Therapeutic agents comprising nucleic acids and CAR-modified immune cells, and uses thereof
12329826 ยท 2025-06-17
Assignee
Inventors
- Fang HU (Zhejiang, CN)
- Can CHEN (Zhejiang, CN)
- Lin XIAO (Zhejiang, CN)
- Jin FU (Zhejiang, CN)
- Rong ZHANG (Zhejiang, CN)
- Jinlu CAI (Zhejiang, CN)
Cpc classification
A61K35/17
HUMAN NECESSITIES
A61K48/0058
HUMAN NECESSITIES
A61K38/1774
HUMAN NECESSITIES
A61K40/11
HUMAN NECESSITIES
A61K47/6891
HUMAN NECESSITIES
C12N5/0638
CHEMISTRY; METALLURGY
A61K40/15
HUMAN NECESSITIES
A61K2239/59
HUMAN NECESSITIES
A61K2239/38
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
A61K40/11
HUMAN NECESSITIES
A61K40/15
HUMAN NECESSITIES
A61K47/68
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
Provided are therapeutic agent including nucleic acid and CAR-modified immune cell and the use thereof. The therapeutic agent comprises first composition and second composition, the first composition comprises a nucleic acid having a labeling polypeptide coding sequence for being introduced into a tumor cell and/or a cancer cell; the labeling polypeptide has an extracellular antigen determining region, a spacer portion, and a transmembrane portion that are operatively linked, which can be expressed to form modification on the surface of the tumor cell and/or cancer cell; the extracellular antigen determining region comprises one or more epitope polypeptides; wherein, amino acid sequences of proteins on cell membrane or secreted proteins of mammal do not comprise the epitope polypeptide amino acid sequence in the natural state; the second composition comprises chimeric antigen receptor modified immune cell which specifically recognize and bind to the extracellular antigen determining region. The therapeutic agent achieves synergistic therapeutic effect.
Claims
1. A therapeutic agent for treatment of tumors and/or cancers, comprising: (a) a first composition, wherein the first composition comprises a first active ingredient in a first pharmaceutically acceptable carrier, and the first active ingredient includes or contains a nucleic acid having a labeling polypeptide coding sequence for being introduced into a tumor cell and/or a cancer cell; the labeling polypeptide has a extracellular antigen determining region, a spacer portion and a transmembrane portion that are operatively linked, which can be expressed to form modification on the surface of the tumor cell and/or cancer cell; an amino acid sequence of the extracellular antigen determining region comprises one or more amino acid sequences of epitope polypeptide; and wherein, in the natural state, an amino acid sequence of a protein on cell membrane or a secreted protein of mammal does not comprise the amino acid sequence of the epitope polypeptide; and (b) a second composition, wherein the second composition comprises a second active ingredient in a second pharmaceutically acceptable carrier, and the second active ingredient comprises a chimeric antigen receptor-modified immune cell; the chimeric antigen receptor-modified immune cell can specifically recognize and bind to the extracellular antigen determining region of the labeling polypeptide; wherein the spacer portion is derived from the hinge region of CD8, the hinge region of IgG or the hinge region of IgD; wherein the amino acid sequence of the epitope polypeptide includes an amino acid sequence of the following tags: Myc tag, HA tag, Strep tag II, Flag tag, HAT tag, S tag, S1 tag, protein C tag, tag-100 tag, E2 tag, TAP tag, HSV tag, KT3 tag, V5 tag, VSV-G tag, His tag or RFP tag; and wherein the amino acid sequence of the extracellular antigen determining region is as shown in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 5.
2. The therapeutic agent of claim 1, wherein an amino acid sequence of the spacer portion is as shown in SEQ ID NO: 6; wherein the transmembrane portion is derived from the transmembrane region of CD8, CD3, CD4 or CD28.
3. The therapeutic agent of claim 1, wherein an amino acid sequence of the labeling polypeptide is as shown in SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14 or SEQ ID NO: 15.
4. The therapeutic agent of claim 1, wherein the nucleic acid includes DNA or RNA; and the RNA includes mRNA transcribed from the DNA; wherein the first composition comprises a therapeutically effective amount of the DNA or a therapeutically effective amount of the mRNA; and wherein the DNA is formulated to be administered by intratumoral injection or intravenously; and the mRNA is formulated to be administered by intratumoral injection or intravenously.
5. The therapeutic agent of claim 1, wherein the first active ingredient is a recombinant virus, and the genome of the recombinant virus has the labeling polypeptide coding sequence; wherein the recombinant virus includes replication-selective recombinant oncolytic virus or replication-defective recombinant virus; wherein the first composition comprises a therapeutically effective amount of the recombinant virus; and wherein the recombinant virus is formulated to be administered by intratumoral injection or intravenously.
6. The therapeutic agent of claim 5, wherein the recombinant oncolytic virus is derived from a genetically mutated virus with oncolytic effect or a wild-type virus with oncolytic effect.
7. The therapeutic agent of claim 1, wherein a chimeric antigen receptor of the chimeric antigen receptor-modified immune cell includes an antigen-binding domain, a spacer region, a transmembrane region and an intracellular domain that are operatively and orderly linked, and the antigen-binding domain can specifically recognize and bind to the extracellular antigen determining region of the labeling polypeptide.
8. The therapeutic agent of claim 5, wherein the recombinant oncolytic virus is derived from adenovirus, poxvirus, herpes simplex virus, measles virus, Semliki forest virus, vesicular stomatitis virus, polio virus, retrovirus, reovirus, Seneca valley virus, Echo-type enterovirus, Coxsackie virus, Newcastle disease virus and Malaba virus with oncolytic effect.
9. The therapeutic agent of claim 7, wherein an amino acid sequence of the antigen-binding domain is as shown in SEQ SEQ ID NO: 44.
