Genetic modification of cytokine inducible SH2-containing protein (CISH) gene

11661611 · 2023-05-30

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure is in the field of genome engineering, particularly targeted genetic modification of a CISH gene.

Claims

1. A genetically modified eukaryotic cell comprising a genomic modification within exon 2 or exon 3 of an endogenous Cytokine Inducible SH2-containing protein (CISH) gene wherein the CISH gene is modified within exon 2 or exon 3 by one or more insertions, deletions, or combinations thereof following cleavage by a zinc finger nuclease, wherein the zinc finger nuclease comprises a zinc finger protein comprising 6 zinc finger domains each comprising a recognition helix region designated SBS #59488, SBS #59489, SBS #59440, SBS #59441, SBS #59558, SBS #59557, SBS #59581 or SBS #59580, wherein the recognition helix regions F1 to F6 are in the order of F1 to F6 as shown in a single row of the table below: TABLE-US-00005 Design SBS # F1 F2 F3 59488 RSDHLSQ QNATRTK RSDNLSE (SEQ ID (SEQ ID (SEQ ID NO: 2) NO: 3) NO: 4) 59489 GHTSLKR TSGHLSR RSDNLAR (SEQ ID (SEQ ID (SEQ ID NO: 8) NO: 9) NO: 10) 59440 RWQYLPT DRSALAR RSDNLAR (SEQ ID (SEQ ID (SEQ ID NO: 13) NO: 14) NO: 10) 59441 RSDDLTR QAATLSR RSDHLSA (SEQ ID (SEQ ID (SEQ ID NO: 18) NO: 19) NO: 20) 59558 QSGDLTR QSGNLHV QSGHLAR (SEQ ID (SEQ ID (SEQ ID NO: 23) NO: 24) NO: 25) 59557 QSSHLTR QSSDLTR QSGNLAR (SEQ ID (SEQ ID (SEQ ID NO: 29) NO: 30) NO: 16) 59581 DRSNLSR LRQDLKR RSDNLST (SEQ ID (SEQ ID (SEQ ID NO: 34) NO: 35) NO: 32) 59580 RSDSLLR CREYRGK QSGHLAR (SEQ ID (SEQ ID (SEQ ID NO: 27) NO: 28) NO: 25) Design SBS # F4 F5 F6 59488 KRCNLRC DRSTRTK RRDNLHS (SEQ ID (SEQ ID (SEQ ID NO: 5) NO: 6) NO: 7) 59489 QNVSRPR TSGHLSR QSGHLSR (SEQ ID (SEQ ID (SEQ ID NO: 11) NO: 9) NO: 12) 59440 DRSNLTR QSGNLAR ATCGLAH (SEQ ID (SEQ ID (SEQ ID NO: 15) NO: 16) NO: 17) 59441 DRSDLSR RSDDLTR DRSHLAR (SEQ ID (SEQ ID (SEQ ID NO: 21) NO: 18) NO: 22) 59558 NRYDLMT RSDSLLR CREYRGK (SEQ ID (SEQ ID (SEQ ID NO: 26) NO: 27) NO: 28) 59557 RLDILQQ RSDNLST DNSYLPR (SEQ ID (SEQ ID (SEQ ID NO: 31) NO: 32) NO: 33) 59581 DNSNRIN QSSDLSR WKWNLRA (SEQ ID (SEQ ID (SEQ ID NO: 36) NO: 37) NO: 38) 59580 QKGTLGE RSDNLST QSGHLSR (SEQ ID (SEQ ID (SEQ ID NO: 39) NO: 32) NO: 12).

2. The genetically modified eukaryotic cell of claim 1, wherein one or more transgenes is/are integrated into the CISH gene.

3. The genetically modified eukaryotic cell of claim 2, wherein the transgene encodes a chimeric antigen receptor (CAR), an immunomodulating factor, an engineered or exogenous T cell receptor (TCR).

4. The genetically modified eukaryotic cell of claim 3, wherein the engineered TCR is an antibody-coupled T-cell receptors (ACTR).

5. The genetically modified eukaryotic cell of claim 1, wherein the zinc finger nuclease comprises a DNA-binding domain that binds to a target site as shown below: TABLE-US-00006 SBS # Target site 59488 5' ggAAGGCCcCAGCAGGCAAGGgctgcat (SEQ ID NO: 40) 59489 5' gaGGAGGTgGCAGAGGGTACCccagccc (SEQ ID NO: 41) 59440 5' ccAGCAAAgGACGAGGTCTAGaaggcag (SEQ ID NO: 42) 59441 5' gtGGAGCGGACTGGGCAGCGgcccctgt (SEQ ID NO: 43) 59558 5' gaTGCGTGgCCTGGACAAGCAgttggag (SEQ ID NO: 44) 59557 5' gaGTCCAGACGGAAGCTGGAgtcggcat (SEQ ID NO: 45) 59581 5' atAGTGCTgCACAAGGCTGACcacatcc (SEQ ID NO: 46) 59580 5' ccGGAAAGgCCAGGATGCGTGgcctgga (SEQ ID NO: 47).

6. The genetically modified eukaryotic cell of claim 1 or a cell descended therefrom, wherein the cell is selected from the group consisting of a hematopoietic stem cell, a T effector cell and a T regulatory cell.

7. A method of generating a genetically modified eukaryotic cell according to claim 1, the method comprising introducing, into the cell, one or more polynucleotides encoding one or more zinc finger nuclease comprising a DNA-binding domain that binds to target site in exon 2 or exon 3 of the CISH gene, wherein the zinc finger nuclease comprises a zinc finger protein comprising 6 zinc finger domains each comprising a recognition helix region, wherein the zinc finger protein comprises the recognition helix regions designated SBS #59488, SBS #59489, SBS #59440, SBS #59441, SBS #59558, SBS #59557, SBS #59581 or SBS #59580, wherein the recognition helix regions F1 to F6 are in the order of F1 to F6 as shown in a single row of the table below: TABLE-US-00007 Design SBS # Fl F2 F3 59488 RSDHLSQ QNATRTK RSDNLSE (SEQ ID (SEQ ID (SEQ ID NO: 2) NO: 3) NO: 4) 59489 GHTSLKR TSGHLSR RSDNLAR (SEQ ID (SEQ ID (SEQ ID NO: 8) NO: 9) NO: 10) 59440 RWQYLPT DRSALAR RSDNLAR (SEQ ID (SEQ ID (SEQ ID NO: 13) NO: 14) NO: 10) 59441 RSDDLTR QAATLSR RSDHLSA (SEQ ID (SEQ ID (SEQ ID NO: 18) NO: 19) NO: 20) 59558 QSGDLTR QSGNLHV QSGHLAR (SEQ ID (SEQ ID (SEQ ID NO: 23) NO: 24) NO: 25) 59557 QSSHLTR QSSDLTR QSGNLAR (SEQ ID (SEQ ID (SEQ ID NO: 29) NO: 30) NO: 16) 59581 DRSNLSR LRQDLKR RSDNLST (SEQ ID (SEQ ID (SEQ ID NO: 34) NO: 35) NO: 32) 59580 RSDSLLR CREYRGK QSGHLAR (SEQ ID (SEQ ID (SEQ ID NO: 27) NO: 28) NO: 25) Design SBS # F4 F5 F6 59488 KRCNLRC DRSTRTK RRDNLHS (SEQ ID (SEQ ID (SEQ ID NO: 5) NO: 6) NO: 7) 59489 QNVSRPR TSGHLSR QSGHLSR (SEQ ID (SEQ ID (SEQ ID NO: 11) NO: 9) NO: 12) 59440 DRSNLTR QSGNLAR ATCGLAH (SEQ ID (SEQ ID (SEQ ID NO: 15) NO: 16) NO: 17) 59441 DRSDLSR RSDDLTR DRSHLAR (SEQ ID (SEQ ID (SEQ ID NO: 21) NO: 18) NO: 22) 59558 NRYDLMT RSDSLLR CREYRGK (SEQ ID (SEQ ID (SEQ ID NO: 26) NO: 27) NO: 28) 59557 RLDILQQ RSDNLST DNSYLPR (SEQ ID (SEQ ID (SEQ ID NO: 31) NO: 32) NO: 33) 59581 DNSNRIN QSSDLSR WKWNLRA (SEQ ID (SEQ ID (SEQ ID NO: 36) NO: 37) NO: 38) 59580 QKGTLGE RSDNLST QSGHLSR (SEQ ID (SEQ ID (SEQ ID NO: 39) NO: 32) NO: 12) and wherein the nuclease bind to and cleave the CISH gene, thereby genetically modifying the cell.

8. The method of claim 7, wherein the genetically modified eukaryotic cell comprises a transgene that is integrated into the CISH gene and expressed in the cell.

9. A method of providing a protein to a subject in need thereof, the method comprising administering a genetically modified eukaryotic cell according to claim 2 wherein the cell expresses the transgene in the subject.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows partial sequence including exons 2 and 3 (shaded) of a CISH gene (SEQ ID NO:48) and also shows exemplary nuclease target sites (boxed) in the gene. FIG. 1 also discloses SEQ ID NO: 50.

(2) FIGS. 2A through 2D show FACS analysis of T cells subject to treatment under the indicated conditions. FIG. 2A (“Mock”) shows results where cells were not treated with the nuclease reagents but otherwise treated in the same way as the other cells. FIG. 2B (“AAV only”) shows results where cells received the AAV-GFP donor only. FIG. 2C (“ZFNs only”) shows results where cells received only the CISH-targeted nucleases (administered as mRNA); and FIG. 2D (“ZFNs+AAV”) shows results where cells were subject to treatment with both the AAV-GFP donor and the CISH-targeted ZFNs. As shown, at least 75% of cells treated with the nucleases and donor expressed GFP as compared to all other treatment conditions in which little (AAV only) or no (mock and ZFNs only) GFP was expressed.

(3) FIG. 3 show FACS analysis of effector T cells subject to treatment under the indicated conditions. “Donor alone” refers to cells which received the AAV-hPGK-GFP donor only and “ZFNs+Donor” refer to cells subject to treatment with both the AAV-hPGK-GFP donor and the CISH-targeted ZFNs. As shown, —72.6% of cells treated with the nucleases and donor expressed GFP as compared to the cells treated with AAV donor alone which did not express any GFP.

(4) FIG. 4 is a graph showing results of Miseq genotype analysis of effector T cells subject to treatment under the indicated conditions. “Mock” refers to cells that were not treated with the nuclease reagents but otherwise treated in the same way as the other cells; “PGK-GFP Donor” refers to cells which received the AAV-hPGK-GFP donor only; “ZFNs” refer to cells to which only the CISH-targeted nucleases were administered as mRNA; and “ZFNs+PGK-GFP Donor” refer to cells subject to treatment with both the AAV-hPGK-GFP donor and the CISH-targeted ZFNs. As shown, ˜90% of alleles are modified in cells treated with the nucleases (ZFNs and ZFNs+Donor), whereas only cells treated with both the AAV donor and ZFNs yielded high levels (˜45%) of targeted integration (TI) of the donor. The group treated with AAV donor alone or Mock had no detectable levels of genome modification.

(5) FIG. 5 is a graph showing Miseq genotype analysis of effector T cells subject to treatment under the indicated conditions. “Mock” refers to cells that were not treated with the nuclease reagents but otherwise treated in the same way as the other cells and “ZFNs+Donor” refers to cells subject to treatment with either AAVS1 or CISH-targeted ZFNs along with a corresponding AAV-GFP donor. As shown, ˜50-60% of alleles are modified in cells treated with the nucleases (ZFNs+Donor), whereas the Mock group had no detectable levels of genome modification.

(6) FIG. 6 is a graph showing effector T cell functional data as assessed by immunostimulatory cytokine secretion via Luminex analysis. “ZFNs+Donor” refers to cells subject to treatment with either AAVS1 or CISH-targeted ZFNs along with a corresponding AAV-GFP donor. As shown TI of a transgene donor into CISH results in increased immunostimulatory function (i.e. TNFα upregulation) of the effector T cells as compared with TI into the genomic safe harbor locus AAVS1, presumably due to knockout of CISH expression in a large fraction of cells.

DETAILED DESCRIPTION

(7) Disclosed herein are compositions and methods for targeted modification of a CISH gene, including modification via integration of a transgene protein (e.g., CAR, TCR, ACTR, and/or any other therapeutic protein) transgene into a CISH gene of cell (e.g., T-cells or lymphocyte precursors such as CD34+ hematopoietic stem cells). The methods and compositions may be used for the modification of a T effector cell (CD4+ or CD8+) and T regulatory cells (CD4+,CD25+,CD127lo, FOXP3+). The cells are suitable for infusion into patients such that subsequent in vivo differentiation of these precursors into cells expressing the functional proteins in the subject with a cancer, inflammatory disorder, autoimmune disease or transplant is provided by the cell, which cells can treat and/or prevent disease in the recipient patient. Genetically modified cells as described herein (e.g., indels and/or transgenes in the CISH gene) are suitable for infusion into patients such that subsequent in vivo differentiation of these stem cells into cells that express the functional CISH protein treat and/or prevent disease (e.g., cancer, inflammatory disorders, etc.) in the patient. In addition, cells as described herein (populations of cells or cell lines) can be used in vitro to produce cells, cell lines or animal models for screening and/or to produce proteins from the integrated transgene, which protein can be isolated and used to treat a subject.

(8) The invention contemplates any genetic modification to a CISH gene, including but not limited to integration of a donor comprising sequence encoding any functional protein, including proteins that treat and/or prevent cancer, inflammatory disorders, autoimmune disease or transplant, or serve as a receptor to redirect a T cell.

(9) General

(10) Practice of the methods, as well as preparation and use of the compositions disclosed herein employ, unless otherwise indicated, conventional techniques in molecular biology, biochemistry, chromatin structure and analysis, computational chemistry, cell culture, recombinant DNA and related fields as are within the skill of the art. These techniques are fully explained in the literature. See, for example, Sambrook, et al., MOLECULAR CLONING: A LABORATORY MANUAL, Second edition, Cold Spring Harbor Laboratory Press, 1989 and Third edition, 2001; Ausubel, et al., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, 1987 and periodic updates; the series METHODS IN ENZYMOLOGY, Academic Press, San Diego; Wolfe, CHROMATIN STRUCTURE AND FUNCTION, Third edition, Academic Press, San Diego, 1998; METHODS IN ENZYMOLOGY, Vol. 304, “Chromatin” (P. M. Wassarman and A. P. Wolffe, eds.), Academic Press, San Diego, 1999; and METHODS IN MOLECULAR BIOLOGY, Vol. 119, “Chromatin Protocols” (P. B. Becker, ed.) Humana Press, Totowa, 1999.

Definitions

(11) The terms “nucleic acid,” “polynucleotide,” and “oligonucleotide” are used interchangeably and refer to a deoxyribonucleotide or ribonucleotide polymer, in linear or circular conformation, and in either single- or double-stranded form. For the purposes of the present disclosure, these terms are not to be construed as limiting with respect to the length of a polymer. The terms can encompass known analogues of natural nucleotides, as well as nucleotides that are modified in the base, sugar and/or phosphate moieties (e.g., phosphorothioate backbones). In general, an analogue of a particular nucleotide has the same base-pairing specificity; i.e., an analogue of A will base-pair with T.

