.e., a non-Ad gene). The gene of interest can be, for example, genomic, cDNA (complementary DNA), a hybrid or chimeric gene (e.g., a minigene lacking one or more introns), or the like. It can be obtained, for example, by conventional molecular biology techniques and/or by chemical synthesis. A gene of interest can encode, for example, an antisense RNA, shRNA, lncRNA, or siRNA, guide-RNA, a ribozyme, or an mRNA that can be translated into a polypeptide of interest. Polypeptides of interest include e.g., nuclear, cytoplasmic, membrane, secreted or other types of proteins, including proteins that can perform targeted editing of DNA sequences in human genomic DNA. Further, the polypeptide of interest can be, for example, a polypeptide as found in nature, a chimeric polypeptide obtained from the fusion of heterologous sequences of diverse origins, or of a polypeptide mutated relative to the native sequence having improved and/or modified biological properties.
[0098] In certain embodiments, the Ad vector can include a gene of interest that is configured to achieve a predetermined function or outcome. The gene of interest can encode, for example and without limitation, cytokines or lymphokines (-, - or -interferon, interleukins (e.g., IL-1, IL-2, IL-6, IL-10, IL-12, IL-15, IL-15R, IL-24, and alike)), colony stimulating factors (e.g., GM-CSF, C-CSF, M-CSF, or the like); cellular or nuclear receptors, including those recognized by pathogenic organisms (e.g., viruses, bacteria or parasites); proteins involved in activation of innate immune signaling of prokaryotic or eukaryotic origin (e.g., bacterial flagellin, or the like); proteins involved in triggering a genetic diseases (e.g., factor VII, factor VIII, factor IX, dystrophin or minidystrophin, insulin, CFTR protein (Cystic Fibrosis Transmembrane Conductance Regulator)); growth hormones (e.g., insulin, hGH or the like); metabolic or homeostatic enzymes (e.g., urease, renin, thrombin, or the like); genomic DNA-editing or host genomic DNA modifying enzymes, RNA-editing enzymes (e.g., CRISPR-Cas enzymes and enzymes with similar functions), enzyme inhibitors (e.g., 1-antitrypsin, antithrombin III, viral protease inhibitors, or the like); polypeptides with antitumor effect (e.g., which are capable of at least partially inhibiting the initiation or the progression of tumors or cancers), such as antibodies, inhibitors acting on cell division or transduction signals, products of expression of tumor suppressor genes (specifically, but without limitation, p53 or pRb), cell adhesion molecules, proteins stimulating the immune system, or the like); proteins of the class I or II major histocompatibility complex or regulatory proteins acting on the expression of the corresponding genes; polypeptides capable of inhibiting a viral, bacterial or parasitic infection or its development (e.g., antigenic polypeptides having immunogenic properties, antigenic epitopes, antibodies, transdominant variants capable of inhibiting the action of a native protein by competition, or the like); toxins (e.g., herpes simplex virus 1 thymidine kinase (HSV-1-TK), ricin, cholera toxin, diphtheria toxin, or the like) or immunotoxins; markers (-galactosidase, luciferase, Green Fluorescent Protein, or the like); polypeptides having an effect on apoptosis (e.g., inducer of apoptosis: Bax, or the like, blocker of apoptosis Bcl2, Bcl-x, or the like); cytostatic agents (e.g., p21, p16, Rb, or the like); apolipoproteins (e.g., apoE or the like); superoxide dismutase, catalase, nitric oxide synthase (NOS); growth factors (e.g., Fibroblast Growth Factor (FGF), Vascular Endothelial Cell Growth Factors (VEGFs), insulin, or the like), or others genes of therapeutic, prophylactic, or research interest. It should be noted that this list is not limiting and that other genes can also be used.
[0099] The Ad optionally can include a selectable gene which allows for selection or identification of the infected cells. Suitable selectable genes include, for example, Neo (neomycin phosphotransferase), DHFR (Dihydrofolate Reductase), CAT (Chloramphenicol Acetyltransferase), PAC (Puromycin Acetyltransferase), GPT (Xanthine-Guanine Phosphoribosyltransferase), MGMT (O6-methylguanine-DNA methyltransferase), and the like.
[0100] In certain embodiments, the gene of interest can further include elements necessary for the selective or regulated expression of the gene in a select host cell. Such elements include, for example, elements facilitating transcription of the gene into RNA and/or the translation of an mRNA into a protein and include promoter, enhancers, and insulators. Suitable promoters include, for example, those of eukaryotic or viral origin. Suitable promoters can be constitutive or regulatable (e.g., inducible). A promoter can be modified to increase promoter activity, suppress transcription-inhibiting regions, make a constitutive promoter regulatable, introduce a restriction site, and the like. The non-limiting examples of suitable promoters include, for example, the cytomegalovirus (CMV) promoter, Rous Sarcoma Virus (RSV) promoter, HSV-1 TK promoter, Simian Virus 40 (SV40) early promoter, Adenovirus (Ad) major late promoter (MLP), murine or human promoters from phosphoglycerate kinase (PGK), metallothionein (MT), the liver-specific al-antitrypsin and albumin promoters, lymphocyte-specific immunoglobulin promoters, endothelial-specific vascular endothelial growth factor receptor 1 (VEGFR-1) promoter, tumor-specific a-fetoprotein (AFP), MLJC-1, and prostate specific antigen (PSA) promoters, and endothelial cell specific flt promoter.
[0101] A gene of interest can also include additional elements for the expression (e.g., an intron sequence, a signal sequence, a nuclear localization sequence, a transcription termination sequence, a site for initiation of translation of the IRES type, or the like), for its maintenance in the host cell etc.
[0102] Further provided herein is a host cell, infected with an Ad according to the present disclosure or capable of being obtained by a method according to the present application.