10. The therapeutic agent of claim 7, wherein the intracellular domain is derived from a lymphocyte intracellular activation signal transduction region, wherein the intracellular activation signal transduction region is selected from an intracellular activation signal transduction region of CD3 or DAP12.
11. The therapeutic agent of claim 7, wherein the spacer region is derived from a hinge region of CD8, a hinge region of IgG or a hinge region of IgD, and a transmembrane region is derived from a transmembrane region of CD8, CD3, CD4 or CD28.
12. The therapeutic agent of claim 7, wherein the intracellular domain is derived from a lymphocyte intracellular activation signal transduction region and a lymphocyte costimulatory signal transduction region, wherein the intracellular activation signal transduction region is selected from an intracellular activation signal transduction region of CD3 or DAP12; the lymphocyte costimulatory signal transduction region is selected from a costimulatory signal transduction region of 4-1BB, CD28, CD27, OX40, GITR, and/or ICOSS.
13. The therapeutic agent of claim 7, wherein the amino acid sequence of the chimeric antigen receptor is as shown in SEQ ID NO: 48.
14. The therapeutic agent of claim 1, wherein the immune cells include T cells or NK cells.
15. The therapeutic agent of claim 1, wherein the first composition and the second composition are present separately in the therapeutic agent without being mixed together.
16. The therapeutic agent of claim 1, wherein the second composition comprises a therapeutically effective amount of the chimeric antigen receptor-modified immune cell; and wherein the chimeric antigen receptor-modified immune cell is formulated to be administered intravenously or locally.
17. The therapeutic agent of claim 1, wherein an amino acid sequence of the transmembrane portion is as shown in SEQ ID NO: 7.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
DETAILED DESCRIPTION
(20) The present disclosure is further explained with the following detailed description of preferred embodiments with references to the accompanying drawings, which is not to be taken in a limiting sense, and it will be apparent to those skilled in the art that various modifications or improvements can be made accordingly without departing from the spirit of the present disclosure and these are therefore within the scope of the present disclosure.
(21) The present inventor was aware of the above-mentioned defects in the prior art and designed a labeling polypeptide through theoretical research and experimental verification. The labeling polypeptide can be expressed to form modification on the surface of the tumor cells and/or cancer cells and has an extracellular antigen determining region. The present invention also proposes a strategy that uses the labeling polypeptide to label the tumor cells and/or cancer cells and combines CAR-modified immune cells that recognize the labeling polypeptide, so as to effectively solve the problems of the expression heterogeneity of tumor (especially solid tumors) antigen and evasion of tumor cells and/or cancer cells from immune surveillance, improve the recognition sensitivity of CAR-modified immune cells on tumor cells and/or cancer cells and effectively reduce the risk of targeting/off-target toxicity, thereby improving the efficacy of CAR-modified immune cells in killing tumor cells.
(22) Specifically, one aspect of the present invention provides a therapeutic agent for the treatment of tumors and/or cancers, comprising: (a) a first composition, wherein the first composition comprises a first active ingredient in a first pharmaceutically acceptable carrier, and the first active ingredient includes or contains a nucleic acid having a labeling polypeptide coding sequence for being introduced into a tumor cell and/or a cancer cell; the labeling polypeptide has a extracellular antigen determining region, a spacer portion and a transmembrane portion that are operatively linked, which can be expressed to form modification on the surface of the tumor cell and/or cancer cell; the amino acid sequence of the extracellular antigen determining region comprises one or more amino acid sequences of epitope polypeptide; and wherein, in the natural state, the amino acid sequence of a protein on cell membrane or a secreted protein of mammal does not comprise the amino acid sequence of the epitope polypeptide; and (b) a second composition, wherein the second composition comprises a second active ingredient in a second pharmaceutically acceptable carrier, and the second active ingredient comprises a chimeric antigen receptor-modified immune cell; the chimeric antigen receptor-modified immune cell can specifically recognize and bind to the extracellular antigen determining region of the labeling polypeptide.
(23) The active ingredients in the therapeutic agent will be described in detail below.
(24) Labeling Polypeptide
(25) The present invention specifically designs the amino acid sequence of a labeling polypeptide which is used to modify the surface of tumor cells and/or cancer cells, wherein the labeling polypeptide has an extracellular antigen determining region, a spacer portion and a transmembrane portion that are operatively linked, and can be expressed to form modification on the surface of tumor cells and/or cancer cells; the amino acid sequence of the extracellular antigen determining region comprises one or more amino acid sequences of epitope polypeptide; wherein, in the natural state, the amino acid sequence of proteins on cell membrane or secreted proteins of mammal do not comprise the amino acid sequence of the epitope polypeptide.
(26) The term extracellular antigen determining region as used herein refers to the part of the labeling polypeptide that is located outside the cell membrane and contains the epitope polypeptide when it is expressed on the cell surface.
(27) Preferably, the amino acid sequence of the epitope polypeptide is derived from the amino acid sequence of a protein that exists in the nature, or is an artificially synthesized amino acid sequence that does not exists in the nature. The proteins that exist in the nature include mammalian intracellular proteins and proteins of organisms other than mammals. Proteins of organisms other than mammals include viral proteins, bacterial proteins, fungal proteins, protozoan proteins, plant proteins, and proteins of other animals except for mammals.
(28) In some embodiments of the present invention, the amino acid sequences of the epitope polypeptides are derived from the amino acid sequences of the following tags: Myc tag, HA tag, Strep tag II, Flag tag, HAT tag, S tag, S1 tag, Protein C tag, tag-100 tag, E2 tag, TAP tag, HSV tag, KT3 tag, V5 tag, VSV-G tag, His tag or RFP tag, etc.