(12) The terms “polypeptide,” “peptide” and “protein” are used interchangeably to refer to a polymer of amino acid residues. The term also applies to amino acid polymers in which one or more amino acids are chemical analogues or modified derivatives of a corresponding naturally-occurring amino acids.

(13) “Binding” refers to a sequence-specific, non-covalent interaction between macromolecules (e.g., between a protein and a nucleic acid). Not all components of a binding interaction need be sequence-specific (e.g., contacts with phosphate residues in a DNA backbone), as long as the interaction as a whole is sequence-specific. Such interactions are generally characterized by a dissociation constant (K.sub.d) of 10.sup.−6 M.sup.−1 or lower. “Affinity” refers to the strength of binding: increased binding affinity being correlated with a lower K.sub.d.

(14) A “binding domain” is a molecule that is able to bind non-covalently to another molecule. A binding molecule can bind to, for example, a DNA molecule (a DNA-binding protein such as a zinc finger protein or TAL-effector domain protein or a single guide RNA), an RNA molecule (an RNA-binding protein) and/or a protein molecule (a protein-binding protein). In the case of a protein-binding molecule, it can bind to itself (to form homodimers, homotrimers, etc.) and/or it can bind to one or more molecules of a different protein or proteins. A binding molecule can have more than one type of binding activity. For example, zinc finger proteins have DNA-binding, RNA-binding and protein-binding activity. Thus, DNA-binding molecules, including DNA-binding components of artificial nucleases and transcription factors include but are not limited to, ZFPs, TALEs and sgRNAs.

(15) A “zinc finger DNA binding protein” (or binding domain) is a protein, or a domain within a larger protein, that binds DNA in a sequence-specific manner through one or more zinc fingers, which are regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion. The term zinc finger DNA binding protein is often abbreviated as zinc finger protein or ZFP. Artificial nucleases and transcription factors can include a ZFP DNA-binding domain and a functional domain (nuclease domain for a ZFN or transcriptional regulatory domain for ZFP-TF). The term “zinc finger nuclease” includes one ZFN as well as a pair of ZFNs (the members of the pair are referred to as “left and right” or “first and second” or “pair”) that dimerize to cleave the target gene.

(16) A “TALE DNA binding domain” or “TALE” is a polypeptide comprising one or more TALE repeat domains/units. The repeat domains are involved in binding of the TALE to its cognate target DNA sequence. A single “repeat unit” (also referred to as a “repeat”) is typically 33-35 amino acids in length and exhibits at least some sequence homology with other TALE repeat sequences within a naturally occurring TALE protein. See, e.g., U.S. Pat. Nos. 8,586,526 and 9,458,205. Artificial nucleases and transcription factors can include a TALE DNA-binding domain and a functional domain (nuclease domain for a TALEN or transcriptional regulatory domain for TALEN-TF). The term “TALEN” includes one TALEN as well as a pair of TALENs (the members of the pair are referred to as “left and right” or “first and second” or “pair”) that dimerize to cleave the target gene.

(17) Zinc finger and TALE binding domains can be “engineered” to bind to a predetermined nucleotide sequence, for example via engineering (altering one or more amino acids) of the recognition helix region of a naturally occurring zinc finger or TALE protein. Therefore, engineered DNA binding proteins (zinc fingers or TALEs) are proteins that are non-naturally occurring. Non-limiting examples of methods for engineering DNA-binding proteins are design and selection. A designed DNA binding protein is a protein not occurring in nature whose design/composition results principally from rational criteria. Rational criteria for design include application of substitution rules and computerized algorithms for processing information in a database storing information of existing ZFP and/or TALE designs and binding data. See, for example, U.S. Pat. Nos. 6,140,081; 6,453,242; 6,534,261; and 8,585,526; see also International Patent Publication Nos. WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536; and WO 03/016496.

(18) A “selected” zinc finger protein or TALE is a protein not found in nature whose production results primarily from an empirical process such as phage display, interaction trap or hybrid selection. See e.g., U.S. Pat. Nos. 5,789,538; 5,925,523; 6,007,988; 6,013,453; 6,200,759; 8,586,526; and International Patent Publication Nos. WO 95/19431; WO 96/06166; WO 98/53057; WO 98/54311; WO 00/27878; WO 01/60970; WO 01/88197; and WO 02/099084.

(19) “TtAgo” is a prokaryotic Argonaute protein thought to be involved in gene silencing. TtAgo is derived from the bacteria Thermus thermophilus. See, e.g., Swarts, et al., ibid, G. Sheng, et al. (2013) Proc. Natl. Acad. Sci. U.S.A. 111, 652. A “TtAgo system” is all the components required including, for example, guide DNAs for cleavage by a TtAgo enzyme.

(20) “Recombination” refers to a process of exchange of genetic information between two polynucleotides, including but not limited to, donor capture by non-homologous end joining (NHEJ) and homologous recombination. For the purposes of this disclosure, “homologous recombination (HR)” refers to the specialized form of such exchange that takes place, for example, during repair of double-strand breaks in cells via homology-directed repair mechanisms. This process requires nucleotide sequence homology, uses a “donor” molecule to template repair of a “target” molecule (i.e., the one that experienced the double-strand break), and is variously known as “non-crossover gene conversion” or “short tract gene conversion,” because it leads to the transfer of genetic information from the donor to the target. Without wishing to be bound by any particular theory, such transfer can involve mismatch correction of heteroduplex DNA that forms between the broken target and the donor, and/or “synthesis-dependent strand annealing,” in which the donor is used to resynthesize genetic information that will become part of the target, and/or related processes. Such specialized HR often results in an alteration of the sequence of the target molecule such that part or all of the sequence of the donor polynucleotide is incorporated into the target polynucleotide.

(21) In the methods of the disclosure, one or more targeted nucleases as described herein create a double-stranded break (DSB) in the target sequence (e.g., cellular chromatin) at a predetermined site. The DSB may result in deletions and/or insertions by homology-directed repair or by non-homology-directed repair mechanisms. Deletions may include any number of base pairs. Similarly, insertions may include any number of base pairs including, for example, integration of a “donor” polynucleotide, optionally having homology to the nucleotide sequence in the region of the break. The donor sequence may be physically integrated or, alternatively, the donor polynucleotide is used as a template for repair of the break via homologous recombination, resulting in the introduction of all or part of the nucleotide sequence as in the donor into the cellular chromatin. Thus, a first sequence in cellular chromatin can be altered and, in certain embodiments, can be converted into a sequence present in a donor polynucleotide. Thus, the use of the terms “replace” or “replacement” can be understood to represent replacement of one nucleotide sequence by another, (i.e., replacement of a sequence in the informational sense), and does not necessarily require physical or chemical replacement of one polynucleotide by another.

(22) In any of the methods described herein, additional pairs of zinc-finger proteins, TALENs, TtAgo or CRISPR/Cas systems can be used for additional double-stranded cleavage of additional target sites within the cell.

(23) Any of the methods described herein can be used for insertion of a donor of any size and/or partial or complete inactivation of one or more target sequences in a cell by targeted integration of donor sequence that disrupts expression of the gene(s) of interest. Cell lines with partially or completely inactivated genes are also provided.

(24) In any of the methods described herein, the exogenous nucleotide sequence (the “donor sequence” or “transgene”) can contain sequences that are homologous, but not identical, to genomic sequences in the region of interest, thereby stimulating homologous recombination to insert a non-identical sequence in the region of interest. Thus, in certain embodiments, portions of the donor sequence that are homologous to sequences in the region of interest exhibit between about 80 to 99% (or any integer therebetween) sequence identity to the genomic sequence that is replaced. In other embodiments, the homology between the donor and genomic sequence is higher than 99%, for example if only 1 nucleotide differs as between donor and genomic sequences of over 100 contiguous base pairs. In certain cases, a non-homologous portion of the donor sequence can contain sequences not present in the region of interest, such that new sequences are introduced into the region of interest. In these instances, the non-homologous sequence is generally flanked by sequences of 50-1,000 base pairs (or any integral value therebetween) or any number of base pairs greater than 1,000, that are homologous or identical to sequences in the region of interest. In other embodiments, the donor sequence is non-homologous to the first sequence, and is inserted into the genome by non-homologous recombination mechanisms.

(25) “Cleavage” refers to the breakage of the covalent backbone of a DNA molecule. Cleavage can be initiated by a variety of methods including, but not limited to, enzymatic or chemical hydrolysis of a phosphodiester bond. Both single-stranded cleavage and double-stranded cleavage are possible, and double-stranded cleavage can occur as a result of two distinct single-stranded cleavage events. DNA cleavage can result in the production of either blunt ends or staggered ends. In certain embodiments, fusion polypeptides are used for targeted double-stranded DNA cleavage.

(26) A “cleavage half-domain” is a polypeptide sequence which, in conjunction with a second polypeptide (either identical or different) forms a complex having cleavage activity (preferably double-strand cleavage activity). The terms “first and second cleavage half-domains;” “+ and − cleavage half-domains” and “right and left cleavage half-domains” are used interchangeably to refer to pairs of cleavage half-domains that dimerize.

(27) An “engineered cleavage half-domain” is a cleavage half-domain that has been modified so as to form obligate heterodimers with another cleavage half-domain (e.g., another engineered cleavage half-domain). See, also, U.S. Pat. Nos. 8,623,618; 7,888,121; 7,914,796; and 8,034,598, incorporated herein by reference in their entireties.

(28) The term “sequence” refers to a nucleotide sequence of any length, which can be DNA or RNA; can be linear, circular or branched and can be either single-stranded or double stranded. The term “donor sequence” refers to a nucleotide sequence that is inserted into a genome. A donor sequence can be of any length, for example between 2 and 100,000,000 nucleotides in length (or any integer value therebetween or thereabove), preferably between about 100 and 100,000 nucleotides in length (or any integer therebetween), more preferably between about 2000 and 20,000 nucleotides in length (or any value therebetween) and even more preferable, between about 5 and 15 kb (or any value therebetween).

(29) “Chromatin” is the nucleoprotein structure comprising the cellular genome. Cellular chromatin comprises nucleic acid, primarily DNA, and protein, including histones and non-histone chromosomal proteins. The majority of eukaryotic cellular chromatin exists in the form of nucleosomes, wherein a nucleosome core comprises approximately 150 base pairs of DNA associated with an octamer comprising two each of histones H2A, H2B, H3 and H4; and linker DNA (of variable length depending on the organism) extends between nucleosome cores. A molecule of histone H1 is generally associated with the linker DNA. For the purposes of the present disclosure, the term “chromatin” is meant to encompass all types of cellular nucleoprotein, both prokaryotic and eukaryotic. Cellular chromatin includes both chromosomal and episomal chromatin.

(30) A “chromosome,” is a chromatin complex comprising all or a portion of the genome of a cell. The genome of a cell is often characterized by its karyotype, which is the collection of all the chromosomes that comprise the genome of the cell. The genome of a cell can comprise one or more chromosomes.

(31) An “episome” is a replicating nucleic acid, nucleoprotein complex or other structure comprising a nucleic acid that is not part of the chromosomal karyotype of a cell. Examples of episomes include plasmids and certain viral genomes.

(32) An “accessible region” is a site in cellular chromatin in which a target site present in the nucleic acid can be bound by an exogenous molecule which recognizes the target site. Without wishing to be bound by any particular theory, it is believed that an accessible region is one that is not packaged into a nucleosomal structure. The distinct structure of an accessible region can often be detected by its sensitivity to chemical and enzymatic probes, for example, nucleases.

(33) A “target site” or “target sequence” is a nucleic acid sequence that defines a portion of a nucleic acid to which a binding molecule will bind, provided sufficient conditions for binding exist. Target sites may be any length, for example, 9 to 20 or more nucleotides and length and the bound nucleotides may be contiguous or non-contiguous.

(34) An “exogenous” molecule is a molecule that is not normally present in a cell, but can be introduced into a cell by one or more genetic, biochemical or other methods. “Normal presence in the cell” is determined with respect to the particular developmental stage and environmental conditions of the cell. Thus, for example, a molecule that is present only during embryonic development of muscle is an exogenous molecule with respect to an adult muscle cell. Similarly, a molecule induced by heat shock is an exogenous molecule with respect to a non-heat-shocked cell. An exogenous molecule can comprise, for example, a functioning version of a malfunctioning endogenous molecule or a malfunctioning version of a normally-functioning endogenous molecule.

(35) An exogenous molecule can be, among other things, a small molecule, such as is generated by a combinatorial chemistry process, or a macromolecule such as a protein, nucleic acid, carbohydrate, lipid, glycoprotein, lipoprotein, polysaccharide, any modified derivative of the above molecules, or any complex comprising one or more of the above molecules. Nucleic acids include DNA and RNA, can be single- or double-stranded; can be linear, branched or circular; and can be of any length. Nucleic acids include those capable of forming duplexes, as well as triplex-forming nucleic acids. See, for example, U.S. Pat. Nos. 5,176,996 and 5,422,251. Proteins include, but are not limited to, DNA-binding proteins, transcription factors, chromatin remodeling factors, methylated DNA binding proteins, polymerases, methylases, demethylases, acetylases, deacetylases, kinases, phosphatases, integrases, recombinases, ligases, topoisomerases, gyrases and helicases.

(36) An exogenous molecule can be the same type of molecule as an endogenous molecule, e.g., an exogenous protein or nucleic acid. For example, an exogenous nucleic acid can comprise an infecting viral genome, a plasmid or episome introduced into a cell, or a chromosome that is not normally present in the cell. Methods for the introduction of exogenous molecules into cells are known to those of skill in the art and include, but are not limited to, lipid-mediated transfer (i.e., liposomes, including neutral and cationic lipids), electroporation, direct injection, cell fusion, particle bombardment, calcium phosphate co-precipitation, DEAE-dextran-mediated transfer and viral vector-mediated transfer. An exogenous molecule can also be the same type of molecule as an endogenous molecule but derived from a different species than the cell is derived from. For example, a human nucleic acid sequence may be introduced into a cell line originally derived from a mouse or hamster.

(37) By contrast, an “endogenous” molecule is one that is normally present in a particular cell at a particular developmental stage under particular environmental conditions. For example, an endogenous nucleic acid can comprise a chromosome, the genome of a mitochondrion, chloroplast or other organelle, or a naturally-occurring episomal nucleic acid. Additional endogenous molecules can include proteins, for example, transcription factors and enzymes.

(38) As used herein, the term “product of an exogenous nucleic acid” includes both polynucleotide and polypeptide products, for example, transcription products (polynucleotides such as RNA) and translation products (polypeptides).