III. Pharmaceutical Compositions
[0103] Another aspect of the present application relates to a pharmaceutical composition that comprises an adenovirus vector or polynucleotide of the present application and a pharmaceutically acceptable carrier.
[0104] The pharmaceutical compositions are co-administered with at least one pharmaceutically acceptable carrier for in vivo or ex vivo delivery. As used herein, the term pharmaceutically acceptable is used with reference to a material that is not biologically or otherwise undesirable, e.g., the material may be administered to a subject, along with the Ad vector or cells, without causing any undesirable biological effects or interactions in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained. In some embodiments, the carrier can be selected to minimize degradation of the active components and minimize any adverse side effects in the subject, as would be well known to one of ordinary skill in the art.
[0105] The compositions may be administered parenterally (e.g., intravenously), orally, by intramuscular injection, by intraperitoneal injection, transdermally, extracorporeally, topically, or by inhalation through the mouth or nose. The exact amount of the composition required will vary from subject to subject, depending on the species, age, weight and general condition of the subject, the severity of the allergic disorder being treated, the particular nucleic acid or vector used, its mode of administration and the like. An appropriate amount can be determined by one of ordinary skill in the art.
[0106] Parenteral administration of the composition, if used, is generally characterized by injection. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution of suspension in liquid prior to injection, or as emulsions. A more recently revised approach for parenteral administration involves use of a slow release or sustained release system such that a constant dosage is maintained.
[0107] The pharmaceutical composition may be formulated in solution, suspension, or incorporated into microparticles, liposomes, or cells, including within human LT-HSC or tumor cells following their in vitro transduction with the viral vectors of the present application and subsequently used for administration to patients with therapeutic intent.
IV. Therapeutic Uses
[0108] In one aspect, disclosed herein are methods of treatment according to which a therapeutically effective quantity of an Ad according to the present description or of a host cell is administered to a patient requiring such a treatment. Such methods can comprise treating a host with one or more pharmaceutical entities prior to, during, or after Ad administration.
[0109] The adenovirus vectors of the invention can be used as a gene delivery platform for in vitro, ex vivo, and in vivo delivery of reporter genes, therapeutic genes, cytotoxic genes, genes expressing shRNA, anti-sense RNA, Linc-RNA, guide-RNA, genes expressing genomic DNA- or RNA-editing enzymes, or any combination of these genes for gene therapy applications in vitro, ex vivo, or in vivo, specifically after intravenous vector administration, where expression of such genes may provide therapeutic benefits to patients with genetic or acquired diseases.
[0110] The disclosed Ad compositions can be also used to treat any disease where uncontrolled cellular proliferation occurs such as cancers. A non-limiting list of different types of cancers is as follows: lymphomas (Hodgkins and non-Hodgkins), leukemias, carcinomas, carcinomas of solid tissues, squamous cell carcinomas, adenocarcinomas, sarcomas, gliomas, high grade gliomas, blastomas, neuroblastomas, plasmacytomas, histiocytomas, melanomas, adenomas, hypoxic tumors, myelomas, AIDS-related lymphomas or sarcomas, metastatic cancers, or cancers in general.
[0111] A representative but non-limiting list of cancers that the disclosed compositions can be used to treat is the following: lymphoma, B cell lymphoma, T cell lymphoma, mycosis fungoides, Hodgkin's Disease, myeloid leukemia, bladder cancer, brain cancer, nervous system cancer, head and neck cancer, squamous cell carcinoma of head and neck, kidney cancer, lung cancers such as small cell lung cancer and non-small cell lung cancer, neuroblastoma/glioblastoma, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer, liver cancer, melanoma, squamous cell carcinomas of the mouth, throat, larynx, and lung, colon cancer, cervical cancer, cervical carcinoma, breast cancer, and epithelial cancer, renal cancer, genitourinary cancer, pulmonary cancer, esophageal carcinoma, head and neck carcinoma, large bowel cancer, hematopoietic cancers; testicular cancer; colon and rectal cancers, prostatic cancer, or pancreatic cancer.
[0112] Compounds disclosed herein may also be used for the treatment of precancer conditions such as cervical and anal dysplasias, other dysplasias, severe dysplasias, hyperplasias, atypical hyperplasias, and neoplasias.