(29) The amino acid sequences and nucleotide sequences of the above tags are known and available from public databases commonly used in the art.
(30) In a preferred embodiment of the present invention, the amino acid sequences of the epitope polypeptides are derived from the amino acid sequences of the following tags: human Myc tag (corresponding labeling polypeptide is denoted as TT1), influenza virus HA tag (corresponding labeling polypeptide is denoted as TT2), Strep tag II (corresponding labeling polypeptide is denoted as TT3). Further preferably, the amino acid sequence of the epitope polypeptide is consistent with the amino acid sequence of position 410 to 419 of the human Myc protein; or the amino acid sequence of the epitope polypeptide is consistent with the amino acid sequence of position 119 to 127 of the influenza virus HA protein, or the amino acid sequence of the epitope polypeptide is consistent with Strep tag II (for the detailed description of Strep tag II, see the document Molecular Interaction Between the Strep-tag Affinity Peptide and its Cognate Target, Streptavidin, Thomas G. M. Schmidt, Jurgen Koepke, Ronald Frank and Arne Skerra). In other embodiments of the present invention, the amino acid sequences of the epitope polypeptides of TT1 and TT2 can extend to upstream and downstream of the above sequence by no more than 10 amino acids, wherein, the amino acid sequence of the human Myc protein can be the amino acid sequence numbered P01106 isoform1 in UniProtKB, and the amino acid sequence of the influenza virus HA protein can be the amino acid sequence numbered Q03909 in UniProtKB.
(31) In a particular embodiment, the amino acid sequence of the extracellular antigen determining region of the labeling polypeptide comprises one or more amino acid sequences of the epitope polypeptide, wherein, when the amino acid sequence of the extracellular antigen determining region of the labeling peptide comprises a plurality of amino acid sequences of the epitope polypeptides, every two adjacent epitope polypeptides are operatively linked. For example, they may be connected by a linker or be connected directly without any linker. The amino acid sequence of the linker may be, for example, G (as used in labeling polypeptides C1&2a, C1&2b), GGS (as used in C1&2a, C1&2b), GGGGSGGGGS (as used in TT1-TT3).
(32) In order to enhance the immunogenicity of the labeling polypeptide, the extracellular antigen determining region of the labeling polypeptide preferably comprises n epitope polypeptides, where n is an integer greater than or equal to 1, for example, n=1, 2, 3, 4 . . . etc. Preferably, n is an integer of 1-10; it is also preferable that n is an integer of 2-5; and it is also preferable that n=2 or 3. For example, the extracellular antigen determining region of the labeling polypeptide may comprise 3 repeated epitope polypeptides derived from the Myc tag (see, for example, TT1), or comprise 3 repeated epitope polypeptides derived from the HA tag (see, for example, TT2), or comprise 3 repeated epitope polypeptides derived from the Strep tag II (see, for example, TT3), or comprise 3 repeated epitope polypeptides derived from the Myc tag and 3 repeated epitope polypeptides derived from the HA tag (see, for example, C1&2a), or comprise 2 repeated epitope polypeptides derived from the Myc tag and 2 repeated epitope polypeptides derived from HA Tag (see, for example, C1&2b).
(33) In one embodiment of the present invention, the amino acid sequences of the extracellular antigen determining regions are shown as SEQ ID NO: 1 (corresponding to TT1), SEQ ID NO: 2 (corresponding to TT2), SEQ ID NO: 3 (corresponding to TT3), SEQ ID NO: 4 (corresponding to C1&2a) and SEQ ID NO: 5 (corresponding to C1&2b).
(34) Preferably, the transmembrane portion is derived from the transmembrane region of CD8, CD3, CD4 or CD28 whose full-length amino acid sequence and nucleotide sequence are known and available from public databases commonly used in the art. More preferably, the transmembrane portion is derived from the transmembrane region of human CD8. Still more preferably, the amino acid sequence of the transmembrane portion comprises the amino acid sequence as shown in SEQ ID NO: 7. CD8 is a transmembrane glycosylated membrane protein composed of and subunits. It works with T cell surface receptor to make T cell to bind to specific antigen. CD8 specifically binds to MHC I and mediates the killing effect of cytotoxic T cells. The transmembrane region is usually a hydrophobic alpha helix that spans the cell membrane.
(35) In the labeling polypeptide of the present invention, the transmembrane portion and the extracellular antigen determining region can be connected by a spacer portion. The structure of this region should be flexible, so that the extracellular antigen determining region can be adapted to different directions to promote the recognition and binding of corresponding CAR. The simplest form of the spacer portion is the hinge region of immunoglobulin IgGI, and can also be a portion of immunoglobulin C.sub.H2C.sub.H3 region. The present invention has found through researches and experimentations that the spacer portion is preferably derived from the hinge region of CD8 and the transmembrane portion is preferably derived from the transmembrane region of CD8. Preferably, the amino acid sequence of the spacer portion is as shown in SEQ ID NO: 6. More preferably, the spacer portion and the transmembrane portion constitute a spacer transmembrane portion, and the amino acid sequence of the spacer transmembrane portion is consistent with the amino acid sequences of position Y to 210 of CD8, and 118Y 128, Y is an integer. Wherein, the UniProtKB number of the amino acid sequence of CD8 can be P01732. That is to say, the amino acid sequence of the spacer transmembrane portion is preferably selected from position 118 to 210 of CD8 and comprises the amino acids at position 128 to 210. For example, the amino acid sequence of the spacer transmembrane portion is shown as any one of the amino acid sequences selected from the following group:
(36) position 118 to 210, position 119 to 210, position 120 to 210, position 121 to 210, position 122 to 210, position 123 to 210, position 124 to 210, position 125 to 210, position 126 to 210, position 127 to 210, or position 128 to 210 of CD8.