(39) A “fusion” molecule is a molecule in which two or more subunit molecules are linked, preferably covalently. The subunit molecules can be the same chemical type of molecule, or can be different chemical types of molecules. Examples of the first type of fusion molecule include, but are not limited to, fusion proteins (for example, a fusion between a ZFP or TALE DNA-binding domain and one or more activation domains) and fusion nucleic acids (for example, a nucleic acid encoding the fusion protein described supra). Examples of the second type of fusion molecule include, but are not limited to, a fusion between a triplex-forming nucleic acid and a polypeptide, and a fusion between a minor groove binder and a nucleic acid.

(40) Expression of a fusion protein in a cell can result from delivery of the fusion protein to the cell or by delivery of a polynucleotide encoding the fusion protein to a cell, wherein the polynucleotide is transcribed, and the transcript is translated, to generate the fusion protein. Trans-splicing, polypeptide cleavage and polypeptide ligation can also be involved in expression of a protein in a cell. Methods for polynucleotide and polypeptide delivery to cells are presented elsewhere in this disclosure.

(41) A “gene,” for the purposes of the present disclosure, includes a DNA region encoding a gene product (see infra), as well as all DNA regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. Accordingly, a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions.

(42) “Gene expression” refers to the conversion of the information, contained in a gene, into a gene product. A gene product can be the direct transcriptional product of a gene (e.g., mRNA, tRNA, rRNA, antisense RNA, ribozyme, structural RNA or any other type of RNA) or a protein produced by translation of an mRNA. Gene products also include RNAs which are modified, by processes such as capping, polyadenylation, methylation, and editing, and proteins modified by, for example, methylation, acetylation, phosphorylation, ubiquitination, ADP-ribosylation, myristilation, and glycosylation.

(43) “Modulation” of gene expression refers to a change in the activity of a gene. Modulation of expression can include, but is not limited to, gene activation and gene repression. Genome editing (e.g., cleavage, alteration, inactivation, random mutation) can be used to modulate expression. Gene inactivation refers to any reduction in gene expression as compared to a cell that does not include a ZFP, TALE, TtAgo or CRISPR/Cas system as described herein. Thus, gene inactivation may be partial or complete.

(44) A “region of interest” is any region of cellular chromatin, such as, for example, a gene or a non-coding sequence within or adjacent to a gene, in which it is desirable to bind an exogenous molecule. Binding can be for the purposes of targeted DNA cleavage and/or targeted recombination. A region of interest can be present in a chromosome, an episome, an organellar genome (e.g., mitochondrial, chloroplast), or an infecting viral genome, for example. A region of interest can be within the coding region of a gene, within transcribed non-coding regions such as, for example, leader sequences, trailer sequences or introns, or within non-transcribed regions, either upstream or downstream of the coding region. A region of interest can be as small as a single nucleotide pair or up to 2,000 nucleotide pairs in length, or any integral value of nucleotide pairs.

(45) “Eukaryotic” cells include, but are not limited to, fungal cells (such as yeast), plant cells, animal cells, mammalian cells and human cells (e.g., T-cells), including stem cells (pluripotent and multipotent).

(46) A “T effector cell” (Teff) is a CD4+ or CD8+ T cell that acts immediately to a stimulus. These cells play a central role in cellular-mediated immunity following differentiation. T cells are activated following stimulation by an antigen presenting cell and differentiate into T effector cells that perform critical effector functions such as producing cytotoxic molecules and antibodies. T effector cells migrate to the site of inflammation (e.g. infection) and produce chemokines to recruit additional immune cells.

(47) A “regulatory T cell” (Treg) is also known as a suppressor T cell, and is a subpopulation of T cells that modulate the immune system, maintain tolerance to self-antigens and prevent autoimmune disease. Tregs are immunosuppressive and generally suppress or downregulate induction and proliferation of T effector cells. Tregs are CD4+, CD25+, CD12710 and FOXP3+.

(48) The term “autologous” refers to any material derived from the same individual to whom it is later to be re-introduced.

(49) The term “allogeneic” refers to any material derived from a different individual of the same specie as the individual to whom the material is introduced. Two or more individuals are said to be allogeneic to one another when the genes at one or more loci are not identical. In some aspects, allogeneic material from individuals of the same species may be sufficiently unlike genetically to interact antigenically.

(50) The terms “operative linkage” and “operatively linked” (or “operably linked”) are used interchangeably with reference to a juxtaposition of two or more components (such as sequence elements), in which the components are arranged such that both components function normally and allow the possibility that at least one of the components can mediate a function that is exerted upon at least one of the other components. By way of illustration, a transcriptional regulatory sequence, such as a promoter, is operatively linked to a coding sequence if the transcriptional regulatory sequence controls the level of transcription of the coding sequence in response to the presence or absence of one or more transcriptional regulatory factors. A transcriptional regulatory sequence is generally operatively linked in cis with a coding sequence, but need not be directly adjacent to it. For example, an enhancer is a transcriptional regulatory sequence that is operatively linked to a coding sequence, even though they are not contiguous.

(51) With respect to fusion polypeptides, the term “operatively linked” can refer to the fact that each of the components performs the same function in linkage to the other component as it would if it were not so linked. For example, with respect to a fusion polypeptide in which a ZFP, TALE, TtAgo or Cas DNA-binding domain is fused to an activation domain, the ZFP, TALE, TtAgo or Cas DNA-binding domain and the activation domain are in operative linkage if, in the fusion polypeptide, the ZFP, TALE, TtAgo or Cas DNA-binding domain portion is able to bind its target site and/or its binding site, while the activation domain is able to upregulate gene expression. When a fusion polypeptide in which a ZFP, TALE, TtAgo or Cas DNA-binding domain is fused to a cleavage domain, the ZFP, TALE, TtAgo or Cas DNA-binding domain and the cleavage domain are in operative linkage if, in the fusion polypeptide, the ZFP, TALE, TtAgo or Cas DNA-binding domain portion is able to bind its target site and/or its binding site, while the cleavage domain is able to cleave DNA in the vicinity of the target site.

(52) A “functional fragment” of a protein, polypeptide or nucleic acid is a protein, polypeptide or nucleic acid whose sequence is not identical to the full-length protein, polypeptide or nucleic acid, yet retains the same function as the full-length protein, polypeptide or nucleic acid. A functional fragment can possess more, fewer, or the same number of residues as the corresponding native molecule, and/or can contain one or more amino acid or nucleotide substitutions. Methods for determining the function of a nucleic acid (e.g., coding function, ability to hybridize to another nucleic acid) are well-known in the art. Similarly, methods for determining protein function are well-known. For example, the DNA-binding function of a polypeptide can be determined, for example, by filter-binding, electrophoretic mobility-shift, or immunoprecipitation assays. DNA cleavage can be assayed by gel electrophoresis. See Ausubel, et al., supra. The ability of a protein to interact with another protein can be determined, for example, by co-immunoprecipitation, two-hybrid assays or complementation, both genetic and biochemical. See, for example, Fields, et al. (1989) Nature 340:245-246; U.S. Pat. No. 5,585,245 and International Patent Publication No. WO 98/44350.

(53) A “vector” is capable of transferring gene sequences to target cells. Typically, “vector construct,” “expression vector,” and “gene transfer vector,” mean any nucleic acid construct capable of directing the expression of a gene of interest and which can transfer gene sequences to target cells. Thus, the term includes cloning, and expression vehicles, as well as integrating vectors.

(54) The terms “subject” and “patient” are used interchangeably and refer to mammals such as human patients and non-human primates, as well as experimental animals such as rabbits, dogs, cats, rats, mice, and other animals. Accordingly, the term “subject” or “patient” as used herein means any mammalian patient or subject to which the nucleases, donors and/or genetically modified cells of the invention can be administered. Subjects of the present invention include those with a disorder.

(55) An “autoimmune disease” is a disease where the immune system is attacking auto-antigens. Examples of an autoimmune disease include discoid lupus erythematosus/lupus erythematosus profundus/chilblain lupus erythematosus/tumidus lupus erythematosus nephropathy, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with discoid lupus erythematosus/lupus erythematosus profundus/chilblain lupus erythematosus/tumidus lupus erythematosus nephropathy. Examples of autoantigens associated with discoid lupus erythematosus/lupus erythematosus profundus/chilblain lupus erythematosus/tumidus lupus erythematosus nephropathy include, but are not limited to, ANA.

(56) In one embodiment, the autoimmune disease is Hashimoto's disease, and the chimeric receptor comprises an autoantigen associated with Hashimoto's disease. Examples of autoantigens associated with Hashimoto's disease include, but are not limited to, thyroid peroxidase, and thyroglobulin.

(57) In one embodiment, the autoimmune disease is NMDAR encephalitis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with NMDAR encephalitis. Examples of autoantigens associated with NMDAR encephalitis include, but are not limited to, anti-N-methyl-D-aspartate receptor (NR1 subunit).

(58) In one embodiment, the autoimmune disease is autoimmune hemolytic anemia, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with autoimmune hemolytic anemia. Examples of autoantigens associated with autoimmune hemolytic anemia include, but are not limited to, Rh blood group antigens, and I antigen.

(59) In one embodiment, the autoimmune disease is pemphigus vulgaris, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with pemphigus vulgaris. Examples of autoantigens associated with pemphigus vulgaris include, but are not limited to, Dsgl/3.

(60) In one embodiment, the autoimmune disease is bullous pemphigoid, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with bullous pemphigoid. Examples of autoantigens associated with bullous pemphigoid include, but are not limited to, BP 180, and BP230.

(61) In one embodiment, the autoimmune disease is Myasthenia Gravis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with Myasthenia Gravis. Examples of autoantigens associated with myasthenia gravis include, but are not limited to, acetylcholine nicotinic postsynaptic receptors.

(62) In one embodiment, the autoimmune disease is Graves' disease, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with Graves' disease. Examples of autoantigens associated with Graves' disease include but are not limited to, thyrotropin receptors.

(63) In one embodiment, the autoimmune disease is idiopathic thrombocytopenic purpura (ITP), and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with idiopathic thrombocytopenic purpura (ITP). Examples of autoantigens associated with idiopathic thrombocytopenic purpura include, but are not limited to, Platelet integrin, and GpIIb:IIIa.

(64) In one embodiment, the autoimmune disease is Goodpasture's syndrome, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with Goodpasture's syndrome. Examples of autoantigens associated with Goodpasture's syndrome include, but are not limited to, Collagen alpha-3 (IV) chain.

(65) In one embodiment, the autoimmune disease is rheumatoid arthritis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with rheumatoid arthritis. Examples of autoantigens associated with rheumatoid arthritis include, but are not limited to, Rheumatoid factor, and calpastatin.

(66) In one embodiment, the autoimmune disease is juvenile idiopathic arthritis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with juvenile idiopathic arthritis. Examples of autoantigens associated with juvenile idiopathic arthritis include, but are not limited to, RF, citrullinated proteins.

(67) In one embodiment, the autoimmune disease is multiple sclerosis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with multiple sclerosis. Examples of autoantigens associated with multiple sclerosis include, but are not limited to, Myelin basic protein (MBP), Myelin oligodendrocyte glycoprotein (MOG) peptides, and alpha-beta-crystallin.

(68) In one embodiment, the autoimmune disease is celiac disease, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with celiac disease. Examples of autoantigens associated with celiac disease include, but are not limited to, tissue transglutaminase (TG2).

(69) In one embodiment, the autoimmune disease is pernicious anemia, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with pernicious anemia. Examples of autoantigens associated with pernicious anemia include, but are not limited to, intrinsic factor of gastric parietal cells.

(70) In one embodiment, the autoimmune disease is vitiligo, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with vitiligo. Examples of autoantigens associated with vitiligo include, but are not limited to, 65-kDa antigen.

(71) In one embodiment, the autoimmune disease is Behcet's disease, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with Behcet's disease. Examples of autoantigens associated with Behcet's disease include, but are not limited to, phosphatidylserine, ribosomal phosphoproteins, and anti-neutrophil cytoplasmic antibody.

(72) In one embodiment, the autoimmune disease is scleroderma, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with scleroderma. Examples of autoantigens associated with scleroderma include, but are not limited to, Scl-70, U1-RNP.

(73) In one embodiment, the autoimmune disease is psoriasis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with psoriasis. Examples of autoantigens associated with psoriasis include, but are not limited to, calpastatin.

(74) In one embodiment, the autoimmune disease is ulcerative colitis (UC) and Crohn's disease, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with UC and Crohn's disease. Examples of autoantigens associated with UC and Crohn's disease include, but are not limited to, ANA.

(75) In one embodiment, the autoimmune disease is Sjogren's syndrome, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with Sjogren's syndrome. Examples of autoantigens associated with Sjogren's syndrome include, but are not limited to, SSA and anti-SSB.

(76) In one embodiment, the autoimmune disease is Wegener's granulomatosis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with Wegener's granulomatosis. Examples of autoantigens associated with Wegener's granulomatosis include, but are not limited to, ANA, and ANCA.

(77) In one embodiment, the autoimmune disease is polymyositis or dermatomyositis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with polymyositis or dermatomyositis. Examples of autoantigens associated with polymyositis or dermatomyositis include, but are not limited to, Jo-1.

(78) In one embodiment, the autoimmune disease is primary biliary cirrhosis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with primary biliary cirrhosis. Examples of autoantigens associated with primary biliary cirrhosis include, but are not limited to, anti-mitochondrial antibodies, gp210, p62, sp 100.

(79) In one embodiment, the autoimmune disease is antiphospholipid syndrome (APS), and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with antiphospholipid syndrome. Examples of autoantigens associated with antiphospholipid syndrome include, but are not limited to, anti-phospholipid antibodies.

(80) In one embodiment, the autoimmune disease is mixed connective tissue disease (MCTD), and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with mixed connective tissue disease. Examples of autoantigens associated with mixed connective tissue disease include, but are not limited to, Ul-RNP, Ul-70 kd snRNP.

(81) In one embodiment, the autoimmune disease is Miller Fisher syndrome, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with Miller Fisher syndrome. Examples of autoantigens associated with Miller Fisher syndrome include, but are not limited to, GQlb ganglioside.

(82) In one embodiment, the autoimmune disease is Guillain-Barre syndrome, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with Guillain-Barre syndrome. Examples of autoantigens associated with Guillain-Barre syndrome include, but are not limited to, GM1, asialo GM1, and GDlb.

(83) In one embodiment, the autoimmune disease is acute motor axonal neuropathy, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with acute motor axonal neuropathy. Examples of autoantigens associated with acute motor axonal neuropathy include, but are not limited to, GM1.

(84) In one embodiment, the autoimmune disease is autoimmune hepatitis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with autoimmune hepatitis. Examples of autoantigens associated with autoimmune hepatitis include, but are not limited to, antinuclear antibodies (ANA) and anti-smooth muscle antibodies (ASMA), anti-liver-kidney microsome-1 antibodies (ALKM-1) and anti-liver cytosol antibody-1 (ALC-1).

(85) In one embodiment, the autoimmune disease is dermatitis herpetiformis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with dermatitis herpetiformis. Examples of autoantigens associated with dermatitis herpetiformis include, but are not limited to, IgA anti-endomysial antibodies.