EXAMPLES
Example 1. Assembly and Analysis of the Therapeutic Platform Vector A VID-317, Comprising Mutated Penton Base Protein with Deletion of the RGD Motif and Comprising a Peptide Interacting with a6-Integrins, and Further Comprising Mutated, Chimeric, Re-Targeted Fiber that Interacts with CD46 Attachment Receptor
[0113] As a base for engineering AVID-317 vector, we used known in the art vector Ad5-GFP that is based on human adenovirus serotype HAdv-C5 and that comprises a deletion in the E3 region of the virus genome but otherwise comprises wild type sequences for all open reading frames encoding viral capsid proteins. We used adenovirus cloning techniques known in the art and replaced an open reading frame encoding the wild type penton base protein of SEQ ID NO: 17 with an open reading frame of penton of SEQ ID NO:20, comprising SIKVAV amino acid motif (SEQ ID NO: 1) in place of the RGD loop as shown in
[0114] It is well established in the art that introduction of mutations in structural proteins of adenovirus and other gene transfer vectors can negatively affect the efficacy of cell infection by a mutated virus. To determine if adenovirus vector AVID-317, comprising mutations in penton and fiber, retains infectivity toward human cells, we infected human lung adenocarcinoma cell line A549 with Ad vector at various multiplicity of infection (MOIs) and analyzed cell transduction using flow cytometry methodology. Human lung adenocarcinoma A549 cells were seeded at a density of 1.510.sup.5 cells per well of the tissue-culture-treated 12 well plate one day prior to infection. 18-24 hours after seeding, cells were infected with AVID-317-CMV-GFP virus in DMEM+10% FBS media at MOIs ranging from 0.01 to 100 virus particles per cell. Percent of cells expressing GFP was analyzed 24 h later by flow cytometry using CytoFlex flow cytometer. The dose response curve of percent of GFP-positive cells versus virus dose was plotted and the EC50 dose was calculated using GraphPad Prism software. This analysis showed (
Example 2. Assembly and Analysis of the Therapeutic Platform Vector AVID-388, Comprising Mutated Penton Base Protein with Deletion of the RGD Motif and Comprising a Peptide Interacting with a6-Integrins, and Further Comprising Mutated, Chimeric, Re-Targeted Fiber that Interacts with DSG2 Attachment Receptor
[0115] As a base for engineering AVID-388 vector, we used known in the art vector Ad5-GFP that is based on human adenovirus serotype HAdv-C5 and that comprises a deletion in the E3 region of the virus genome but otherwise comprises wild type sequences for all open reading frames encoding viral capsid proteins. We used adenovirus cloning techniques known in the art and replaced an open reading frame encoding the wild-type penton base protein of SEQ ID NO: 17 with an open reading frame of penton of SEQ ID NO: 19, comprising SIKVAV amino acid motif (SEQ ID NO: 1) in place of the RGD loop as shown in
[0116] To determine if adenovirus vector AVID-388, comprising mutations in penton and a DSG2-interacting fiber, retains the infectivity toward human cells, we infected human lung adenocarcinoma cell line A549 with Ad vector at various multiplicity of infection (MOIs) and analyzed cell transduction using flow cytometry methodology. Human lung adenocarcinoma A549 cells were seeded at a density of 1.510.sup.5 cells per well of the tissue-culture-treated 12 well plate one day prior to infection. 18-24 hours after seeding, cells were infected with AVID-388-CMV-GFP virus in DMEM+10% FBS media at MOIs ranging from 0.01 to 100 virus particles per cell. Percent of cells expressing GFP was analyzed 24 h later by flow cytometry using CytoFlex flow cytometer. The dose response curve of percent of GFP-positive cells versus virus dose was plotted and the EC50 dose was calculated using GraphPad Prism software. This analysis showed (
Example 3. The Penton-Mutated CD46-Interacting and DSG2-Interacting Therapeutic Platform Vectors Trigger Significantly Reduced Production of Inflammatory Cytokines after Intravenous Administration, Compared to Unmodified Virus HAdv-B11
[0117] To analyze whether mutations introduced into novel AVID-317 and AVID-388 vectors may have adversely and unpredictably affected its safety after intravenous administration, as it was earlier reported in the art for Ad5: Ad48 vector with mutated hexon, we analyzed the amounts of inflammatory cytokines IL-6, TNF-, IL-1b and IFN-g in plasma of mice 6 hours after the intravenous vector administration. For this analysis, 10-14-week-old wild type C57BL6 mice, females, with an average weight of 20 g were used. Mice were administered intravenously with an injection buffer (Control group), human adenovirus of HAdv-B11 serotype with unmodified wild type capsid, or novel AVID-317 and AVID-388 vectors at a very high dose of 110.sup.11 virus particles per mouse. Virus samples were diluted in the injection buffer with the following composition: 150 mM NaCl, 10 mM Tris-HCL, pH 7.5. The injection buffer was prepared on the pharmaceutical-grade water for intravenous administration from reagents of the molecular biology-grade purity (>99.5%), filter-sterilized, and stored at +4 C. until use.
[0118] Mice were administered in groups of 2 (Control group), or >3 per experimental setting. Blood was collected through retro-orbital bleeding, and heparinized plasma was immediately prepared and stored at 80 C until subsequent analyzes were performed. The analysis of cytokine concentrations in plasma was perform using Bio-Rad Bio-Plex Pro Mouse Cytokine 23-Plex #M60009RDPD in accordance with manufacturer's instructions using 25 ml of plasma sample for each mouse. The results of tests of inflammatory cytokine concentrations in mouse plasma after administration of these viruses at a single dose of 110.sup.11 per mouse in 200 ml of injection buffer are shown in
[0119] This analysis demonstrated that the intravenous administration of the very high doses of AVID-317 and A VID-388 vectors of the invention, comprising mutated pentons and fibers, triggered release of significantly lower amounts of inflammatory cytokines in plasma, compared to HAdv-B11 virus with unmodified capsid.