(37) The terms spacer portion and transmembrane portion used herein are known in the art. For details, please refer to Immunology introductory theory, Yu Shanqian, Higher Education Press, 2008; and 'Immunobiology', Seventh edition, Kenneth Murphy, Paul Travers, Mark Walport, etc..
(38) In the nucleic acid having the labeling polypeptide coding sequence of the present invention, a signal peptide coding sequence is preferably comprised before the 5 end of the labeling polypeptide coding sequence, and the signal peptide has the function of guiding the secretion of the target protein to the cell surface. The present invention found that the combination of the extracellular antigen determining region with the signal peptide from the GM-CSF chain allow the labeling polypeptide to be expressed on the surface of tumor cells. The GM-CSF chain signal peptide is the leader sequence for targeting the labeling polypeptide of the present invention to the secretory pathway, the coding sequence of which is first translated into protein in the cell together with the coding sequence of the labeling polypeptide and guide the synthesized protein into intracellular secretion pathway. The signal peptide is removed before the labeling polypeptide is expressed on the cell surface. The full-length amino acid sequence and nucleotide sequence of the GM-CSF chain are known and available from public databases commonly used in the art. Preferably, the amino acid sequence of the signal peptide is selected from position 1 to 22 of human GM-CSF chain. More preferably, the amino acid sequence of the signal peptide is as shown in SEQ ID NO: 8. Wherein, the amino acid sequence of GM-CSF chain is derived from UniProtKB-P15509.
(39) In a specific embodiment of the present invention, the labeling polypeptide comprises the following amino acid sequences that are orderly and operatively linked: an extracellular antigen determining region (which comprises one or more amino acid sequences of the epitope polypeptide), spacer portion and transmembrane portion. In a more specific embodiment of the present invention, the amino acid sequence of the epitope polypeptide of the extracellular antigen determining region is derived from the amino acid sequence of the epitope polypeptide of the following peptide: Myc tag derived from the human intracellular protein Myc, HA tag derived from the HA protein of influenza virus, the artificially synthesized sequence Strep tag II that does not exists in the nature. The spacer portion is derived from the hinge region of human CD8, and the transmembrane portion is derived from the transmembrane region of human CD8.
(40) As mentioned above, the signal peptide is operatively linked with the extracellular antigen determining region, the extracellular antigen determining region is operatively linked with the spacer portion and the spacer portion is operatively linked with the transmembrane portion. For example, they may connect by a linker or connected directly without any linker. In an embodiment of the present invention, the signal peptide and the extracellular antigen determining region are connected by a linker, such as GAHADITS (as used in TT1-TT3), GAHAAQLTLTKGNK (as used in C1&2a), GAHA (as used in C1&2b). The extracellular antigen determining region and the spacer portion are connected by a linker, such as, -Ala-Ser- and G, and the spacer portion and the transmembrane portion are connected directly without a linker.
(41) The present invention further found that the labeling polypeptide can express two epitope polypeptides at the same time. Specifically, the present invention designed the labeling polypeptide C1&2a and its antigen determining region contains three repeats of Myc tag and three repeats of HA tag. The present invention also designed a labeling polypeptide C1&2b, the antigen determining region of which contains two repeats of Myc tag and two repeats of HA tag. In order to further stabilize the expression of the labeling polypeptide on the cell membrane surface, a TIGIT spacer was added to the spacer portion of C1&2b. The amino acid sequence of the added spacer is consistent with the amino acid sequence of position 24 to 140 of TIGIT. Wherein, the amino acid sequence of TIGIT is derived from UniProtKB-Q495A1. More preferably, the amino acid sequence of the added TIGIT spacer is as shown in SEQ ID NO: 9 and the amino acid sequence of the C1&2b spacer transmembrane portion is as shown in SEQ ID NO: 10.
(42) Preferably, the amino acid sequence of the labeling polypeptide is as shown in SEQ ID NO: 11 (corresponding to TT1), SEQ ID NO: 12 (corresponding to TT2), SEQ ID NO: 13 (corresponding to TT3), SEQ ID NO: 14 (corresponding to C1&2a) or SEQ ID NO: 15 (corresponding to C1&2b).
(43) TABLE-US-00001 SEQIDNO:11: GAHADITSEQKLISEEDLGGGGSGGGGSEQKLISEEDLGGGGSGGGGSEQKLISEEDLGG
wherein, the boldface shows the epitope polypeptide, the gray portion shows the spacer 10 portion from the CD8 hinge region, and the underline shows the transmembrane portion from the CD8 transmembrane region.
(44) TABLE-US-00002 SEQIDNO:12: GAHADITSYPYDVPDYAGGGGSGGGGSYPYDVPDYAGGGGSGGGGSYPYDVPDYAGGG
wherein, the boldface shows the epitope polypeptide, the gray shows the spacer portion from the CD8 hinge region, and the underline shows the transmembrane portion from the CD8 transmembrane region.
(45) TABLE-US-00003 SEQIDNO:13: GAHADITSNWSHPQFEKGGGGSGGGGSNWSHPQFEKGGGGSGGGGSNWSHPQFEKGG
wherein, the boldface shows the epitope polypeptide, the gray shows the spacer portion from the CD8 hinge region, and the underline shows the transmembrane portion from the CD8 25 transmembrane region.
(46) TABLE-US-00004 SEQIDNO:14: GAHAAQLTLTKGNKEQKLISEEDLGEQKLISEEDLGEQKLISEEDLGGSYPYDVPDYAGYPY
wherein, the boldface shows the epitope polypeptide, the gray shows the spacer portion from the CD8 hinge region, and the underline shows the transmembrane portion from the CD8 transmembrane region.