(86) In one embodiment, the autoimmune disease is Churg-Strauss syndrome, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with Churg-Strauss syndrome. Examples of autoantigens associated with Churg-Strauss syndrome include, but are not limited to, anti-neutrophil cytoplasm antibodies (ANCAs).

(87) In one embodiment, the autoimmune disease is microscopic polyangiitis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with microscopic polyangiitis. Examples of autoantigens associated with microscopic polyangiitis include, but are not limited to, ANCAs.

(88) In one embodiment, the autoimmune disease is ANCA vasculitis, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with ANCA vasculitis. Examples of autoantigens associated with ANCA vasculitis include, but are not limited to, neutrophil granule proteins.

(89) In one embodiment, the autoimmune disease is acute rheumatic fever, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with acute rheumatic fever. Examples of autoantigens associated with acute rheumatic fever include, but are not limited to, streptococcal cell wall antigen.

(90) In one embodiment, the autoimmune disease is type 1 Diabetes (TID), and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with TID. Examples of autoantigens associated with TID include, but are not limited to, insulin (IAA), glutamic acid decarboxylase (GAA or GAD) and protein tyrosine phosphatase (IA2 or ICA512).

(91) In one embodiment, the autoimmune disease is membranous nephropathy, and the chimeric receptor comprises an autoantigen (or a variant or fragment thereof) associated with membranous nephropathy. Examples of autoantigens associated with membranous nephropathy include, but are not limited to, PLA2R1 and THSD7A1.

(92) “Sternness” refers to the relative ability of any cell to act in a stem cell-like manner, i.e., the degree of toti-, pluri-, or oligopotentcy and expanded or indefinite self-renewal that any particular stem cell may have. An “ACTR” is an Antibody-coupled T-cell Receptors that is an engineered T cell component capable of binding to an exogenously supplied antibody. The binding of the antibody to the ACTR component arms the T cell to interact with the antigen recognized by the antibody, and when that antigen is encountered, the ACTR comprising T cell is triggered to interact with antigen (see U.S. Patent Publication No. 2015/0139943).

(93) Fusion Molecules

(94) Described herein are compositions, for example nucleases, that are useful for cleavage of a selected target gene (e.g., CISH) in a cell. In certain embodiments, one or more components of the fusion molecules (e.g., nucleases) are naturally occurring. In other embodiments, one or more of the components of the fusion molecules (e.g., nucleases) are non-naturally occurring, i.e., engineered in the DNA-binding molecules and/or cleavage domain(s). For example, the DNA-binding portion of a naturally-occurring nuclease may be altered to bind to a selected target site (e.g., a single guide RNA of a CRISPR/Cas system or a meganuclease that has been engineered to bind to site different than the cognate binding site). In other embodiments, the nuclease comprises heterologous DNA-binding and cleavage domains (e.g., zinc finger nucleases; TAL-effector domain DNA binding proteins; meganuclease DNA-binding domains with heterologous cleavage domains). Thus, any nuclease may be used in the practice of the present invention including but not limited to, at least one ZFN, TALEN, meganuclease, CRISPR/Cas nuclease or the like, which nucleases that cleave a target gene, which cleavage results in genomic modification of the target gene (e.g., insertions and/or deletions into the cleaved gene).

(95) Also described herein are methods to increase specificity of cleavage activity through independent titration of the engineered cleavage half-domain partners of a nuclease complex. In some embodiments, the ratio of the two partners (half cleavage domains) is given at a 1:2, 1:3, 1:4, 1:5, 1:6, 1:8, 1:9, 1:10 or 1:20 ratio, or any value therebetween. In other embodiments, the ratio of the two partners is greater than 1:30. In other embodiments, the two partners are deployed at a ratio that is chosen to be different from 1:1. When used individually or in combination, the methods and compositions of the invention provide surprising and unexpected increases in targeting specificity via reductions in off-target cleavage activity. The nucleases used in these embodiments may comprise ZFNs, TALENs, CRISPR/Cas, CRISPR/dCas and TtAgo, or any combination thereof.

(96) A. DNA-Binding Molecules

(97) The fusion molecules described herein can include any DNA-binding molecule (also referred to as DNA-binding domain), including protein domains and/or polynucleotide DNA-binding domains. In certain embodiments, the DNA-binding domain binds to a sequence comprising 9 to 12 contiguous nucleotides of the sequences shown in Table 2 (SEQ ID NO:40-47).

(98) In certain embodiments, the composition and methods described herein employ a meganuclease (homing endonuclease) DNA-binding domain for binding to the donor molecule and/or binding to the region of interest in the genome of the cell. Naturally-occurring meganucleases recognize 15-40 base-pair cleavage sites and are commonly grouped into four families: the LAGLIDADG (“LAGLIDADG” disclosed as SEQ ID NO: 49) family, the GIY-YIG family, the His-Cyst box family and the HNH family. Exemplary homing endonucleases include I-SceI, I-CeuI, PI-PspI, PI-Sce, I-SceIV, I-CsmI, I-PanI, I-SceII, I-PpoI, I-SceIII, I-CreI, I-TevI, I-TevII and I-TevIII. Their recognition sequences are known. See also U.S. Pat. Nos. 5,420,032 and 6,833,252; Belfort, et al. (1997) Nucleic Acids Res. 25:3379-3388; Dujon, et al. (1989) Gene 82:115-118; Perler, et al. (1994) Nucleic Acids Res. 22, 1125-1127; Jasin (1996) Trends Genet. 12:224-228; Gimble, et al. (1996) J. Mol. Biol. 263:163-180; Argast, et al. (1998)J Mol. Biol. 280:345-353 and the New England Biolabs catalogue. In addition, the DNA-binding specificity of homing endonucleases and meganucleases can be engineered to bind non-natural target sites. See, for example, Chevalier, et al. (2002) Molec. Cell 10:895-905; Epinat, et al. (2003) Nucleic Acids Res. 31:2952-2962; Ashworth, et al. (2006) Nature 441:656-659; Paques, et al. (2007) Current Gene Therapy 7:49-66; and U.S. Patent Publication No. 2007/0117128. The DNA-binding domains of the homing endonucleases and meganucleases may be altered in the context of the nuclease as a whole (i.e., such that the nuclease includes the cognate cleavage domain) or may be fused to a heterologous cleavage domain.

(99) In other embodiments, the DNA-binding domain of one or more of the nucleases used in the methods and compositions described herein comprises a naturally occurring or engineered (non-naturally occurring) TAL effector DNA binding domain. See, e.g., U.S. Pat. No. 8,586,526, incorporated by reference in its entirety herein. The plant pathogenic bacteria of the genus Xanthomonas are known to cause many diseases in important crop plants. Pathogenicity of Xanthomonas depends on a conserved type III secretion (T3S) system which injects more than 25 different effector proteins into the plant cell. Among these injected proteins are transcription activator-like (TAL) effectors which mimic plant transcriptional activators and manipulate the plant transcriptome (see Kay, et al. (2007) Science 318:648-651). These proteins contain a DNA binding domain and a transcriptional activation domain. One of the most well characterized TAL-effectors is AvrBs3 from Xanthomonas campestgris pv. vesicatoria (see Bonas, et al. (1989) Mol Gen Genet 218:127-136 and International Patent Publication No. WO 2010/079430). TAL-effectors contain a centralized domain of tandem repeats, each repeat containing approximately 34 amino acids, which are key to the DNA binding specificity of these proteins. In addition, they contain a nuclear localization sequence and an acidic transcriptional activation domain (for a review see Schornack S, et al. (2006) J Plant Physiol 163(3):256-272). In addition, in the phytopathogenic bacteria Ralstonia solanacearum two genes, designated brg11 and hpx17 have been found that are homologous to the AvrBs3 family of Xanthomonas in the R. solanacearum biovar 1 strain GMI1000 and in the biovar 4 strain RS1000 (See Heuer, et al. (2007) Appl and Envir Micro 73(13):4379-4384). These genes are 98.9% identical in nucleotide sequence to each other but differ by a deletion of 1,575 bp in the repeat domain of hpx17. However, both gene products have less than 40% sequence identity with AvrBs3 family proteins of Xanthomonas. See, e.g., U.S. Pat. No. 8,586,526, incorporated by reference in its entirety herein.

(100) Specificity of these TAL effectors depends on the sequences found in the tandem repeats. The repeated sequence comprises approximately 102 bp and the repeats are typically 91-100% homologous with each other (Bonas, et al., ibid). Polymorphism of the repeats is usually located at positions 12 and 13 and there appears to be a one-to-one correspondence between the identity of the hypervariable diresidues (RVD) at positions 12 and 13 with the identity of the contiguous nucleotides in the TAL-effector's target sequence (see Moscou and Bogdanove, (2009) Science 326:1501 and Boch, et al. (2009) Science 326:1509-1512). Experimentally, the natural code for DNA recognition of these TAL-effectors has been determined such that an HD sequence at positions 12 and 13 leads to a binding to cytosine (C), NG binds to T, NI to A, C, G or T, NN binds to A or G, and ING binds to T. These DNA binding repeats have been assembled into proteins with new combinations and numbers of repeats, to make artificial transcription factors that are able to interact with new sequences and activate the expression of a non-endogenous reporter gene in plant cells (Boch, et al., ibid). Engineered TAL proteins have been linked to a FokI cleavage half domain to yield a TAL effector domain nuclease fusion (TALEN). See, e.g., U.S. Pat. No. 8,586,526; Christian, et al. (2010) Genetics 186(2):757-61 epub 10.1534/genetics.110.120717. In certain embodiments, TALE domain comprises an N-cap and/or C-cap as described in U.S. Pat. No. 8,586,526.

(101) In certain embodiments, the DNA binding domain of one or more of the nucleases used for in vivo cleavage and/or targeted cleavage of the genome of a cell comprises a zinc finger protein. Preferably, the zinc finger protein is non-naturally occurring in that it is engineered to bind to a target site of choice. See, for example, See, for example, Beerli, et al. (2002) Nature Biotechnol. 20:135-141; Pabo, et al. (2001) Ann. Rev. Biochem. 70:313-340; Isalan, et al. (2001) Nature Biotechnol. 19:656-660; Segal, et al. (2001) Curr. Opin. Biotechnol. 12:632-637; Choo, et al. (2000) Curr. Opin. Struct. Biol. 10:411-416; U.S. Pat. Nos. 6,453,242; 6,534,261; 6,599,692; 6,503,717; 6,689,558; 7,030,215; 6,794,136; 7,067,317; 7,262,054; 7,070,934; 7,361,635; 7,253,273; and U.S. Patent Publication Nos. 2005/0064474; 2007/0218528; 2005/0267061, all incorporated herein by reference in their entireties.

(102) An engineered zinc finger binding domain can have a novel binding specificity, compared to a naturally-occurring zinc finger protein. Engineering methods include, but are not limited to, rational design and various types of selection. Rational design includes, for example, using databases comprising triplet (or quadruplet) nucleotide sequences and individual zinc finger amino acid sequences, in which each triplet or quadruplet nucleotide sequence is associated with one or more amino acid sequences of zinc fingers which bind the particular triplet or quadruplet sequence. See, for example, co-owned U.S. Pat. Nos. 6,453,242 and 6,534,261, incorporated by reference herein in their entireties.

(103) Exemplary selection methods, including phage display and two-hybrid systems, are disclosed in U.S. Pat. Nos. 5,789,538; 5,925,523; 6,007,988; 6,013,453; 6,410,248; 6,140,466; 6,200,759; and 6,242,568; as well as International Patent Publication Nos. WO 98/37186; WO 98/53057; WO 00/27878; WO 01/88197; and GB Patent No. 2,338,237. In addition, enhancement of binding specificity for zinc finger binding domains has been described, for example, in co-owned International Patent Publication No. WO 02/077227.

(104) In addition, as disclosed in these and other references, zinc finger domains and/or multi-fingered zinc finger proteins may be linked together using any suitable linker sequences, including for example, linkers of 5 or more amino acids in length. See, also, U.S. Pat. Nos. 6,479,626; 6,903,185; and 7,153,949 for exemplary linker sequences 6 or more amino acids in length. The proteins described herein may include any combination of suitable linkers between the individual zinc fingers of the protein.

(105) A ZFP can be operably associated (linked) to one or more nuclease (cleavage) domains to form a ZFN. The term “a ZFN” includes a pair of ZFNs that dimerize to cleave the target gene. Methods and compositions can also be used to increase the specificity of a ZFN, including a nuclease pair, for its intended target relative to other unintended cleavage sites, known as off-target sites (see U.S. Patent Publication No. 20180087072). Thus, nucleases described herein can comprise mutations in one or more of their DNA binding domain backbone regions and/or one or more mutations in their nuclease cleavage domains. These nucleases can include mutations to amino acid within the ZFP DNA binding domain (‘ZFP backbone’) that can interact non-specifically with phosphates on the DNA backbone, but they do not comprise changes in the DNA recognition helices. Thus, the invention includes mutations of cationic amino acid residues in the ZFP backbone that are not required for nucleotide target specificity. In some embodiments, these mutations in the ZFP backbone comprise mutating a cationic amino acid residue to a neutral or anionic amino acid residue. In some embodiments, these mutations in the ZFP backbone comprise mutating a polar amino acid residue to a neutral or non-polar amino acid residue. In preferred embodiments, mutations at made at position (−5), (−9) and/or position (−14) relative to the DNA binding helix. In some embodiments, a zinc finger may comprise one or more mutations at (−5), (−9) and/or (−14). In further embodiments, one or more zinc finger in a multi-finger zinc finger protein may comprise mutations in (−5), (−9) and/or (−14). In some embodiments, the amino acids at (−5), (−9) and/or (−14) (e.g. an arginine (R) or lysine (K)) are mutated to an alanine (A), leucine (L), Ser (S), Asp (N), Glu (E), Tyr (Y) and/or glutamine (Q).

(106) In some aspects, the DNA-binding domain (e.g., ZFP, TALE, sgRNA, etc.) targets a CISH gene. In certain embodiments, the DNA-binding domain targets an exonic region of CISH gene, for example exon 2 or exon 3.

(107) Selection of target sites (e.g., within an intron and/or exon of a CISH gene); ZFPs and methods for design and construction of fusion proteins (and polynucleotides encoding same) are known to those of skill in the art and described in detail in U.S. Pat. Nos. 6,140,081; 5,789,538; 6,453,242; 6,534,261; 5,925,523; 6,007,988; 6,013,453; 6,200,759; and International Patent Publication Nos. WO 95/19431; WO 96/06166; WO 98/53057; WO 98/54311; WO 00/27878; WO 01/60970; WO 01/88197; WO 02/099084; WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536; and WO 03/016496.

(108) In addition, as disclosed in these and other references, zinc finger domains and/or multi-fingered zinc finger proteins may be linked together using any suitable linker sequences, including for example, linkers of 5 or more amino acids in length. See, also, U.S. Pat. Nos. 6,479,626; 6,903,185; and 7,153,949 for exemplary linker sequences 6 or more amino acids in length. The proteins described herein may include any combination of suitable linkers between the individual zinc fingers of the protein.