Example 4. CD46-Interacting Adenovirus Vectors are Cytotoxic to Human CD33-Positive Myeloid Cell Populations in Peripheral Blood
[0120] In clinical settings, intravenous injection will inevitably lead to exposure of circulating blood cells to the viral vectors. We sought to analyze whether and to what extent the engineered AVID-317 and AVID-388 vectors may reduce viability of mononuclear cell populations in human blood. To that end, we first infected primary human peripheral blood mononuclear cells (PBMCs) with a known in the art Ad5/35 vector, comprising mutated CD46-interacting fiber but comprising unmodified penton, and novel vectors of the invention, AVID-317 and AVID-388 vectors, at an MOI of 5000 v.p./cell. Infection of primary human blood mononuclear cells with these vectors led to a dramatic reduction and a near complete disappearance of CD33+ myeloid cells within 24 hours after cell infection with Ad5/35 and AVID-317 vectors comprising CD46-interacting fibers (
Example 5. DSG2-Interacting a VID-388 Virus, Comprising Mutated Penton Base Protein, Efficiently Infects Primitive Human CD34+ Hematopoietic Cells In Vitro
[0121] To determine whether capsid-mutated DSG2-interacting AVID-388-CMV-GFP vector is able to infect primary human CD34.sup.+ cells, we infected human CD34.sup.+ cells, isolated from mobilized peripheral blood-derived (supplied by Lonza), with AVID-388-CMV-GFP virus at an MOI of 5000 v.g. per cell in IMDM+15% FBS media, and percent of GFP-expressing cells was analyzed 48 h later by flow cytometry. Prior to analyzing the proportion of GFP-expressing cells, cells were stained with fluorescent APC-labeled anti-CD34 and PE-labeled anti-CD38 antibodies to allow for specific gating on total CD34.sup.+ cells as well as on the more primitive CD34-positive/CD38-negative cells (CD34.sup.+CD38.sup. cells). This analysis showed that 48 hours after the addition of the virus to cells, the proportion of CD34.sup.+ cells that expressed GFP reporter gene was 28.5% (
Example 6. DSG2-Interacting a VID-388-CMV-GFP Virus, Comprising Mutated Penton Base Protein, Efficiently Infects Primitive Human CD34+ Hematopoietic Cells In Vivo
[0122] For in vivo gene transfer analyses, we chose the commercially available humanized CD34.sup.+ hu-NSG mouse model, grafted with primary human CD34.sup.+ cells isolated from cord blood (Jackson Laboratories). Mice were conditioned with human G-CSF for 5 days to expand the HSPC compartment prior to AVID-388-CMV-GFP administration and were mobilized with AMD3100 three hours prior to virus administration. Mice were also conditioned with dexamethasone to further suppress the innate immune activation that inevitably occurs following intravenous administration of viral vectors. Forty-eight hours after intravenous administration of AVID-388-CMV-GFP or Buffer (control group), mice were sacrificed, and bone marrow was harvested for flow cytometry analyses. Due to the extreme paucity of HSPCs, harvested bone marrow was pooled from 3 to 7 mice per group prior to CD34.sup.+ cell enrichment, staining with antibodies to different cell markers, and flow cytometry analysis of distribution of GFP.sup.+ cells among various BM cell populations. The experiment was repeated 3 times.
[0123] Analysis of the efficacy of in vivo gene delivery to human CD34.sup.+ cells in mouse bone marrow demonstrated that 1.370.18% of total human CD34.sup.+ cells in the bone marrow expressed GFP 48 h after intravenous administration of A VID-388-CMV-GFP (
[0124] It is known in the art that long-term multilineage engraftment can be achieved by serial transplantation of primitive CD34.sup.+CD38.sup.CD45RA.sup. cells that express CD49f (also known as 6-integrin) with or without CD90 expression. Because the penton within AVID-388 was engineered to utilize CD49f (
Example 7. Capsid-Mutated a VID-388 Vector, Comprising DSG2-Interacting Fiber Knob Domain and Mutated Penton Base Protein, Exhibits Potent Anti-Tumor Activity after Intravenous Administration
[0125] Next, we tested the anti-tumor potency of the DSG2-interacting AVID-388 vector platform in a pre-clinical model of localized cancer. Human lung adenocarcinoma A549 cells were grafted subcutaneously to NSG mice (NOD.Cg-Prkdcscid Il2rgtm1Wjl/SzJ; Jackson Laboratories strain #005557) at 510.sup.6 cells per site and, when tumor size reached about 125 mm.sup.3, mice were intravenously administered with three injections of replication-competent AVID-388, comprising adenovirus death protein in the E3 region, at a dose of 410.sup.10 v.p./mouse at 48-hour intervals or Buffer (Control group). The tumor growth kinetics were monitored for up to 90 days post virus administration. Mice were sacrificed when tumor volume reached 2000 mm.sup.3. This analysis demonstrated that intravenous administration of AVID-388 could efficiently suppress tumor growth (
Example 8. The Use of AVID-317 Therapeutic Platform for Treatment of Localized and Disseminated Cancer
[0126] Next, we utilized a replication-competent AVID-317 vector that comprises fiber that interacts with CD46 attachment receptor and further comprises mutated penton, to analyze the anti-tumor potency of this vector platform in pre-clinical models of localized and disseminated cancer using intravenous route of virus delivery. For these studies, the replication competent AVID-317 vector comprised adenovirus death protein in the E3 region of the virus.
[0127] For pre-clinical localized cancer model, we utilized NSG mice (NOD.Cg-Prkdcscid Il2rgtm1Wjl/SzJ; Jackson Laboratories strain #005557) with subcutaneously grafted human lung adenocarcinoma A549 cells. A549 cells were grafted at 510.sup.6 cells per site and, when tumor size reached about 125 mm.sup.3, mice were intravenously administered with three injections of AVID-317 at a dose of 410.sup.10 v.p./mouse at 48-hour intervals or Buffer (Control group). The tumor growth kinetics were monitored for up to 90 days post virus administration. Mice were sacrificed when tumor volume reached 2000 mm.sup.3. This analysis demonstrated that while all tumor-bearing mice treated with buffer succumbed to tumor growth and had to be sacrificed within 40 days after the beginning of treatment, all tumor-bearing mice that were treated with AVID-317 virus survived for the duration of the study (
[0128] For disseminated lung cancer model, we utilized NCr-Nude mice (supplied by Taconic) that were grafted with human lung adenocarcinoma A549-Luc-C5 cells intravenously. Ten-to twelve-week-old female NCr-Nude mice were intravenously injected with 2.510.sup.6 A549-luc-C5 cells, which express firefly luciferase under the control of NF-kB-responsive promoter. Tumor burden in the lung was monitored using non-invasive IVIS imaging that measured relative luciferase unit (RLU) luminescence of tumor cells starting week 5 post tumor grafting. Eight to ten weeks after tumor transplantation, when the tumor burden reached a luminescence signal from 2 to 810.sup.6 RLU, mice were enrolled into treatment experiment and randomized between AVID-317-treated and Buffer-treated (Control) cohorts. In virus-treated cohort, mice were administered intravenously with three injections of AVID-317 at a dose of 510.sup.10 v.p./mouse at 48-hour intervals. In Buffer-treated cohorts, mice were administered with buffer with the same schedule of administration. The luminescence of tumors was monitored weekly for the up to 105 days, and mice were sacrificed when they experienced a 20% weight loss against their weight prior to virus treatment. The log-rank survival plot of the data obtained from this experiment is shown in
Example 9. Generation of Novel Therapeutic Ad Vectors with Desired Multiplexed Receptor Specificities
[0129] Using methodologies established in the art, one of the ordinary skills in the art can now construct novel Ad vectors with desired and restricted receptor specificities and targeted to specific human cell types by replacing artificial peptides interacting with a6-integrins within penton base proteins of AVID-317 or AVID-388 vectors, as shown in Examples 1 and 2, with peptides interacting with a4-, a9, or aD-integrin classes. Using methods established in the art, one of the ordinary skills in the art can replace the penton base open reading frame in the adenovirus vector genome for an open reading frame of a penton base protein, comprising peptide interacting with a4-integrins classes (SEQ ID NO:21) as shown in
[0130] The above description is for the purpose of teaching the person of ordinary skill in the art how to practice the object of the present application, and it is not intended to detail all those obvious modifications and variations of it which will become apparent to the skilled worker upon reading the description. It is intended, however, that all such obvious modifications and variations be included within the scope of the present application, which is defined by the following claims. The aspects and embodiments are intended to cover the components and steps in any sequence, which is effective to meet the objectives there intended, unless the context specifically indicates the contrary. The appendixes which are hereby incorporated by reference as if fully set forth herein.