(47) TABLE-US-00005 SEQIDNO:15:
wherein, the boldface shows the epitope polypeptide, the dark gray shows the part from the TIGIT spacer in the spacer portion, the light gray shows the part from the CD8 hinge region in the spacer portion, and the underline shows the transmembrane portion from the CD8 transmembrane region.
Nucleic Acid Having Labeling Polypeptide Coding Sequence
(48) The labeling polypeptide coding sequence comprises an extracellular antigen determining region coding sequence, a spacer portion coding sequence and a transmembrane portion coding sequence, the extracellular antigen determining region coding sequence encodes the extracellular antigen determining region of the labeling polypeptide, the spacer portion coding sequence encodes the spacer portion of the labeling polypeptide and the transmembrane portion coding sequence encodes the transmembrane portion of the labeling polypeptide. The extracellular antigen determining region coding sequence comprises one or more coding sequences of epitope polypeptides; wherein, in natural state, the coding sequence of a protein on cell membrane or a secreted protein of mammalian does not comprise the coding sequence of the epitope polypeptide.
(49) In some embodiments of the present invention, the epitope polypeptide coding sequence is derived from the coding sequences of the following tags: Myc tag, HA tag, Strep tag II, Flag tag, HAT tag, S tag, S1 tag, protein C tag , Tag-100 tag, E2 tag, TAP tag, HSV tag, KT3 tag, V5 tags, VSV-G tag, His tag or RFP tag, etc.
(50) Preferably, the epitope polypeptide coding sequence is derived from the coding sequences of the following tags: the coding sequence of Myc tag, the coding sequence of HA tag, and the coding sequence of Strep tag II.
(51) In a specific embodiment, the coding sequence of the extracellular antigen determining region of the labeling polypeptide comprises one or more coding sequences of the epitope polypeptide, wherein when the coding sequence of the extracellular antigen determining region of the labeling polypeptide comprise a plurality of coding sequences of the epitope polypeptide, every two adjacent coding sequences of the epitope polypeptide are operatively linked. For example, they may be connected by a linker coding sequence or be connected directly without any linker coding sequence.
(52) As mentioned above, in order to enhance the immunogenicity of the labeling polypeptide, the extracellular antigen determining region of the labeling polypeptide preferably comprises n epitope polypeptides, where n is an integer greater than or equal to 1, for example, n=1, 2, 3, 4, etc. Preferably, n is an integer of 1-10; it is also preferable that n is an integer of 2-5; and it is also preferable that n=2 or 3. For example, the extracellular antigen determining region of the labeling polypeptide may include three repeated epitope polypeptides derived from human Myc protein, or two repeated epitope polypeptides derived from influenza virus HA protein. Therefore, the coding sequence of the extracellular antigen determining region of the labeling polypeptide preferably comprises 3 repeats or 2 repeats of the coding sequence of the epitope polypeptide correspondingly.
(53) In a preferred embodiment of the present invention, the nucleotide sequence of the coding sequence of the extracellular antigen determining region is as shown in SEQ ID NO: 16 (corresponding to TT1), SEQ ID NO: 17 (corresponding to TT2), SEQ ID NO: 18 (corresponding to TT3), SEQ ID NO: 19 (corresponding to C1&2a) or SEQ ID NO: 20 (corresponding to C1&2b).
(54) Preferably, the transmembrane portion coding sequence is derived from the coding sequence of the transmembrane region of CD8, CD3, CD4 or CD28. More preferably, the transmembrane portion coding sequence is derived from the coding sequence of the transmembrane region of human CD8. Still more preferably, the nucleotide sequence of the coding sequence of the transmembrane portion comprises the nucleotide sequence as shown in SEQ ID NO:21.
(55) In the labeling polypeptide coding sequence, the transmembrane portion coding sequence and the extracellular antigen determining region coding sequence may be connected by the spacer portion coding sequence. The simplest form of the spacer portion is the hinge region of immunoglobulin IgGI, and it can also be a portion of C.sub.H2C.sub.H3 region of immunoglobulin. The present invention found through researches and experimentations that the coding sequence of the spacer portion is preferably derived from the coding sequence of the hinge region of CD8, and the coding sequence of the transmembrane portion is preferably derived from the coding sequence of the transmembrane region of CD8. Preferably, the nucleotide sequence of the coding sequence of the spacer portion is as shown in SEQ ID NO: 22. More preferably, the coding sequence of the spacer portion and the coding sequence of the transmembrane region portion constitute the coding sequence of the spacer transmembrane portion, and the spacer portion and the transmembrane portion may be connected directly without a linker.
(56) In the nucleic acid having the labeling polypeptide coding sequence of the present invention, a signal peptide coding sequence is preferably comprised before the 5 end of the labeling polypeptide coding sequence and the signal peptide coding sequence encodes the signal peptide. The signal peptide has the function of guiding the secretion of the target protein to the cell surface, which is the leader sequence for targeting the labeling polypeptide of the present invention to the secretory pathway. The coding sequence thereof is first translated into a protein in the cell together with the coding sequence of the labeling polypeptide to guide the synthesized protein enter into the intracellular secretory pathway. The signal peptide is removed before the labeling polypeptide is expressed on the cell surface.
(57) Preferably, the nucleotide sequence of the signal peptide coding sequence is derived from the signal peptide coding sequence of human GM-CSF chain. More preferably, the nucleotide sequence of the signal peptide coding sequence is as shown in SEQ ID NO: 23.