(109) In certain embodiments, the DNA-binding molecule is part of a CRISPR/Cas nuclease system. See, e.g., U.S. Pat. No. 8,697,359 and U.S. Patent Publication No. 2015/0056705. The CRISPR (clustered regularly interspaced short palindromic repeats) locus, which encodes RNA components of the system, and the cas (CRISPR-associated) locus, which encodes proteins (Jansen, et al. (2002) Mol. Microbiol. 43:1565-1575; Makarova, et al. (2002) Nucleic Acids Res. 30:482-496; Makarova, et al. (2006). Biol. Direct 1:7; Haft, et al. (2005) PLoS Comput. Biol. 1:e60) make up the gene sequences of the CRISPR/Cas nuclease system. CRISPR loci in microbial hosts contain a combination of CRISPR-associated (Cas) genes as well as non-coding RNA elements capable of programming the specificity of the CRISPR-mediated nucleic acid cleavage.

(110) The Type II CRISPR is one of the most well characterized systems and carries out targeted DNA double-strand break in four sequential steps. First, two non-coding RNA, the pre-crRNA array and tracrRNA, are transcribed from the CRISPR locus. Second, tracrRNA hybridizes to the repeat regions of the pre-crRNA and mediates the processing of pre-crRNA into mature crRNAs containing individual spacer sequences. Third, the mature crRNA:tracrRNA complex directs Cas9 to the target DNA via Watson-Crick base-pairing between the spacer on the crRNA and the protospacer on the target DNA next to the protospacer adjacent motif (PAM), an additional requirement for target recognition. Finally, Cas9 mediates cleavage of target DNA to create a double-stranded break within the protospacer. Activity of the CRISPR/Cas system comprises of three steps: (i) insertion of alien DNA sequences into the CRISPR array to prevent future attacks, in a process called ‘adaptation’, (ii) expression of the relevant proteins, as well as expression and processing of the array, followed by (iii) RNA-mediated interference with the alien nucleic acid. Thus, in the bacterial cell, several of the so-called ‘Cas’ proteins are involved with the natural function of the CRISPR/Cas system and serve roles in functions such as insertion of the alien DNA etc.

(111) In certain embodiments, Cas protein may be a “functional derivative” of a naturally occurring Cas protein. A “functional derivative” of a native sequence polypeptide is a compound having a qualitative biological property in common with a native sequence polypeptide. “Functional derivatives” include, but are not limited to, fragments of a native sequence and derivatives of a native sequence polypeptide and its fragments, provided that they have a biological activity in common with a corresponding native sequence polypeptide. A biological activity contemplated herein is the ability of the functional derivative to hydrolyze a DNA substrate into fragments. The term “derivative” encompasses both amino acid sequence variants of polypeptide, covalent modifications, and fusions thereof. Suitable derivatives of a Cas polypeptide or a fragment thereof include but are not limited to mutants, fusions, covalent modifications of Cas protein or a fragment thereof. Cas protein, which includes Cas protein or a fragment thereof, as well as derivatives of Cas protein or a fragment thereof, may be obtainable from a cell or synthesized chemically or by a combination of these two procedures. The cell may be a cell that naturally produces Cas protein, or a cell that naturally produces Cas protein and is genetically engineered to produce the endogenous Cas protein at a higher expression level or to produce a Cas protein from an exogenously introduced nucleic acid, which nucleic acid encodes a Cas that is same or different from the endogenous Cas. In some case, the cell does not naturally produce Cas protein and is genetically engineered to produce a Cas protein. In some embodiments, the Cas protein is a small Cas9 ortholog for delivery via an AAV vector (Ran, et al. (2015) Nature 510:186).

(112) In some embodiments, the DNA binding molecule is part of a TtAgo system (see Swarts, et al., ibid; Sheng, et al., ibid). In eukaryotes, gene silencing is mediated by the Argonaute (Ago) family of proteins. In this paradigm, Ago is bound to small (19-31 nt) RNAs. This protein-RNA silencing complex recognizes target RNAs via Watson-Crick base pairing between the small RNA and the target and endonucleolytically cleaves the target RNA (Vogel (2014) Science 344:972-973). In contrast, prokaryotic Ago proteins bind to small single-stranded DNA fragments and likely function to detect and remove foreign (often viral) DNA (Yuan, et al. (2005) Mol. Cell 19, 405; Olovnikov, et al. (2013) Mol. Cell 51:594; Swarts, et al., ibid). Exemplary prokaryotic Ago proteins include those from Aquifex aeolicus, Rhodobacter sphaeroides, and Thermus thermophilus.

(113) One of the most well-characterized prokaryotic Ago protein is the one from T thermophilus (TtAgo; Swarts, et al., ibid). TtAgo associates with either 15 nt or 13-25 nt single-stranded DNA fragments with 5′ phosphate groups. This “guide DNA” bound by TtAgo serves to direct the protein-DNA complex to bind a Watson-Crick complementary DNA sequence in a third-party molecule of DNA. Once the sequence information in these guide DNAs has allowed identification of the target DNA, the TtAgo-guide DNA complex cleaves the target DNA. Such a mechanism is also supported by the structure of the TtAgo-guide DNA complex while bound to its target DNA (G. Sheng, et al., ibid). Ago from Rhodobacter sphaeroides (RsAgo) has similar properties (Olovnikov, et al., ibid).

(114) Exogenous guide DNAs of arbitrary DNA sequence can be loaded onto the TtAgo protein (Swarts et al., ibid.). Since the specificity of TtAgo cleavage is directed by the guide DNA, a TtAgo-DNA complex formed with an exogenous, investigator-specified guide DNA will therefore direct TtAgo target DNA cleavage to a complementary investigator-specified target DNA. In this way, one may create a targeted double-strand break in DNA. Use of the TtAgo-guide DNA system (or orthologous Ago-guide DNA systems from other organisms) allows for targeted cleavage of genomic DNA within cells. Such cleavage can be either single- or double-stranded. For cleavage of mammalian genomic DNA, it would be preferable to use of a version of TtAgo codon optimized for expression in mammalian cells. Further, it might be preferable to treat cells with a TtAgo-DNA complex formed in vitro where the TtAgo protein is fused to a cell-penetrating peptide. Further, it might be preferable to use a version of the TtAgo protein that has been altered via mutagenesis to have improved activity at 37 degrees Celsius. Ago-RNA-mediated DNA cleavage could be used to affect a panoply of outcomes including gene knock-out, targeted gene addition, gene correction, targeted gene deletion using techniques standard in the art for exploitation of DNA breaks.

(115) Thus, the nuclease comprises a DNA-binding molecule in that specifically binds to a target site in any gene into which it is desired to insert a donor (transgene).

(116) B. Cleavage Domains

(117) Any suitable cleavage domain can be operatively linked to a DNA-binding domain to form a nuclease. For example, ZFP DNA-binding domains have been fused to nuclease domains to create ZFNs—a functional entity that is able to recognize its intended nucleic acid target through its engineered (ZFP) DNA binding domain and cause the DNA to be cut near the ZFP binding site via the nuclease activity, including for use in genome modification in a variety of organisms. See, for example, U.S. Pat. Nos. 7,888,121; 8,623,618; 7,888,121; 7,914,796; and 8,034,598; and U.S. Patent Publication No. 2011/0201055. Likewise, TALE DNA-binding domains have been fused to nuclease domains to create TALENs. See, e.g., U.S. Pat. No. 8,586,526.

(118) As noted above, the cleavage domain may be heterologous to the DNA-binding domain, for example a zinc finger DNA-binding domain and a cleavage domain from a nuclease or a TALEN DNA-binding domain and a cleavage domain, or meganuclease DNA-binding domain and cleavage domain from a different nuclease. Heterologous cleavage domains can be obtained from any endonuclease or exonuclease. Exemplary endonucleases from which a cleavage domain can be derived include, but are not limited to, restriction endonucleases and homing endonucleases. Additional enzymes which cleave DNA are known (e.g., S1 Nuclease; mung bean nuclease; pancreatic DNase I; micrococcal nuclease; yeast HO endonuclease. One or more of these enzymes (or functional fragments thereof) can be used as a source of cleavage domains and cleavage half-domains.

(119) Similarly, a cleavage half-domain can be derived from any nuclease or portion thereof, as set forth above, that requires dimerization for cleavage activity. In general, two fusion proteins are required for cleavage if the fusion proteins comprise cleavage half-domains. Alternatively, a single protein comprising two cleavage half-domains can be used. The two cleavage half-domains can be derived from the same endonuclease (or functional fragments thereof), or each cleavage half-domain can be derived from a different endonuclease (or functional fragments thereof). In addition, the target sites for the two fusion proteins are preferably disposed, with respect to each other, such that binding of the two fusion proteins to their respective target sites places the cleavage half-domains in a spatial orientation to each other that allows the cleavage half-domains to form a functional cleavage domain, e.g., by dimerizing. Thus, in certain embodiments, the near edges of the target sites are separated by 5-8 nucleotides or by 15-18 nucleotides. However, any integral number of nucleotides or nucleotide pairs can intervene between two target sites (e.g., from 2 to 50 nucleotide pairs or more). In general, the site of cleavage lies between the target sites.

(120) Restriction endonucleases (restriction enzymes) are present in many species and are capable of sequence-specific binding to DNA (at a recognition site), and cleaving DNA at or near the site of binding. Certain restriction enzymes (e.g., Type IIS) cleave DNA at sites removed from the recognition site and have separable binding and cleavage domains. For example, the Type IIS enzyme FokI catalyzes double-stranded cleavage of DNA, at 9 nucleotides from its recognition site on one strand and 13 nucleotides from its recognition site on the other. See, for example, U.S. Pat. Nos. 5,356,802; 5,436,150; and 5,487,994; as well as Li, et al. (1992) Proc. Natl. Acad. Sci. USA 89:4275-4279; Li, et al. (1993) Proc. Natl. Acad. Sci. USA 90:2764-2768; Kim, et al. (1994a) Proc. Natl. Acad. Sci. USA 91:883-887; Kim, et al. (1994b) J. Biol. Chem. 269:31,978-31,982. Thus, in one embodiment, fusion proteins comprise the cleavage domain (or cleavage half-domain) from at least one Type IIS restriction enzyme and one or more zinc finger binding domains, which may or may not be engineered.

(121) An exemplary Type IIS restriction enzyme, whose cleavage domain is separable from the binding domain, is FokI. This particular enzyme is active as a dimer. Bitinaite, et al. (1998) Proc. Natl. Acad. Sci. USA 95:10,570-10,575. Accordingly, for the purposes of the present disclosure, the portion of the FokI enzyme used in the disclosed fusion proteins is considered a cleavage half-domain. Thus, for targeted double-stranded cleavage and/or targeted replacement of cellular sequences using zinc finger-FokI fusions, two fusion proteins, each comprising a FokI cleavage half-domain, can be used to reconstitute a catalytically active cleavage domain. Alternatively, a single polypeptide molecule containing a zinc finger binding domain and two FokI cleavage half-domains can also be used. Parameters for targeted cleavage and targeted sequence alteration using zinc finger-FokI fusions are provided elsewhere in this disclosure.

(122) A cleavage domain or cleavage half-domain can be any portion of a protein that retains cleavage activity, or that retains the ability to multimerize (e.g., dimerize) to form a functional cleavage domain.

(123) Exemplary Type IIS restriction enzymes are described in International Patent Publication No. WO 07/014275, incorporated herein in its entirety. Additional restriction enzymes also contain separable binding and cleavage domains, and these are contemplated by the present disclosure. See, for example, Roberts, et al. (2003) Nucleic Acids Res. 31:418-420.

(124) In certain embodiments, the cleavage domain comprises one or more engineered cleavage half-domain (also referred to as dimerization domain mutants) that minimize or prevent homodimerization, as described, for example, in U.S. Pat. Nos. 8,623,618; 7,888,121; 7,914,796; and 8,034,598; and U.S. Patent Publication No. 2011/0201055, the disclosures of all of which are incorporated by reference in their entireties herein. Amino acid residues at positions 446, 447, 479, 483, 484, 486, 487, 490, 491, 496, 498, 499, 500, 531, 534, 537, and 538 of FokI are all targets for influencing dimerization of the FokI cleavage half-domains.

(125) In certain embodiments, the engineered cleavage half domains are derived from FokI and comprise one or more mutations in one or more of amino acid residues 416, 422, 447, 448, and/or 525 (see, e.g., U.S. Patent Publication No. 2018/0087072) numbered relative to the wild-type full length FokI as shown below:

(126) TABLE-US-00001 Wild type FokI cleavage half domain  (SEQ ID NO: 1) QLVKSELEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFM KVYGYRGKHLGGSRKPDGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQAD EMQRYVEENQTRNKHINPNEWWKVYPSSVTEFKFLFVSGHFKGNYKAQLT RLNHITNCNGAVLSVEELLIGGEMIKAGTLTLEEVRRKFNNGEINF
These mutations decrease the non-specific interaction between the FokI domain and a DNA molecule. In other embodiments the cleavage half domains derived from FokI comprises a mutation in one or more of amino acid residues 414-426, 443-450, 467-488, 501-502, and/or 521-531. The mutations may include mutations to residues found in natural restriction enzymes homologous to FokI. In certain embodiments, the mutations are substitutions, for example substitution of the wild-type residue with a different amino acid, for example serine (S), e.g. R416S or K525S. In a preferred embodiment, the mutation at positions 416, 422, 447, 448 and/or 525 comprise replacement of a positively charged amino acid with an uncharged or a negatively charged amino acid. In another embodiment, the engineered cleavage half domain comprises mutations in amino acid residues 499, 496 and 486 in addition to the mutations in one or more amino acid residues 416, 422, 447, 448, or 525. In a preferred embodiment, the invention provides fusion proteins wherein the engineered cleavage half-domain comprises a polypeptide in which the wild-type Gln (Q) residue at position 486 is replaced with a Glu (E) residue, the wild-type Ile (I) residue at position 499 is replaced with a Leu (L) residue and the wild-type Asn (N) residue at position 496 is replaced with an Asp (D) or a Glu (E) residue (“ELD” or “ELE”) in addition to one or more mutations at positions 416, 422, 447, 448, or 525.