Sequences Cited in the Specification
TABLE-US-00001 SEQIDNO:1 Organism:Humanlaminin-1-derivedpeptide SIKVAV SEQIDNO:2 Organism:Humanadenovirustype5fiberACCESSIONNO:AP_000226 MKRARPSEDTFNPVYPYDTETGPPTVPFLTPPFVSPNGFQESPPGVLSLRLSEPLVTSNG MLALKMGNGLSLDEAGNLTSQNVTTVSPPLKKTKSNINLEISAPLTVTSEALTVAAAAPL MVAGNTLTMQSQAPLTVHDSKLSIATQGPLTVSEGKLALQTSGPLTTTDSSTLTITASPP LTTATGSLGIDLKEPIYTQNGKLGLKYGAPLHVTDDLNTLTVATGPGVTINNTSLQTKVT GALGFDSQGNMQLNVAGGLRIDSQNRRLILDVSYPFDAQNQLNLRLGQGPLFINSAHNLD INYNKGLYLFTASNNSKKLEVNLSTAKGLMFDATAIAINAGDGLEFGSPNAPNTNPLKTK IGHGLEFDSNKAMVPKLGTGLSFDSTGAITVGNKNNDKLTLWTTPAPSPNCRLNAEKDAK LTLVLTKCGSQILATVSVLAVKGSLAPISGTVQSAHLIIRFDENGVLLNNSFLDPEYWNF RNGDLTEGTAYTNAVGFMPNLSAYPKSHGKTAKSNIVSQVYLNGDKTKPVTLTITLNGTQ ETGDTTPSAYSMSFSWDWSGHNYINEIFATSSYTFSYIAQE SEQIDNO:3 Organism:Humanadenovirustype11fiberACCESSIONNO:AAA42490 MTKRVRLSDSFNPVYPYEDESTSQHPFINPGFISPNGFTQSPNGVLTLKCLTPLTTTGGS LQLKVGGGLTVDDTNGFLKENISATTPLVKTGHSIGLPLGAGLGTNENKLCIKLGQGLTF NSNNICIDDNINTLWTGVNPTEANCQIMNSSESNDCKLILTLVKTGALVTAFVYVIGVSN NFNMLTTHRNINFTAELFFDSTGNLLTRLSSLKTPLNHKSGQNMATGAITNAKGFMPSTT AYPFNDNSREKENYIYGTCYYTASDRTAFPIDISVMLNRRAINDETSYCIRITWSWNTGD APEVQTSATTLVTSPFTFYYIREDD SEQIDNO:4 Organism:Humanadenovirustype16fiberACCESSIONNO:AET87329 MAKRARLSSSFNPVYPYEDESSSQHPFINPGFISSNGFAQSPDGVLTLKCVNPLTTASGP LQLKVGSSLTVDTIDGSLEENITAAAPLTKTNHSIGLSIGSGLQTKDDELCLSLGDGLVT KDDKLCLSLGDGLITKDDTLCAKLGHGLVFDSSNAITIENNTLWTGAKPSANCVIQEGED SPDCKLTLVLVKNGGLINGYITLMGASQYTNTLFKNKQVTINVNLAFDNTGQIITYLSSL KSNLNFKDNQNMATGTITSAKGFMPSTTAYPFTIYATQSLNEDYIYGECYYKSTNGTLFP LKVTVTLNRRMSASGMAYAMNFSWSLNAEQAPETTEVTLITSPFFFSYIREDD SEQIDNO:5 Organism:Humanadenovirustype21fiberACCESSIONNO:AAW33370 MTKRVRLSDSFNPVYPYEDESTSQHPFINPGFISPNGFTQSPDGVLTLNCLTPLTTTGGP LQLKVGGGLIVDDTDGTLQENIRATAPITKNNHSVELSIGNGLETQNNKLCAKLGNGLKF NNGDICIKDSINTLWTGIKPPPNCQIVENTDTNDGKLTLVLVKNGGLVNGYVSLVGVSDT VNQMFTQKSATIQLRLYFDSSGNLLTDESNLKIPLKNKSSTATSEAATSSKAFMPSTTAY PFNTTTRDSENYIHGICYYMTSYDRSLVPLNISIMLNSRTISSNVAYAIQFEWNLNAKES PESNIATLTTSPFFFSYIREDDN SEQIDNO:6 Organism:Humanadenovirustype34fiberACCESSIONNO:AAW33501 MTKRVRLSDSFNPVYPYEDESTSQHPFINPGFISPNGFTQSPDGVLTLKCLTPLTTTGGS LQLKVGGGLTVDDTDGTLQENIRATAPITKNNHSVELSIGNGLETQNNKLCAKLGNGLKF NNGDICIKDSINTLWTGINPPPNCQIVENTNTNDGKLTLVLVKNGGLVNGYVSLVGVSDT VNQMFTQKTANIQLRLYFDSSGNLLTDESDLKIPLKNKSSTATSETVASSKAFMPSTTAY PENTTTRDSENYIHGICYYMTSYDRSLFPLNISIMLNSRMISSNVAYAIQFEWNLNASES PESNIATLTTSPFFFSYITEDDN SEQIDNO:7 Organism:Humanadenovirustype35fiberACCESSIONNO:AP_000601 MTKRVRLSDSFNPVYPYEDESTSQHPFINPGFISPNGFTQSPDGVLTLKCLTPLTTTGGS LQLKVGGGLTVDDTDGTLQENIRATAPITKNNHSVELSIGNGLETQNNKLCAKLGNGLKF