(58) In a specific embodiment of the present invention, the nucleic acid having the labeling polypeptide coding sequence comprises the following coding sequences operatively and orderly linked: a signal peptide coding sequence, an extracellular antigen determining region coding sequence (which comprises one or more the coding sequence(s) of the epitope polypeptide(s)), the spacer portion coding sequence and the transmembrane portion coding sequence. In a more specific embodiment of the present invention, the coding sequence of the epitope polypeptide of the extracellular antigen determining region is derived from the coding sequence of the following tags: Myc tag, HA tag or Strep tag II; the signal peptide coding sequence is derived from the coding sequence of the signal peptide of human GM-CSF chain; the spacer portion coding sequence is derived from the coding sequence of the hinge region of human CD8, and the transmembrane portion coding sequence is derived from the coding sequence of the transmembrane region of human CD8.
(59) As mentioned above, the signal peptide coding sequence and the extracellular antigen determining region coding sequence, the extracellular antigen determining region coding sequence and the spacer portion coding sequence, the spacer portion coding sequence and the transmembrane portion coding sequence are operatively linked, for example, they may be connected by a linker coding sequence or be connected directly without any linker coding sequence. In one embodiment of the present invention, the signal peptide coding sequence and the extracellular antigen determining region coding sequence are connected by a linker coding sequence, such as GGCGCGCATGCCGACATTACTAGT (as used in any one of the nucleic acids having the TT1-TT3 coding sequence, respectively), GGCGCGCATGCCGCTCAGTTGACATTGACGAAGGGCAATAAA (as used in the nucleic acid having C1&2a coding sequence), GGCGCGCATGCC (as used in the nucleic acid having C1&2b coding sequence). The extracellular antigen determining region coding sequence and the spacer portion coding sequence are connected by a linker coding sequence, such as GCTAGC, GGG. The spacer portion coding sequence and the transmembrane portion coding sequence are connected directly without a linker coding sequence.
(60) Preferably, a TIGIT spacer region coding sequence is added to the C1&2b spacer portion coding sequence, wherein the TIGIT spacer region coding sequence encodes the amino acid of position 24 to 140 of TIGIT, wherein, the amino acid sequence of TIGIT is derived from UniProtKB-Q495A1. Preferably, the TIGIT spacer region coding sequence comprises the nucleotide sequence as shown in SEQ ID NO: 24. Preferably, the coding sequence of the spacer transmembrane portion of C1&2b comprises the nucleotide sequence as shown in SEQ ID NO:25.
(61) Preferably, the nucleotide sequence of the nucleic acid having the labeling polypeptide coding sequence is as shown in SEQ ID NO: 26 (corresponding to TT1), SEQ ID NO: 27 (corresponding to TT2), SEQ ID NO: 28 (corresponding to TT3), SEQ ID NO: 29 (corresponding to C1&2a) or SEQ ID NO: 30 (corresponding to C1&2b).
(62) Preferably, the nucleic acid having the labeling polypeptide coding sequence includes DNA or RNA; and the RNA includes mRNA transcribed from the DNA.
(63) Preferably, the nucleic acid comprises in sequence an operatively linked promoter and the labeling polypeptide coding sequence. Examples of the promoter include any promoters known in the art for promoting the transcription of downstream DNA sequence, such as CMV promoter, T7 promoter and the like.
(64) Recombinant Virus
(65) In one embodiment of the present invention, the first active ingredient is a recombinant virus and the genome thereof has a promoter, a signal peptide coding sequence and the labeling polypeptide coding sequence that are orderly and operatively linked; wherein the recombinant virus includes replication-selective recombinant oncolytic virus or replication-deficient recombinant virus.
(66) Preferably, the recombinant oncolytic virus is derived from a genetically mutated virus with oncolytic effect and a wild-type virus with oncolytic effect; preferably, the recombinant oncolytic virus is derived from an adenovirus, poxvirus, herpes simplex virus, measles virus, Semliki forest virus, vesicular stomatitis virus, polio virus, retrovirus, reovirus, Seneca valley virus, Echo-type enterovirus, Coxsackie virus, Newcastle disease virus and Malaba virus with oncolytic effect.
(67) Oncolytic virus therapy has a long history. Many types of viruses have been modified for oncolytic virus development, including adenovirus, herpes virus, poxvirus, picornavirus, paramyxovirus, reovirus, parvovirus and rhabdovirus. Up to now, two oncolytic viruses (H101 and T-VEC) have been approved for clinical tumor treatment. Oncolytic viruses are artificially modified viruses whose pathogenic genes have been knocked out and are basically unable to replicate in normal tissue cells, but can selectively replicate in tumor cells to exert oncolytic effects. Take vaccinia virus as an example, oncolytic vaccinia virus is generally constructed by knocking out the endogenous thymidine kinase (TK) gene of vaccinia virus or double knocking out TK and vaccinia growth factor (VGF) genes using homologous recombination technique by means of genetic bioengineering. TK is one of the key enzymes in DNA synthesis. Vaccinia virus needs to use TK to form a high-concentration nucleic acid pool during the replication process to complete the smooth replication of progeny virus. Vaccinia virus often promotes the proliferation of the host and surrounding cells through VGF gene products, and achieves their own replication and proliferation, while the damage to normal cells of the vaccinia virus without the VGF gene is greatly reduced. Due to the deletion of TK and VGF genes, the ability of the virus to replicate in normal cells is restricted and the expression of exogenous gene inserted into oncolytic virus vectors will also be greatly restricted. However, TK gene is highly expressed in most of the environment of tumor cells, which provides a favorable environment for the replication and packaging of vaccinia viruses, so that vaccinia viruses have the functions of selectively replicating and oncolytic in tumor cells and allow the exogenous gene inserted into the tumor virus vector to be highly expressed, In addition to the direct oncolytic effect, oncolytic viruses can also make tumor cells release holographic tumor antigens to activate the inherent anti-tumor immunity of the body and at the same time have a certain regulatory effect on the tumor microenvironment.