(127) Cleavage domains with more than one mutation may be used, for example mutations at positions 490 (E.fwdarw.K) and 538 (I.fwdarw.K) in one cleavage half-domain to produce an engineered cleavage half-domain designated “E490K:I538K” and by mutating positions 486 (Q.fwdarw.E) and 499 (I.fwdarw.L) in another cleavage half-domain to produce an engineered cleavage half-domain designated “Q486E:I499L;” mutations that replace the wild type Gln (Q) residue at position 486 with a Glu (E) residue, the wild type Iso (I) residue at position 499 with a Leu (L) residue and the wild-type Asn (N) residue at position 496 with an Asp (D) or Glu (E) residue (also referred to as a “ELD” and “ELE” domains, respectively); engineered cleavage half-domain comprising mutations at positions 490, 538 and 537 (numbered relative to wild-type FokI), for instance mutations that replace the wild type Glu (E) residue at position 490 with a Lys (K) residue, the wild type Iso (I) residue at position 538 with a Lys (K) residue, and the wild-type His (H) residue at position 537 with a Lys (K) residue or a Arg (R) residue (also referred to as “KKK” and “KKR” domains, respectively); and/or engineered cleavage half-domain comprises mutations at positions 490 and 537 (numbered relative to wild-type FokI), for instance mutations that replace the wild type Glu (E) residue at position 490 with a Lys (K) residue and the wild-type His (H) residue at position 537 with a Lys (K) residue or a Arg (R) residue (also referred to as “KIK” and “KIR” domains, respectively). See, e.g., U.S. Pat. Nos. 7,914,796; 8,034,598; and 8,623,618, the disclosures of which are incorporated by reference in its entirety for all purposes. In other embodiments, the engineered cleavage half domain comprises the “Sharkey” and/or “Sharkey” mutations (see Guo, et al. (2010) J. Mol. Biol. 400(1):96-107).

(128) Alternatively, nucleases may be assembled in vivo at the nucleic acid target site using so-called “split-enzyme” technology (see, e.g. U.S. Patent Publication No. 2009/0068164). Components of such split enzymes may be expressed either on separate expression constructs, or can be linked in one open reading frame where the individual components are separated, for example, by a self-cleaving 2A peptide or IRES sequence. Components may be individual zinc finger binding domains or domains of a meganuclease nucleic acid binding domain.

(129) Nucleases can be screened for activity prior to use, for example in a yeast-based chromosomal system as described in U.S. Pat. No. 8,563,314.

(130) The Cas9 related CRISPR/Cas system comprises two RNA non-coding components: tracrRNA and a pre-crRNA array containing nuclease guide sequences (spacers) interspaced by identical direct repeats (DRs). To use a CRISPR/Cas system to accomplish genome engineering, both functions of these RNAs must be present (see Cong, et al. (2013) Sciencexpress 1/10.1126/science 1231143). In some embodiments, the tracrRNA and pre-crRNAs are supplied via separate expression constructs or as separate RNAs. In other embodiments, a chimeric RNA is constructed where an engineered mature crRNA (conferring target specificity) is fused to a tracrRNA (supplying interaction with the Cas9) to create a chimeric cr-RNA-tracrRNA hybrid (also termed a single guide RNA). (see Jinek, et al. (2012) Science 337:816-821; Jinek, et al. (2013) eLife 2:e00471. DOI: 10.7554/eLife.00471 and Cong, ibid).

(131) In some embodiments, the CRISPR-Cpf1 system is used. The CRISPR-Cpf1 system, identified in Francisella spp, is a class 2 CRISPR-Cas system that mediates robust DNA interference in human cells. Although functionally conserved, Cpf1 and Cas9 differ in many aspects including in their guide RNAs and substrate specificity (see Fagerlund, et al. (2015) Genom Bio 16:251). A major difference between Cas9 and Cpf1 proteins is that Cpf1 does not utilize tracrRNA, and thus requires only a crRNA. The FnCpf1 crRNAs are 42-44 nucleotides long (19-nucleotide repeat and 23-25-nucleotide spacer) and contain a single stem-loop, which tolerates sequence changes that retain secondary structure. In addition, the Cpf1 crRNAs are significantly shorter than the ˜100-nucleotide engineered sgRNAs required by Cas9, and the PAM requirements for FnCpf1 are 5′-TTN-3′ and 5′-CTA-3′ on the displaced strand. Although both Cas9 and Cpf1 make double strand breaks in the target DNA, Cas9 uses its RuvC- and HNH-like domains to make blunt-ended cuts within the seed sequence of the guide RNA, whereas Cpf1 uses a RuvC-like domain to produce staggered cuts outside of the seed. Because Cpf1 makes staggered cuts away from the critical seed region, NHEJ will not disrupt the target site, therefore ensuring that Cpf1 can continue to cut the same site until the desired HDR recombination event has taken place. Thus, in the methods and compositions described herein, it is understood that the term “‘Cas” includes both Cas9 and Cpf1 proteins. Thus, as used herein, a “CRISPR/Cas system” refers both CRISPR/Cas and/or CRISPR/Cpf1 systems, including both nuclease and/or transcription factor systems.

(132) Target Sites

(133) As described in detail above, DNA-binding domains can be engineered to bind to any sequence of choice. An engineered DNA-binding domain can have a novel binding specificity, compared to a naturally-occurring DNA-binding domain.

(134) In certain embodiments, the nuclease(s) target(s) a CISH gene for example an intron and/or an exon (e.g., exon 2 or 3) of the gene. In certain embodiments, the nuclease binds to a target site of 9-20 or more nucleotides (contiguous or non-contiguous) within a sequence as shown in Table 2.

(135) In certain embodiments, the nuclease target(s) a “safe harbor” loci such as the AAVS1, HPRT, ALB and CCR5 genes in human cells, and Rosa26 in murine cells (see, e.g., U.S. Pat. Nos. 7,888,121; 7,972,854; 7,914,796; 7,951,925; 8,110,379; 8,409,861; 8,586,526; U.S. Patent Publication Nos. 2003/0232410; 2005/0208489; 2005/0026157; 2006/0063231; 2008/0159996; 2010/00218264; 2012/0017290; 2011/0265198; 2013/0137104; 2013/0122591; 2013/0177983; and 2013/0177960) and the Zp15 locus in plants (see U.S. Pat. No. 8,329,986).

(136) Addition non-limiting examples of suitable target genes include a beta (β) globin gene (HBB), a gamma (δ) globin gene (HBG1), a B-cell lymphoma/leukemia 11A (BCL11A) gene, a Kruppel-like factor 1 (KLF1) gene, a CCR5 gene, a CXCR4 gene, a PPP1R12C (AAVS1) gene, an hypoxanthine phosphoribosyltransferase (HPRT) gene, an albumin gene, a Factor VIII gene, a Factor IX gene, a Leucine-rich repeat kinase 2 (LRRK2) gene, a Hungtingin (Htt) gene, a rhodopsin (RHO) gene, a Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) gene, a surfactant protein B gene (SFTPB), a T-cell receptor alpha (TRAC) gene, a T-cell receptor beta (TRBC) gene, a programmed cell death 1 (PD1) gene, a Cytotoxic T-Lymphocyte Antigen 4 (CTLA-4) gene, an human leukocyte antigen (HLA) A gene, an HLA B gene, an HLA C gene, an HLA-DPA gene, an HLA-DQ gene, an HLA-DRA gene, a LMP7 gene, a Transporter associated with Antigen Processing (TAP) 1 gene, a TAP2 gene, a tapasin gene (TAPBP), a class II major histocompatibility complex transactivator (CIITA) gene, a dystrophin gene (DMD), a glucocorticoid receptor gene (GR), a CISH gene, a Rag-1 gene, an RFXS gene, a FAD2 gene, a FAD3 gene, a ZP15 gene, a KASII gene, a MDH gene, and/or an EPSPS gene. In some aspects, the nuclease(s) binds to and/or cleaves a check point inhibitor gene, for example PD-1, CTLA4, receptors for the B7 family of inhibitory ligands, or cleaves a receptor or ligand gene involved in signaling through LAG3, 2B4, BTLA, TIM3, A2aR, and killer inhibitor receptors (KIRs and C-type lectin receptors), see Pardoll (2012) Nat Rev Cancer 12(4):252, an HLA complex gene (class I: HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, HLA-G, B2M; class II: HLA-DMA, HLA-DOA, HLA-DPA1, HLA-DQA, HLA-DRA, HLA-DMB, HLA-DOB, HLA-DPB1, HLA-DQB, HLA-DRB) or TCR; and/or a gene encoding a product involved in the peptide loading process and antigen processing for the HLA complexes (e.g. TAP, tapasin, calreticulin, calnexin, LMP2, LMP7 or Erp57). See, e.g., U.S. Pat. Nos. 8,956,828 and 8,945,868.

(137) Donors

(138) In certain embodiments, the present disclosure relates to nuclease-mediated targeted integration of an exogenous sequence (e.g. a transgene encoding a therapeutic protein) into the genome of a cell. As noted above, insertion of an exogenous sequence (also called a “donor sequence” or “donor” or “transgene”), for example for deletion of a specified region and/or correction of a mutant gene or for increased expression of a wild-type gene. It will be readily apparent that the donor sequence is typically not identical to the genomic sequence where it is placed. A donor sequence can contain a non-homologous sequence (e.g., a transgene) flanked by two regions of homology to allow for efficient HDR at the location of interest or can be integrated via non-homology directed repair mechanisms. See, e.g., U.S. Pat. Nos. 9,045,763; 9,005,973; and 7,888,121. Additionally, donor sequences can comprise a vector molecule containing sequences that are not homologous to the region of interest in cellular chromatin. A donor molecule can contain several, discontinuous regions of homology to cellular DNA. Further, for targeted insertion of sequences not normally present in a region of interest, said sequences can be present in a donor nucleic acid molecule and flanked by regions of homology to sequence in the region of interest.

(139) As with nucleases, the donors can be introduced into any form. In certain embodiments, the donors may be introduced using DNA and/or viral vectors by methods known in the art. See, e.g., U.S. Pat. Nos. 9,005,973; 8,936,936; and 8,703,489. The donor may be introduced into the cell in double- or single-stranded form. The donor may be introduced into the cell in circular or linear form. If introduced in linear form, the ends of the donor sequence can be protected (e.g., from exonucleolytic degradation) by methods known to those of skill in the art. For example, one or more dideoxynucleotide residues are added to the 3′ terminus of a linear molecule and/or self-complementary oligonucleotides are ligated to one or both ends. See, for example, Chang, et al. (1987) Proc. Natl. Acad. Sci. USA 84:4959-4963; Nehls, et al. (1996) Science 272:886-889. Additional methods for protecting exogenous polynucleotides from degradation include, but are not limited to, addition of terminal amino group(s) and the use of modified internucleotide linkages such as, for example, phosphorothioates, phosphoramidates, and O-methyl ribose or deoxyribose residues.

(140) In certain embodiments, the donor includes sequences (e.g., coding sequences, also referred to as transgenes) greater than 1 kb in length, for example between 2 and 200 kb, between 2 and 10 kb (or any value therebetween). The donor may also include at least one nuclease target site. In certain embodiments, the donor includes at least 2 target sites, for example for a pair of ZFNs, TALENs, TtAgo or CRISPR/Cas nucleases. Typically, the nuclease target sites are outside the transgene sequences, for example, 5′ and/or 3′ to the transgene sequences, for cleavage of the transgene. The nuclease cleavage site(s) may be for any nuclease(s). In certain embodiments, the nuclease target site(s) contained in the double-stranded donor are for the same nuclease(s) used to cleave the endogenous target into which the cleaved donor is integrated via homology-independent methods.

(141) The donor can be inserted so that its expression is driven by the endogenous promoter at the integration site, namely the promoter that drives expression of the endogenous gene into which the donor is inserted. However, it will be apparent that the donor may comprise a promoter and/or enhancer, for example a constitutive promoter or an inducible or tissue specific promoter.

(142) The donor molecule may be inserted into an endogenous gene such that all, some or none of the endogenous gene is expressed. In some embodiments, the transgene is integrated into the endogenous locus of the CISH gene to correct a mutant version (e.g., in a cell from a patient that is lacking or deficient in a functional version of the CISH gene), for instance, a transgene is integrated into an endogenous CISH gene, for example an exonic (e.g., exon 2 or exon 3) of a CISH gene. In other embodiments, the transgene is integrated into the endogenous locus of a CISH gene such that a functional protein is expressed. Thus, the donor may include any protein-encoding sequences that produce a functional protein, including but not limited to CARs, engineered or exogenous TCRs (see U.S. Pat. No. 8,956,828) and/or ACTRs (U.S. Patent Publication No. 2017/0281682) and combinations thereof.

(143) Furthermore, although not required for expression, exogenous sequences may also include transcriptional or translational regulatory or other sequences, for example, promoters, enhancers, insulators, internal ribosome entry sites, sequences encoding 2A peptides and/or polyadenylation signals. Additionally, splice acceptor sequences may be included.

(144) The transgenes carried on the donor sequences described herein may be isolated from plasmids, cells or other sources using standard techniques known in the art such as PCR. Donors for use can include varying types of topology, including circular supercoiled, circular relaxed, linear and the like. Alternatively, they may be chemically synthesized using standard oligonucleotide synthesis techniques. In addition, donors may be methylated or lack methylation. Donors may be in the form of bacterial or yeast artificial chromosomes (BACs or YACs).

(145) The donor polynucleotides described herein may include one or more non-natural bases and/or backbones. In particular, insertion of a donor molecule with methylated cytosines may be carried out using the methods described herein to achieve a state of transcriptional quiescence in a region of interest.

(146) The exogenous (donor) polynucleotide may comprise any sequence of interest (exogenous sequence). Exemplary exogenous sequences include, but are not limited to any polypeptide coding sequence (e.g., cDNAs), promoter sequences, enhancer sequences, epitope tags, marker genes, cleavage enzyme recognition sites and various types of expression constructs. Marker genes include, but are not limited to, sequences encoding proteins that mediate antibiotic resistance (e.g., ampicillin resistance, neomycin resistance, G418 resistance, puromycin resistance), sequences encoding colored or fluorescent or luminescent proteins (e.g., green fluorescent protein, enhanced green fluorescent protein, red fluorescent protein, luciferase), and proteins which mediate enhanced cell growth and/or gene amplification (e.g., dihydrofolate reductase). Epitope tags include, for example, one or more copies of FLAG, His, myc, Tap, HA or any detectable amino acid sequence.

(147) In some embodiments, the donor further comprises a polynucleotide encoding any polypeptide of which expression in the cell is desired, including, but not limited to antibodies, antigens, enzymes, receptors (cell surface or nuclear or chimeric antigen receptors (CARs)), hormones, lymphokines, cytokines, reporter polypeptides, growth factors, and functional fragments of any of the above. The coding sequences may be, for example, cDNAs.

(148) In certain embodiments, the exogenous sequences can comprise a marker gene (described above), allowing selection of cells that have undergone targeted integration, and a linked sequence encoding an additional functionality. Non-limiting examples of marker genes include GFP, drug selection marker(s) and the like.

(149) In certain embodiments, the transgene may include, for example, wild-type genes to replace mutated endogenous sequences. For example, a wild-type (or other functional) CISH gene sequence may be inserted into the genome of a stem cell in which the endogenous copy of the gene is mutated. The transgene may be inserted at the endogenous locus, or may alternatively be targeted to a safe harbor locus.

(150) Construction of such expression cassettes, following the teachings of the present specification, utilizes methodologies well known in the art of molecular biology (see, for example, Ausubel or Maniatis). Before use of the expression cassette to generate a transgenic animal, the responsiveness of the expression cassette to the stress-inducer associated with selected control elements can be tested by introducing the expression cassette into a suitable cell line (e.g., primary cells, transformed cells, or immortalized cell lines).