NNGDICIKDSINTLWTGINPPPNCQIVENTNTNDGKLTLVLVKNGGLVNGYVSLVGVSDT VNQMFTQKTANIQLRLYFDSSGNLLTEESDLKIPLKNKSSTATSETVASSKAFMPSTTAY PFNTTTRDSENYIHGICYYMTSYDRSLFPLNISIMLNSRMISSNVAYAIQFEWNLNASES PESNIATLTTSPFFFSYITEDDN SEQIDNO:8 Organism:Humanadenovirustype50fiberACCESSIONNO:AAW33547 MTKRVRLSDSFNPVYPYEDESTSQHPFINPGFISPNGFTQSPDGVLTLNCLTPLTTTGGP LQLKVGGGLIVDDTDGTLQENIRVTAPITKNNHSVELSIGNGLETQNNKLCAKLGNGLKF NNGDICIKDSINTLWTGIKPPPNCQIVENTDTNDGKLTLVLVKNGGLVNGYVSLVGVSDT VNQMFTQKSATIQLRLYFDSSGNLLTDESNLKIPLKNKSSTATSEAATSSKAFMPSTTAY PFNTTTRDSENYIHGICYYMTSYDRSLVPLNISIMLNSRTISSNVAYAIQFEWNLNAKES PESNIATLTTSPFFFSYIREDDN SEQIDNO:9 Organism:Humanadenovirustype3fiberACCESSIONNO:ABB17809 MAKRARLSTSFNPVYPYEDESSSQHPFINPGFISPDGFTQSPNGVLSLKCVNPLTTASGS LQLKVGSGLTVDTTDGSLEENIKVNTPLTKSNHSINLPIGNGLQIEQNKLCSKLGNGLTF DSSNSIALKNNTLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNGYVTLMGASDYV NTLFKNKNVSINVELYFDATGHILPDSSSLKTDLELKYKQTADFSARGFMPSTTAYPFVL PNAGTHNENYIFGQCYYKASDGALFPLEVTVMLNKRLPDSRTSYVMTFLWSLNAGLAPET TQATLITSPFTFSYIREDD SEQIDNO:10 Organism:Humanadenovirustype7fiberACCESSIONNO:QEQ50315 MTKRVRLSDSFNPVYPYEDESTSQHPFINPGFISPNGFTQSPDGVLTLKCLTPLTTTGGS LQLKVGGGLTIDDTDGFLKENISATTPLVKTGHSIGLSLGPGLETNENKLCAKLGEGLTF NSNNICINDNINTLWTGVNPTRANCQIMASSESNDCKLILTLVKTGALVTAFVYVIGVSN DFNMLTTHKNINFTAELFFDSTGNLLTSLSSLKTPLNHKSGQNMATGALTNAKGFMPSTT AYPFNVNSREKENYIYGTCYYTASDHTAFPIDTSVMLNQRALNNETSYCIRVTWSWNTGV APEVQTSATTLVTSPFTFYYIREDD SEQIDNO:11 Organism:Humanadenovirustype14fiberACCESSIONNO:ACO81814 MTKRVRLSDSFNPVYPYEDESTSQHPFINPGFISPNGFTQSPDGVLTLKCLTPLTTTGGS LQLKVGGGLTVDDTDGTLQENIGATTPLVKTGHSIGLSLGAGLGTDENKLCTKLGEGLTF NSNNICIDDNINTLWTGVNPTEANCQMMDSSESNDCKLILTLVKTGALVTAFVYVIGVSN NFNMLTTYRNINFTAELFFDSAGNLLTSLSSLKTPLNHKSGQNMATGAITNAKSFMPSTT AYPFNNNSRENYIYGTCHYTASDHTAFPIDISVMLNQRAIRADTSYCIRITWSWNTGDAP EGQTSATTLVTSPFTFYYIREDD SEQIDNO:12 Organism:Humanadenovirustype55fiberACCESSIONNO:AQY04135 MTKRVRLSDSFNPVYPYEDESTSQHPFINPGFISPNGFTQSPDGVLTLKCLTPLTTTGGS LQLKVGGGLTVDDTDGTLQENIGTTTPLVKTGHSIGLSLGAGLGTDENKLCTKLGKGLTF NSNNICIDDNINTLWTGINPTEANCQMMDSSESNDCKLILTLVKTGALVTAFVYVIGVSN NFNMLTTYRNINFTAELFFDSAGNLLTSLSSLKTPLNHKSGQNMATGAITNAKSFMPSTT AYPFNNNSREKENYIYGTCHYTASDHTAFPIDISVMLNQRAIRADTSYCIRITWSWNTGD APEGQTSATTLVTSPFTFYYIREDD SEQIDNO:13 Organism:Ad5/35fiber,chimericartificial MKRARPSEDTFNPVYPYDTETGPPTVPFLTPPFVSPNGFQESPPGVLSLRLADPVTTKNG EITLKLGEGVDLDDSGKLIANTVNKAIAPLSFSNNTISLNMDTPLYTKDGKLSLQVSPPLS ILKSTILNTLALAFGSGLGLSGSALAVQLASPLTFDDKGNIKITLNRGLHVTTGDAIESNIS WAKGIKFEDGAIATNIGKGLEFGTSSTETGVNNAYPIQVKLGSGLSFDSTGAIMAGNKD YDKLTLWTGINPPPNCQIVENTNTNDGKLTLVLVKNGGLVNGYVSLVGVSDTVNQMFT QKTANIQLRLYFDSSGNLLTDESDLKIPLKNKSSTATSETVASSKAFMPSTTAYPFNTTTR