(68) In the present invention, the labeling polypeptide coding sequence is inserted into the genome of the oncolytic virus, thereby introducing the labeling polypeptide coding nucleic acid into tumor cells and/or cancer cells, so that the oncolytic virus can kill tumor cells and/or cancer cells and at the same time the expression of exogenous epitope peptide on the surface of tumor cells is combined with the effect of CAR-modified immune cells to achieve a synergistic therapeutic effect. As the oncolytic virus destroys the tumor microenvironment, the tumor homing ability of CAR-modified immune cells is improved, thereby further enhancing the effectiveness of solid tumor treatment. In addition, CAR-modified immune cells can also effectively eliminate those tumor cells that after being infected by oncolytic viruses, cannot complete the replication cycle and produce a sufficient number of progeny viruses and thus cannot be lysed; thereby achieving further synergistic effect. In addition, the antigens released by the tumor cells lysed by the oncolytic virus can further activate the body's own anti-tumor immunity, which can achieve better tumor killing effects than using oncolytic viruses or CAR-modified immune cells alone, thereby achieving synergistic therapeutic effect.
(69) In one embodiment of the present invention, a nucleic acid (the nucleotide sequence of which may be, for example, any one of SEQ ID NOs: 26 -30) having the labeling polypeptide coding sequence is inserted into the genome of the obtained replication-selective recombinant oncolytic vaccinia virus.
(70) Preferably, the recombinant oncolytic virus is a recombinant oncolytic vaccinia virus that is functionally defective in the TK gene and the VGF gene. The TK gene can be functionally defective by inserting exogenous nucleotide sequences. The VGF gene can be functionally defective by gene knockout or inserting exogenous nucleotide sequences, but it is preferable to knock out the VGF gene.
(71) The term functional defect or functionally defective used herein when referring to the gene of an oncolytic virus means that the oncolytic virus is unable to exert the function that the gene should have, that is, the function is lost. This purpose can be achieved by, for example, inserting extraneous fragment into the gene or knocking out the gene.
(72) More preferably, the recombinant oncolytic vaccinia virus is Wyeth strain or WR strain.
(73) The labeling polypeptide coding sequence can be inserted into the TK gene to obtain the recombinant oncolytic virus of the present invention. The labeling polypeptide coding sequence can also be inserted into the VGF gene to obtain the recombinant oncolytic virus of the present invention.
(74) In a preferred embodiment, the recombinant oncolytic vaccinia virus is obtained by genetically modifying the VSC20 vaccinia virus which is a vaccinia virus with the VGF gene deleted. For preparation methods, please refer to the scientific literature: McCart, JA, et al. Systemic cancer therapy with a tumor-selective vaccinia virus mutant lacking thymidine kinase and vaccinia growth factor genes. Cancer Res (2001) 61: 8751-8757. The genetic modification includes inserting an exogenous labeling polypeptide coding sequence into the TK gene of the VSC20 vaccinia virus to make the TK gene functionally defective.
(75) The genome of the recombinant virus may also integrate other exogenous genes, such as exogenous screening gene which includes puromycin gene, gpt gene and/or LacZ gene. The exogenous screening gene can be knocked out by a gene knockout system (for example, LoxP) when purifying the gene encoding the exogenous labeling polypeptide.
(76) In some embodiments, the present invention adopts the vaccinia virus early/late promoter p7.5 to control the exogenous screening gene, artificially synthetizes the vaccinia virus early promoter pSEL to control signal peptide sequence and the exogenous labeling polypeptide coding sequence, and inserts the exogenous screening gene coding sequence, the signal peptide coding sequence and the labeling polypeptide coding sequence into the TK gene region of the vaccinia virus VSC20 strain through in vitro intracellular recombination technique to construct an oncolytic virus. The two promoters respectively initiate the expression of the genes that they respectively regulate in a back-to-back manner.
(77) In another embodiment of the present invention, Crisper-Cas9 gene editing technique is used to construct a recombinant oncolytic vaccinia virus.
(78) Preferably, the Crisper-Cas9 gene editing method can perform cutting and homologous recombination at two sites simultaneously so as to achieve the purpose of knocking out a sequence and inserting a transgene at one time.
(79) Preferably, the Crisper-Cas9 gene editing method can cut the target sequence and the donor sequence simultaneously to improve the efficiency of homologous recombination.
(80) The design of cutting and homologous recombination of the Crisper-Cas9 gene editing method of the present invention is shown in
(81) Specifically, the Crisper-Cas9 system may include leader RNA and donor DNA.
(82) Preferably, the leader RNAs includes leader RNA-1 and leader RNA-2. The nucleotide sequence of the leader RNA-1 is preferably consistent with the nucleotide sequence at position 123 to 145 of the vaccinia virus TK gene, and the nucleotide sequence of the leader RNA-2 is preferably consistent with nucleotide sequence at position 411 to 433 of the vaccinia virus TK gene. The Genbank number of the nucleotide sequence of the TK gene can be AA089373.1. Preferably, the nucleotide sequence of the leader RNA-1 is as shown in SEQ ID NO: 31, and the nucleotide sequence of the leader RNA-2 is as shown in SEQ ID NO: 32.
(83) Preferably, in the donor DNA, the nucleotide sequence of the left homology arm is as shown in SEQ ID NO: 33 and the nucleotide sequence of the right homology arm is as shown in SEQ ID NO: 34.
(84) Preferably, the nucleotide sequence of the donor DNA comprises the above-mentioned signal peptide coding sequence (for example, SEQ ID NO: 23) and the labeling polypeptide coding sequence, and also comprises the puro-GFP coding sequence. The nucleotide sequence of the puro-GFP coding sequence is as shown in SEQ ID NO: 35.