(151) Furthermore, although not required for expression, exogenous sequences may also transcriptional or translational regulatory sequences, for example, promoters, enhancers, insulators, internal ribosome entry sites, sequences encoding 2A peptides and/or polyadenylation signals. Further, the control elements of the genes of interest can be operably linked to reporter genes to create chimeric genes (e.g., reporter expression cassettes).

(152) Targeted insertion of non-coding nucleic acid sequence may also be achieved. Sequences encoding antisense RNAs, RNAi, shRNAs and micro RNAs (miRNAs) may also be used for targeted insertions.

(153) In additional embodiments, the donor nucleic acid may comprise non-coding sequences that are specific target sites for additional nuclease designs. Subsequently, additional nucleases may be expressed in cells such that the original donor molecule is cleaved and modified by insertion of another donor molecule of interest. In this way, reiterative integrations of donor molecules may be generated allowing for trait stacking at a particular locus of interest or at a safe harbor locus.

(154) Cells

(155) Thus, provided herein are genetically modified cells comprising a genetically modified CISH gene. The genetically modified cells may be modified anywhere within the CISH gene, including non-coding or coding regions, for example within exon 2 and/or exon 3 of the CISH gene. In certain embodiments the modification comprises integration of a transgene that expresses a functional protein in the cell, including cells (e.g., T-cells or stem cells) produced by the methods described herein. The transgene is integrated in a targeted manner into the cell's genome using one or more nucleases. In certain embodiments, the transgene is integrated into a CISH gene, for example in a cancer patient or a patient with an inflammatory disease. The transgene may be integrated into any intronic and/or exonic region of CISH, for example, exon 2 or exon 3. In certain embodiments, the transgene is integrated into or within 5-10 nucleotides on either side of a target site of at least 9 base pairs as shown in Table 2. Thus, provided herein are genetically modified cells comprising a transgene (that expresses a functional protein) integrated in exon 2 or 3 of a CISH gene as well as cells descended from these cells that include the genetic modification.

(156) Unlike random integration, targeted integration ensures that the transgene is integrated into a specified gene. The transgene may be integrated anywhere in the target gene. In certain embodiments, the transgene is integrated at or near the nuclease cleavage site, for example, within 1-300 (or any value therebetween) base pairs upstream or downstream of the site of cleavage, more preferably within 1-100 base pairs (or any value therebetween) of either side of the cleavage site, even more preferably within 1 to 50 base pairs (or any value therebetween) of either side of the cleavage site. In certain embodiments, the integrated sequence comprising the transgene does not include any vector sequences (e.g., viral vector sequences).

(157) Any cell type can be genetically modified as described herein to comprise a transgene, including but not limited to cells and cell lines. Other non-limiting examples of transgene containing cells as described herein include T-cells (e.g., CD4+, CD3+, CD8+, etc.); dendritic cells; B-cells; autologous (e.g., patient-derived) or heterologous pluripotent, totipotent or multipotent stem cells (e.g., CD34+ cells, induced pluripotent stem cells (iPSCs), embryonic stem cells or the like). In certain embodiments, the cells as described herein are CD34+ cells derived from a patient. Cells may be genetically modified in culture or, alternatively, may be genetically modified in vivo by providing the nucleases and/or donors as described herein to the subject.

(158) The cells as described herein are useful in treating and/or preventing cancer or an inflammatory disease in a subject with the disorder, for example, by ex vivo therapies. The nuclease-modified cells can be expanded and then reintroduced into the patient using standard techniques. See, e.g., Tebas, et al. (2014) New Eng J Med 370(10):901. In the case of stem cells, after infusion into the subject, in vivo differentiation of these precursors into cells expressing the functional CISH protein also occurs. Pharmaceutical compositions comprising the cells as described herein are also provided. In addition, the cells may be cryopreserved prior to administration to a patient.

(159) The cells and ex vivo methods as described herein provide treatment and/or prevention of a disorder (e.g., cancer or inflammatory disease) in a subject (e.g., a mammalian subject) and eliminate the need for continuous prophylactic pharmaceutical administration or risky procedures such as allogeneic bone marrow transplants or gamma retroviral delivery. As such, the invention described herein provides a safer, cost-effective and time efficient way of treating and/or preventing cancers, inflammatory diseases and other conditions in which immune regulatory is desirable.

(160) Delivery

(161) The nucleases, polynucleotides encoding these nucleases, donor polynucleotides and compositions comprising the proteins and/or polynucleotides described herein may be delivered by any suitable means. In certain embodiments, the nucleases and/or donors are delivered in vivo. In other embodiments, the nucleases and/or donors are delivered to isolated cells (e.g., autologous or heterologous stem cells) for the provision of modified cells useful in ex vivo delivery to patients (cell therapy).

(162) Methods of delivering nucleases as described herein are described, for example, in U.S. Pat. Nos. 6,453,242; 6,503,717; 6,534,261; 6,599,692; 6,607,882; 6,689,558; 6,824,978; 6,933,113; 6,979,539; 7,013,219; and 7,163,824, the disclosures of all of which are incorporated by reference herein in their entireties.

(163) Nucleases and/or donor constructs as described herein may also be delivered using any nucleic acid delivery mechanism, including naked DNA and/or RNA (e.g., mRNA) and vectors containing sequences encoding one or more of the components. Any vector systems may be used including, but not limited to, plasmid vectors, DNA minicircles, retroviral vectors, lentiviral vectors, adenovirus vectors, poxvirus vectors; herpesvirus vectors and adeno-associated virus vectors, etc., and combinations thereof. See, also, U.S. Pat. Nos. 6,534,261; 6,607,882; 6,824,978; 6,933,113; 6,979,539; 7,013,219; and 7,163,824; and U.S. Patent Publication No. 2014/0335063, incorporated by reference herein in their entireties. Furthermore, it will be apparent that any of these systems may comprise one or more of the sequences needed for treatment. Thus, when one or more nucleases and a donor construct are introduced into the cell, the nucleases and/or donor polynucleotide may be carried on the same delivery system or on different delivery mechanisms. When multiple systems are used, each delivery mechanism may comprise a sequence encoding one or multiple nucleases and/or donor constructs (e.g., mRNA encoding one or more nucleases and/or mRNA or AAV carrying one or more donor constructs).

(164) Conventional viral and non-viral based gene transfer methods can be used to introduce nucleic acids encoding nucleases and donor constructs in cells (e.g., mammalian cells) and target tissues. Non-viral vector delivery systems include DNA plasmids, DNA minicircles, naked nucleic acid, and nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer. Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the cell. For a review of gene therapy procedures, see Anderson (1992) Science 256:808-813; Nabel & Felgner (1993) TIBTECH 11:211-217; Mitani & Caskey (1993) TIBTECH 11:162-166; Dillon (1993) TIBTECH 11:167-175; Miller (1992) Nature 357:455-460; Van Brunt (1988) Biotechnology 6(10):1149-1154; Vigne (1995) Restorative Neurology and Neuroscience 8:35-36; Kremer & Perricaudet (1995) British Medical Bulletin 51(1):31-44; Haddada, et al., in Current Topics in Microbiology and Immunology Doerfler and Bohm (eds.) (1995); and Yu, et al. (1994) Gene Therapy 1:13-26.

(165) Methods of non-viral delivery of nucleic acids include electroporation, lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, lipid nanoparticles (LNP), naked DNA, naked RNA, capped RNA, artificial virions, and agent-enhanced uptake of DNA. Sonoporation using, e.g., the Sonitron 2000 system (Rich-Mar) can also be used for delivery of nucleic acids.

(166) Additional exemplary nucleic acid delivery systems include those provided by Amaxa Biosystems (Cologne, Germany), Maxcyte, Inc. (Rockville, Md.), BTX Molecular Delivery Systems (Holliston, Mass.) and Copernicus Therapeutics Inc. (see for example U.S. Pat. No. 6,008,336). Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386; 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., Transfectam™ and Lipofectin™) Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Felgner, International Patent Publication Nos. WO 91/17424, WO 91/16024. In some aspects, the nucleases are delivered as mRNAs and the transgene is delivered via other modalities such as viral vectors, minicircle DNA, plasmid DNA, single-stranded DNA, linear DNA, liposomes, nanoparticles and the like.

(167) The preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes, is well known to one of skill in the art (see, e.g., Crystal (1995) Science 270:404-410; Blaese, et al. (1995) Cancer Gene Ther. 2:291-297; Behr, et al. (1994) Bioconjugate Chem. 5:382-389; Remy, et al. (1994) Bioconjugate Chem. 5:647-654; Gao, et al. (1995) Gene Therapy 2:710-722; Ahmad, et al. (1992) Cancer Res. 52:4817-4820; U.S. Pat. Nos. 4,186,183; 4,217,344; 4,235,871; 4,261,975; 4,485,054; 4,501,728; 4,774,085; 4,837,028; and 4,946,787).

(168) Additional methods of delivery include the use of packaging the nucleic acids to be delivered into EnGeneIC delivery vehicles (EDVs). These EDVs are specifically delivered to target tissues using bispecific antibodies where one arm of the antibody has specificity for the target tissue and the other has specificity for the EDV. The antibody brings the EDVs to the target cell surface and then the EDV is brought into the cell by endocytosis. Once in the cell, the contents are released (see MacDiarmid et al. (2009) Nature Biotechnology 27(7):643).

(169) The use of RNA or DNA viral based systems for the delivery of nucleic acids encoding engineered CRISPR/Cas systems take advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus. Viral vectors can be administered directly to subjects (in vivo) or they can be used to treat cells in vitro and the modified cells are administered to subjects (ex vivo). Conventional viral based systems for the delivery of CRISPR/Cas systems include, but are not limited to, retroviral, lentivirus, adenoviral, adeno-associated, vaccinia and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues.

(170) The tropism of a retrovirus can be altered by incorporating foreign envelope proteins, expanding the potential target population of target cells. Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system depends on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression. Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immunodeficiency virus (SIV), human immunodeficiency virus (HIV), and combinations thereof (see, e.g., Buchscher, et al. (1992) J. Virol. 66:2731-2739; Johann, et al. (1992) J. Virol. 66:1635-1640; Sommerfelt, et al. (1990) Virol. 176:58-59; Wilson, et al. (1989) J. Virol. 63:2374-2378; Miller, et al. (1991) J. Virol. 65:2220-2224; International Patent Publication No. WO 1994/026877).

(171) In applications in which transient expression is preferred, adenoviral based systems can be used. Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and high levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system. Adeno-associated virus (“AAV”) vectors are also used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West, et al. (1987) Virology 160:38-47; U.S. Pat. No. 4,797,368; International Patent Publication No. WO 93/24641; Kotin (1994) Human Gene Therapy 5:793-801; Muzyczka (1994) J. Clin. Invest. 94:1351. Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No. 5,173,414; Tratschin, et al. (1985) Mol. Cell. Biol. 5:3251-3260; Tratschin, et al. (1984) Mol. Cell. Biol. 4:2072-2081; Hermonat & Muzyczka (1984) PNAS 81:6466-6470; and Samulski, et al. (1989) J. Virol. 63:03822-3828. Any AAV serotype can be used, including AAV1, AAV3, AAV4, AAV5, AAV6 and AAV8, AAV 8.2, AAV9, and AAV rh10 and pseudotyped AAV such as AAV2/8, AAV2/5 and AAV2/6.

(172) At least six viral vector approaches are currently available for gene transfer in clinical trials, which utilize approaches that involve complementation of defective vectors by genes inserted into helper cell lines to generate the transducing agent.

(173) pLASN and MFG-S are examples of retroviral vectors that have been used in clinical trials (Dunbar, et al. (1995) Blood 85:3048-305; Kohn, et al. (1995) Nat. Med. 1:1017-102; Malech, et al. (1997) PNAS 94:22 12133-12138). PA317/pLASN was the first therapeutic vector used in a gene therapy trial. (Blaese, et al. (1995) Science 270:475-480 (1995)). Transduction efficiencies of 50% or greater have been observed for MFG-S packaged vectors. (Ellem, et al. (1997) Immunol Immunother. 44(1):10-20; Dranoff et al. (1997) Hum. Gene Ther. 1:111-2.

(174) Recombinant adeno-associated virus vectors (rAAV) are a promising alternative gene delivery systems based on the defective and nonpathogenic parvovirus adeno-associated type 2 virus. All vectors are derived from a plasmid that retains only the AAV 145 base pair (bp) inverted terminal repeats flanking the transgene expression cassette. Efficient gene transfer and stable transgene delivery due to integration into the genomes of the transduced cell are key features for this vector system. (Wagner, et al. (1998) Lancet 351:9117 1702-3; Kearns, et al. (1996) Gene Ther. 9:748-55). Other AAV serotypes, including AAV1, AAV3, AAV4, AAV5, AAV6, AAV8, AAV9 and AAVrh10, and all variants thereof, can also be used in accordance with the present invention.

(175) Replication-deficient recombinant adenoviral vectors (Ad) can be produced at high titer and readily infect a number of different cell types. Most adenovirus vectors are engineered such that a transgene replaces the Ad E1a, E1b, and/or E3 genes; subsequently the replication defective vector is propagated in human 293 cells that supply deleted gene function in trans. Ad vectors can transduce multiple types of tissues in vivo, including non-dividing, differentiated cells such as those found in liver, kidney and muscle. Conventional Ad vectors have a large carrying capacity. An example of the use of an Ad vector in a clinical trial involved polynucleotide therapy for anti-tumor immunization with intramuscular injection (Sterman, et al. (1998) Hum. Gene Ther. 7:1083-9). Additional examples of the use of adenovirus vectors for gene transfer in clinical trials include Rosenecker, et al. (1996) Infection 24:1 5-10; Sterman, et al. (1998) Hum. Gene Ther. 9(7):1083-1089; Welsh, et al. (1995) Hum. Gene Ther. 2:205-18; Alvarez, et al. (1997) Hum. Gene Ther. 5:597-613; Topf, et al. (1998) Gene Ther. 5:507-513; Sterman, et al. (1998) Hum. Gene Ther. 7:1083-1089.

(176) Packaging cells are used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and ψ2 cells or PA317 cells, which package retrovirus. Viral vectors used in gene therapy are usually generated by a producer cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host (if applicable), other viral sequences being replaced by an expression cassette encoding the protein to be expressed. The missing viral functions are supplied in trans by the packaging cell line. For example, AAV vectors used in gene therapy typically only possess inverted terminal repeat (ITR) sequences from the AAV genome which are required for packaging and integration into the host genome. Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences. The cell line is also infected with adenovirus as a helper. The helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid. The helper plasmid is not packaged in significant amounts due to a lack of ITR sequences. Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV.