DSENYIHGICYYMTSYDRSLFPLNISIMLNSRMISSNVAYAIQFEWNLNASESPESNIATLT TSPFFFSYITEDDN SEQIDNO:14 Organism:Ad5/14fiber,chimericartificial Organism:Fibermutant;Artificial MKRARPSEDTFNPVYPYDTETGPPTVPFLTPPFVSPNGFQESPPGVLSLRLADPVTTKNG EITLKLGEGVDLDDSGKLIANTVNKAIAPLSFSNNTISLNMDTPLYTKDGKLSLQVSPPLS ILKSTILNTLALAFGSGLGLSGSALAVQLASPLTFDDKGNIKITLNRGLHVTTGDAIESNIS WAKGIKFEDGAIATNIGKGLEFGTSSTETGVNNAYPIQVKLGSGLSFDSTGAIMAGNKD YDKLTLWTGVNPTEANCQMMDSSESNDCKLILTLVKTGALVTAFVYVIGVSNNFNMLT TYRNINFTAELFFDSAGNLLTSLSSLKTPLNHKSGQNMATGAITNAKSFMPSTTAYPFSN NSREKENYIYGTCHYTASDHTAFPIDISVMLNQRAIRADTSYCIRITWSWNTGDAPEGQT SATTLVTSPFTFYYIREDD SEQIDNO:15 Organism:RGDpeptide,artificial RGD SEQIDNO:16 Organism:Humanadenovirustype5pentonbaseRGDloopsequence,partial(FIG.7A) DHAIRGDTFAT SEQIDNO:17 Organism:Humanadenovirustype5pentonACCESSIONNO:AAA42519 MRRAAMYEEGPPPSYESVVSAAPVAAALGSPFDAPLDPPFVPPRYLRPTG GRNSIRYSELAPLFDTTRVYLVDNKSTDVASLNYQNDHSNFLTTVIQNND YSPGEASTQTINLDDRSHWGGDLKTILHTNMPNVNEFMFTNKFKARVMVS RLPTKDNQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNG VLESDIGVKFDTRNFRLGFDPVTGLVMPGVYTNEAFHPDIILLPGCGVDF THSRLSNLLGIRKRQPFQEGFRITYDDLEGGNIPALLDVDAYQASLKDDT EQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEE KRAEAEAAAEAAAPAAQPEVEKPQKKPVIKPLTEDSKKRSYNLISNDSTF TQYRSWYLAYNYGDPQTGIRSWTLLCTPDVTCGSEQVYWSLPDMMQDPVT FRSTRQISNFPVVGAELLPVHSKSFYNDQAVYSQLIRQFTSLTHVFNRFP ENQILARPPAPTITTVSENVPALTDHGTLPLRNSIGGVQRVTITDARRRT CPYVYKALGIVSPRVLSSRTF SEQIDNO:18 Organism:Humanlaminin-1-derivedpeptide,artificial(FIG.8A) AASIKVAVSAA SEQIDNO:19 Organism:Pentonmutant;Artificial(FIG.8B) MRRAAMYEEGPPPSYESVVSAAPVAAALGSPFDAPLDPPFVPPRYLRPTGGRNSIRYSEL APLFDTTRVYLVDNKSTDVASLNYQNDHSNFLTTVIQNNDYSPGEASTQTINLDDRSHW GGDLKTILHTNMPNVNEFMFTNKFKARVMVSRLPTKDNQVELKYEWVEFTLPEGNYSE TMTIDLMNNAIVEHYLKVGRQNGVLESDIGVKFDTRNFRLGFDPVTGLVMPGVYTNEA FHPDIILLPGCGVDFTHSRLSNLLGIRKRQPFQEGFRITYDDLEGGNIPALLDVDAYQASL KDDAASIKVAVSAAKKPVIKPLTEDSKKRSYNLISNDSTFTQYRSWYLAYNYGDPQTGI RSWTLLCTPDVTCGSEQVYWSLPDMMQDPVTFRSTRQISNFPVVGAELLPVHSKSFYND QAVYSQLIRQFTSLTHVFNRFPENQILARPPAPTITTVSENVPALTDHGTLPLRNSIGGVQ RVTITDARRRTCPYVYKALGIVSPRVLSSRTF SEQIDNO:20 Organism:Pentonmutant;Artificial MRRAAMYEEGPPPSYESVVSAAPVAAALGSPFDAPLDPPFVPPRYLRPTG GRNSIRYSELAPLFDTTRVYLVDNKSTDVASLNYQNDHSNFLTTVIQNND YSPGEASTQTINLDDRSHWGGDLKTILHTNMPNVNEFMFTNKFKARVMVS RLPTKDNQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNG VLESDIGVKFDTRNFRLGFDPVTGLVMPGVYTNEAFHPDIILLPGCGVDF THSRLSNLLGIRKRQPFQEGFRITYDDLEGGNIPALLDVTAYQASLK ETAASIKVAVSAAKKPVIKPLTEDSKKRSYNLISNDSTFTQYRSWYLAY NYGDPQTGIRSWTLLCTPDVTCGSEQVYWSLPDMMQDPVTFRSTRQISNF PVVGAELLPVHSKSFYNDQAVYSQLIRQFTSLTHVFNRFPENQILARPPA