(177) In many gene therapy applications, it is desirable that the gene therapy vector be delivered with a high degree of specificity to a particular tissue type. Accordingly, a viral vector can be modified to have specificity for a given cell type by expressing a ligand as a fusion protein with a viral coat protein on the outer surface of the virus. The ligand is chosen to have affinity for a receptor known to be present on the cell type of interest. For example, Han, et al. (1995) Proc. Natl. Acad. Sci. USA 92:9747-9751, reported that Moloney murine leukemia virus can be modified to express human heregulin fused to gp70, and the recombinant virus infects certain human breast cancer cells expressing human epidermal growth factor receptor. This principle can be extended to other virus-target cell pairs, in which the target cell expresses a receptor and the virus expresses a fusion protein comprising a ligand for the cell-surface receptor. For example, filamentous phage can be engineered to display antibody fragments (e.g., FAB or Fv) having specific binding affinity for virtually any chosen cellular receptor. Although the above description applies primarily to viral vectors, the same principles can be applied to nonviral vectors. Such vectors can be engineered to contain specific uptake sequences which favor uptake by specific target cells.

(178) Gene therapy vectors can be delivered in vivo by administration to an individual subject, typically by systemic administration (e.g., intravenous, intraperitoneal, intramuscular, subdermal, sublingual or intracranial infusion) topical application, as described below, or via pulmonary inhalation. Alternatively, vectors can be delivered to cells ex vivo, such as cells explanted from an individual patient (e.g., lymphocytes, bone marrow aspirates, tissue biopsy) or universal donor hematopoietic stem cells, followed by reimplantation of the cells into a patient, usually after selection for cells which have incorporated the vector.

(179) Vectors (e.g., retroviruses, adenoviruses, liposomes, etc.) containing nucleases and/or donor constructs can also be administered directly to an organism for transduction of cells in vivo. Alternatively, naked DNA can be administered. Administration is by any of the routes normally used for introducing a molecule into ultimate contact with blood or tissue cells including, but not limited to, injection, infusion, topical application, inhalation and electroporation. Suitable methods of administering such nucleic acids are available and well known to those of skill in the art, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective reaction than another route.

(180) Vectors suitable for introduction of polynucleotides described herein include non-integrating lentivirus vectors (IDLV). See, for example, Ory, et al. (1996) Proc. Natl. Acad. Sci. USA 93:11382-11388; Dull, et al. (1998) J. Virol. 72:8463-8471; Zuffery, et al. (1998) J. Virol. 72:9873-9880; Follenzi, et al. (2000) Nature Genetics 25:217-222; U.S. Pat. No. 8,936,936.

(181) Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions available, as described below (see, e.g., Remington's Pharmaceutical Sciences, 17th ed., 1989).

(182) It will be apparent that the nuclease-encoding sequences and donor constructs can be delivered using the same or different systems. For example, a donor polynucleotide can be carried by an AAV, while the one or more nucleases can be carried by mRNA. Furthermore, the different systems can be administered by the same or different routes (intramuscular injection, tail vein injection, other intravenous injection, intraperitoneal administration and/or intramuscular injection. Multiple vectors can be delivered simultaneously or in any sequential order.

(183) Formulations for both ex vivo and in vivo administrations include suspensions in liquid or emulsified liquids. The active ingredients often are mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients include, for example, water, saline, dextrose, glycerol, ethanol or the like, and combinations thereof. In addition, the composition may contain minor amounts of auxiliary substances, such as, wetting or emulsifying agents, pH buffering agents, stabilizing agents or other reagents that enhance the effectiveness of the pharmaceutical composition.

(184) Applications

(185) The methods and compositions disclosed herein are for providing therapies for cancers, inflammatory disorders and other diseases, for example via the provision of proteins that modulate T-cell responsiveness. The cell may be modified in vivo or may be modified ex vivo and subsequently administered to a subject. Thus, the methods and compositions provide for the treatment and/or prevention of a disorder.

(186) Targeted integration of a transgene (e.g., CAR transgene, HLA gene, engineered or exogenous TCR gene or ACTR) may be used to correct an aberrant CISH-related gene, insert a wild type gene (e.g., therapeutic proteins), or change the expression of an endogenous gene. For instance, a transgene encoding a CAR may be integrated into a cell to provide a cell that produces a functional CAR protein. Genomic editing may also include correction of mutations (e.g., point mutations) in a faulty endogenous gene, thereby resorting expression of the gene and treating the disorder.

(187) In certain embodiments, one or more CARs are integrated into the CISH gene. CAR transgenes are known in the art and comprise extracellular single chain variable fragment (scFv) with specificity for a particular antigen linked to an intracellular signaling part comprising a costimulatory domain and an activating domain. The costimulatory domain can be derived from, e.g., CD28, and the activating domain can be derived from, e.g., CD3-zeta. CAR transgenes may include two, three, four, or more costimulatory domains. The CAR scFv can be designed to target, for example, CD19, which is a transmembrane protein expressed by cells in the B cell lineage, including all normal B cells and B cell malignances, including but not limited to NHL, CLL, and non-T cell ALL. See, e.g., U.S. Pat. No. 9,855,298. In addition to or instead of the CAR transgene(s), one or more HLA, B2M and/or other immunomodulatory proteins may be integrated into the CISH gene, including but not limited to fusions of B2M and HLA-G and/or HLA-E as described in U.S. patent application Ser. No. 16/058,307 filed Aug. 8, 2018.

(188) By way of non-limiting example, the methods and compositions described herein can be used for treatment and/or prevention of cancers such as B cell leukemias and/or inflammatory diseases such as colitis.

(189) The following Examples relate to exemplary embodiments of the present disclosure in which the nuclease comprises a zinc finger nuclease (ZFN). It will be appreciated that this is for purposes of exemplification only and that other nucleases can be used, for example TALEN, TtAgo and CRISPR/Cas systems, homing endonucleases (meganucleases) with engineered DNA-binding domains and/or fusions of naturally occurring of engineered homing endonucleases (meganucleases) DNA-binding domains and heterologous cleavage domains and/or fusions of meganucleases and TALE proteins. For instance, additional nucleases may be designed to bind to a sequence comprising 9 to 12 contiguous nucleotides of the sequences disclosed herein (e.g., Table 2).

EXAMPLES

Example 1: Zinc Finger Protein Nucleases (ZFN) Targeted to CISH

(190) Zinc finger proteins targeted to CISH were designed and incorporated into mRNA, plasmids, AAV or adenoviral vectors essentially as described in Urnov, et al. (2005) Nature 435(7042):646-651, Perez, et al. (2008) Nature Biotechnology 26(7):808-816, and as described in U.S. Pat. No. 6,534,261. Table 1 shows the recognition helices within the DNA binding domain of exemplary CISH ZFP DNA-binding domains and the target sites for these ZFPs (DNA target sites indicated in uppercase letters; non-contacted nucleotides indicated in lowercase). Nucleotides in the target site that are contacted by the ZFP recognition helices are indicated in uppercase letters; non-contacted nucleotides indicated in lowercase. TALENs and/or sgRNAs are also designed to the CISH sequences shown in Table 2 (e.g., a target site comprising 9 to 20 or more (including 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or more) nucleotides (contiguous or non-contiguous) of the target sites shown in Table 2 following methods known in the art. See, e.g., U.S. Pat. No. 8,586,526 (using canonical or non-canonical RVDs for TALENs) and U.S. Patent Publication No. 2015/0056705.

(191) TABLE-US-00002 TABLE 1  CISH Zinc finger proteins recognition helix designs Design SBS # Linker F1 F2 F3 F4 FS F6 59488 L0 RSDHLSQ QNATRTK RSDNLSE KRCNLRC DRSTRTK RRDNLHS (SEQ ID (SEQ ID (SEQ ID (SEQ D (SEQ ID (SEQ ID NO: 2) NO: 3) NO: 4) NO: 5) NO: 6) NO: 7) 59489 L0 GHTSLKR TSGHLSR RSDNLAR QNVSRPR TSGHLSR QSGHLSR (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 8) NO: 9) NO: 10) NO: 11) NO: 9) NO: 12) 59440 L0 RWQYLPT DRSALAR RSDNLAR DRSNLTR QSGNLAR ATCCLAH (SEQ ID  (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 13) NO: 14) NO: 10) NO: 15) NO: 16) NO: 17) 59441 L0 RSDDLTR QAATLSR RSDHLSA DRSDLSR RSDDLTR DRSHLAR (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 18) NO: 19) NO: 20) NO: 21) NO: 18) NO: 22) 59558 N6a QSGDLTR QSGNLHV QSGHLAR NRYDLMT RSDSLLR CREYRGK (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 23) NO: 24) NO: 25) NO: 26) NO: 27) NO: 28) 59557 L0 QSSHLTR QSSDLTR QSGNLAR RLDILQQ RSDNLST DNSYLPR (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 29) NO: 30) NO: 16) NO: 31) NO: 32) NO: 33) 59581 N7a DRSNLSR LRQDLKR RSDNLST DNSNRIN QSSDLSR WKWNLRA (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 34) NO: 35) NO: 32) NO: 36) NO: 37) NO: 38) 59580 L0 RSDSLLR CREYRGK QSGHLAR QKGTLGE RSDNLST QSGHLSR   (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 27) NO: 28) NO: 25) NO: 39) NO: 32) NO: 12)

(192) TABLE-US-00003 TABLE 2  Target Sites of zinc finger proteins SBS # Target site 59488 5′ ggAAGGCCcCAGCAGGCAAGGgctgcat (SEQ ID NO: 40) 59489 5′ gaGGAGGT9GCAGAGGGTACCccagccc (SEQ ID NO: 41) 59440 5′ ccAGCAAAgGACGAGGTCTAGaaggcag (SEQ ID NO: 42) 59441 5′ gtGGAGCGGACTGGGCAGCGgcccctgt (SEQ ID NO: 43) 59558 5′ gaTGCGTGgCCTGGACAAGCAgttggag (SEQ ID NO: 44) 59557 5′ gaGTCCAGACGGAAGCTGGAgtcggcat (SEQ ID NO: 45) 59581 5′ atAGTGCTgCACAAGGCTGACcacatcc (SEQ ID NO: 46) 59580 5′ ccGGAAAGgCCAGGATGCGTGgcctgga (SEQ ID NO: 47)

(193) All ZFN pairwise combinations were tested for cleavage activity Activated T cells were electroporated with mRNAs encoding CISH targeting ZFNs over a range of mRNA (0.5 μg to 6 μg per 3E6 T cell in a 100 uL transfection reaction). T cells were expanded for 3-4 days post transfection, genomic DNA were harvested and CISH editing efficiency is assessed by deep sequencing. All pairs were found to be active as shown in Table 3 (where the percent cleavage is shown with the indicated pairs at the indicated dosage, for example 89% cleavage of the CISH gene using pair 59488/59489 using 6 μg mRNA).

(194) TABLE-US-00004 TABLE 3 Nuclease-mediated cleavage ZFN pairs 6 μg 2 μg 0.5 μg Exon 2 59488 59489 89 84 60 59440 59441 84 82 59 Exon 3 59558 59557 84 80 55 59581 59580 82 83 72

(195) It will be apparent that these designs may include any linker between any of the finger modules and/or between the ZFP and the cleavage domain, including but not limited to canonical or non-canonical linkers (between fingers) and/or linkers between the ZFP and cleavage domain as described in U.S. Pat. No. 9,394,531. See, also, U.S. Pat. No. 8,772,453 and U.S. Patent Publication No. 2015/0064789.

(196) Furthermore, any of the nucleases (ZFNs, CRISPR/Cas systems and TALENs) can include engineered cleavage domains, for example heterodimers disclosed in U.S. Pat. No. 8,623,618 (e.g., ELD and KKR engineered cleavage domains) and/or cleavage domains with more or more mutations in positions 416, 422, 447, 448, and/or 525 as described in U.S. Patent Publication No. 2018/0087072. ZFNs may also include one or more mutations in the backbone residues of the ZFP as described in U.S. Patent Publication No. 2018/0087072. These mutants were used in conjunction with the exemplary DNA-binding domains described herein.

Example 2: Targeted CISH Donor Insertion

(197) Targeted integration into the CISH locus was also performed using an AAV GFP donor. First, an AAV GFP donor was constructed to encode a GFP expression cassette that is flanked by homology arms 5′ and 3′ to the CISH cleavage site. When cells are treated with the CISH targeted ZFN and co-administer with the AAV donor, the flanking homology arms are necessary to mediate targeted insertion of the GFP expression cassette into the CISH cleavage site via the homology directed repair pathway. In this experiment, activated T cells are electroporated with CISH mRNA, and co-administer with the AAV GFP donor. Targeted integration efficiency was assessed 7 days later by FACS analysis of % GFP positive cells.

(198) As shown in FIGS. 2 and 3, FACS analysis for GFP expression showed that at least 70% efficiency of donor (GFP) insertion was obtained in cells receiving both CISH targeted nucleases as described herein and the donor.

Example 3: Enhanced Immunostimulatory Activation Following Donor Insertion at CISH Compared to AAVS1 Safe Harbor Locus

(199) Targeted integration into the CISH or AAVS1 locus was also performed using an AAV GFP donor. First, an AAV GFP donor was constructed to encode a GFP expression cassette that is flanked by homology arms 5′ and 3′ to the CISH or AAVS1 cleavage site. When cells are treated with the CISH or AAVS1 targeted ZFNs (CISH-specific ZFNs: SB59440/SB59441 (as shown in Table 1 above); AAVS1-specific ZFNs (comprising ZFPs designated SB30054 and SB30035 as described in U.S. Pat. No. 9,957,526) and co-administered with the corresponding AAV donor, the flanking homology arms are necessary to mediate targeted insertion of the GFP expression cassette into the CISH or AAVS1 cleavage site via the homology directed repair pathway. In this experiment, activated effector T cells are electroporated with CISH or AAVS1 ZFN mRNA, and co-administer with the corresponding AAV GFP donor. Genome modification efficient was assessed 7 days later by Miseq analysis.

(200) As shown in FIG. 5, high levels of genome modification efficiency was obtained in cells receiving both CISH or AAVS1 targeted nucleases as described herein and the AAV GFP donor. FIG. 6 demonstrates that targeted integration of the GFP donor at CISH enhances effector T cell immunostimulatory function upon TCR-mediated activation, presumably due to knockout of CISH, a member of the suppressor of cytokine signaling (SOCS) family, expression.

Example 4: Ex Vivo Methods

(201) The genetically modified cells (e.g., T-cells or hematopoietic stem cells) as described herein, comprising a transgene integrated into the CISH gene (e.g., a CAR and/or other therapeutic transgene) are administered to patients with a cancer or an inflammatory disorder. Administration (single or multiple dosing) of the cells is any method known in cell therapy. The disease or disorder (or symptoms thereof) is ameliorated following administration.

(202) All patents, patent applications and publications mentioned herein are hereby incorporated by reference in their entirety.

(203) Although disclosure has been provided in some detail by way of illustration and example for the purposes of clarity of understanding, it will be apparent to those skilled in the art that various changes and modifications can be practiced without departing from the spirit or scope of the disclosure. Accordingly, the foregoing descriptions and examples should not be construed as limiting.