PTITTVSENVPALTDHGTLPLRNSIGGVQRVTITDARRRTCPYVYKALGI VSPRVLSSRTF SEQIDNO:21 Organism:Alpha4-integrin-interactingpeptide,artificial(FIG.9A) AAEILDVPSTAA SEQIDNO:22 Organism:Pentonmutant;Artificial(FIG.9B) MRRAAMYEEGPPPSYESVVSAAPVAAALGSPFDAPLDPPFVPPRYLRPTGGRNSIRYSEL APLFDTTRVYLVDNKSTDVASLNYQNDHSNFLTTVIQNNDYSPGEASTQTINLDDRSHW GGDLKTILHTNMPNVNEFMFTNKFKARVMVSRLPTKDNQVELKYEWVEFTLPEGNYSE TMTIDLMNNAIVEHYLKVGRQNGVLESDIGVKFDTRNFRLGFDPVTGLVMPGVYTNEA FHPDIILLPGCGVDFTHSRLSNLLGIRKRQPFQEGFRITYDDLEGGNIPALLDVDAYQASL KDDAAEILDVPSTAAKKPVIKPLTEDSKKRSYNLISNDSTFTQYRSWYLAYNYGDPQTGI RSWTLLCTPDVTCGSEQVYWSLPDMMQDPVTFRSTRQISNFPVVGAELLPVHSKSFYND QAVYSQLIRQFTSLTHVFNRFPENQILARPPAPTITTVSENVPALTDHGTLPLRNSIGGVQ RVTITDARRRTCPYVYKALGIVSPRVLSSRTF SEQIDNO:23 Organism:Alpha9-integrin-interactingpeptide,artificial(FIG.10A) AAAEIDGIELAA SEQIDNO:24 Organism:Pentonmutant;Artificial(FIG.10B) MRRAAMYEEGPPPSYESVVSAAPVAAALGSPFDAPLDPPFVPPRYLRPTGGRNSIRYSEL APLFDTTRVYLVDNKSTDVASLNYQNDHSNFLTTVIQNNDYSPGEASTQTINLDDRSHW GGDLKTILHTNMPNVNEFMFTNKFKARVMVSRLPTKDNQVELKYEWVEFTLPEGNYSE TMTIDLMNNAIVEHYLKVGRQNGVLESDIGVKFDTRNFRLGFDPVTGLVMPGVYTNEA FHPDIILLPGCGVDFTHSRLSNLLGIRKRQPFQEGFRITYDDLEGGNIPALLDVDAYQASL KDDAAAEIDGIELAAKKPVIKPLTEDSKKRSYNLISNDSTFTQYRSWYLAYNYGDPQTGI RSWTLLCTPDVTCGSEQVYWSLPDMMQDPVTFRSTRQISNFPVVGAELLPVHSKSFYND QAVYSQLIRQFTSLTHVFNRFPENQILARPPAPTITTVSENVPALTDHGTLPLRNSIGGVQ RVTITDARRRTCPYVYKALGIVSPRVLSSRTF SEQIDNO:25 Organism:AlphaD-integrin-interactingpeptide,artificial(FIG.11A) AATQIDSPLNAA SEQIDNO:26 Organism:Pentonmutant;Artificial(FIG.11B) MRRAAMYEEGPPPSYESVVSAAPVAAALGSPFDAPLDPPFVPPRYLRPTGGRNSIRYSEL APLFDTTRVYLVDNKSTDVASLNYQNDHSNFLTTVIQNNDYSPGEASTQTINLDDRSHW GGDLKTILHTNMPNVNEFMFTNKFKARVMVSRLPTKDNQVELKYEWVEFTLPEGNYSE TMTIDLMNNAIVEHYLKVGRQNGVLESDIGVKFDTRNFRLGFDPVTGLVMPGVYTNEA FHPDIILLPGCGVDFTHSRLSNLLGIRKRQPFQEGFRITYDDLEGGNIPALLDVDAYQASL KDDAATQIDSPLNAAKKPVIKPLTEDSKKRSYNLISNDSTFTQYRSWYLAYNYGDPQTGI RSWTLLCTPDVTCGSEQVYWSLPDMMQDPVTFRSTRQISNFPVVGAELLPVHSKSFYND QAVYSQLIRQFTSLTHVFNRFPENQILARPPAPTITTVSENVPALTDHGTLPLRNSIGGVQ RVTITDARRRTCPYVYKALGIVSPRVLSSRTF SEQIDNO:27 Organism:Shaftdomainofthefiberprotein,derivedfromhumanadenovirusserotype HAdv-E4. LSLRLADPVTTKNGEITLKLGEGVDLDDSGKLIANTVNKAIAPLSFSNNTISLNMDTPLYT KDGKLSLQVSPPLSILKSTILNTLALAFGSGLGLSGSALAVQLASPLTFDDKGNIKITLNR GLHVTTGDAIESNISWAKGIKFEDGAIATNIGKGLEFGTSSTETGVNNAYPIQVKLGSGLS FDSTGAIMAGNKDYDKLTL SEQIDNO:28 Organism:Alpha-4-integrin-interactingpeptide,humanfibronectin-derived EILDVPST SEQIDNO:29 Organism:Alpha-9-integrin-interactingpeptide,artificial AEIDGIEL SEQIDNO:30 Organism:Alpha-D-integrin-interactingpeptide,artificial TQIDSPLN