(85) The puro-GFP coding sequence is preferably under the control of the promoter of the nucleotide sequence as shown in SEQ ID NO: 36, and the signal peptide coding sequence and the labeling polypeptide coding sequence are preferably under the control of the promoter of the nucleotide sequence as shown in SEQ ID NO: 37.
(86) In a preferred embodiment of the present invention, the nucleotide sequence of the donor DNA is as shown in SEQ ID NO: 38.
(87) Chimeric Antigen Receptor
(88) The chimeric antigen receptor comprises in sequence an antigen-binding domain, a spacer region, a transmembrane region, and an intracellular domain that are operatively linked. The antigen-binding domain can specifically recognize and bind to the extracellular antigen determining region of the labeling polypeptide. The spacer region is used to separate the antigen-binding domain and the transmembrane region and the intracellular domain is used for signal transmission.
(89) For the definitions of the terms antigen-binding domain, spacer region, transmembrane region and intracellular domain used in the present invention, please refer to 'Immunology introductory theory', Yu Shanqian, Higher Education Press, 2008; and 'Immunobiology', seventh edition, Kenneth Murphy, Paul Travers, Mark Walport, etc.
(90) The antigen-binding domain is preferably a single-chain antibody (ScFv) comprising a light chain and a heavy chain which can be connected to each other through a linker, as shown in
(91) The present invention further found that it is preferable that the amino acid sequence of the light chain of the antigen-binding domain targeting TT1 is consistent with the amino acid sequence at position 1 to 111 of the light chain of anti-Myc antibody (such as clone 9e10) (in other embodiments of the present invention, the amino acid sequence of the light chain of the antigen-binding domain targeting TT1 can be extended by no more than 10 amino acids downstream of the above sequence), and the amino acid sequence of the heavy chain is consistent with the amino acid sequence at position 23 to 143 of the heavy chain of anti-Myc antibodies (such as clone 9e10) (in other embodiments of the present invention, the amino acid sequence of the heavy chain of the antigen-binding domain targeting TT1 can extended by no more than 10 amino acids upstream and downstream of the above sequence).
(92) Preferably, the amino acid sequence of the light chain of the antigen-binding domain targeting TT2 is consistent with the amino acid sequence at position 2 to 121 of the light chain of an anti-HA antibody (such as clone 12ca5) (in other embodiments of the present invention, the amino acid sequence of the light chain of the antigen-binding domain targeting TT2 can be extended by no more than 10 amino acids downstream of the above sequence), the amino acid sequence of the heavy chain is consistent with the amino acid sequence at position 2 to 114 of the heavy chain of an anti-HA antibody (such as clone 12ca5) (in other embodiments of the present invention, the amino acid sequence of the heavy chain of the antigen-binding domain targeting TT2 can be extended by no more than 10 amino acids downstream of the above sequence).
(93) Preferably, the amino acid sequence of the light chain of the antigen-binding domain targeting TT3 is consistent with the light chain of the anti-Strep tag II antibody (see, for example, patent document EP2871189A1), and the amino acid sequence of the heavy chain is consistent with the heavy chain of the anti-Strep tag II antibody (see, for example, patent document EP2871189A1).
(94) Wherein, the amino acid sequence of the light chain of the anti-Myc antibody (clone 9e10) can be derived from the amino acid sequence of PDB: 2ORB_L (https://www.ncbi.nlm.nih.gov/protein/2ORB_L), and the amino acid sequence of the heavy chain of the anti-Myc antibody (Clone 9e10) can be derived from the amino acid sequence of GenBank: CAA73271.1 (https://www.ncbi.nlm.nih.gov/protein/CAA73271.1?report=genbank&log$=protalign&blast_rank=1&RID=P597FX1S014). The amino acid sequence of the linker connecting the light chain and the heavy chain is as shown in SEQ ID NO:39. The amino acid sequence of the light chain of the anti-HA antibody (clone 12ca5) can be derived from the amino acid sequence of PDB: 5XCS_B (https://www.ncbi.nlm.nih.gov/protein/1258501213), and the amino acid sequence of the heavy chain of the anti-HA antibody (clone 12ca5) can be derived from the amino acid sequence PDB: 5XCS_A (https://www.ncbi.nlm.nih.gov/protein/5XCS_A). The amino acid sequence of the linker connecting the light chain and the heavy chain can be as shown in SEQ ID NO:40. The amino acid sequence of the light chain and the heavy chain of the anti-Strep tag antibody can be derived from the amino acid sequence disclosed in the patent document EP2871189A1, and the amino acid sequence of the linker connecting the light chain and the heavy chain can be as shown in SEQ ID NO:41.
(95) More preferably, the amino acid sequences of the antigen-binding domains targeting TT1, TT2 and TT3 are as shown in SEQ ID NOs: 42-44, respectively.
(96) The intracellular domain plays a role in signal transmission to activate T or NK cells. The intracellular domain of the CAR initially used for T cells has only one signal molecule, which is usually the receptor-related FcRI of immunoglobulin E (one subunit of the receptor with high affinity to IgE) or CD3, the basic transduction molecule of T cell antigen receptor signal. Some intracellular domains comprise T cell activation domains composed of one or more T cell activation motifs.
(97) Preferably, the intracellular domain is derived from the lymphocyte intracellular activation signal transduction region and optionally the lymphocyte costimulatory signal transduction region (may include 0 to 2 costimulatory signal transduction regions). Preferably, the intracellular activation signal transduction region is derived from the intracellular signal region of CD3 and DAP12, and the costimulatory signal transduction region is derived from the intracellular signal region of 4-1BB, CD28, CD27, OX40, GITR and/or ICOS.
(98) More preferably, the present invention has discovered that combining the above-mentioned antigen-binding domain with intracellular signal regions from 4-1BB and CD3 can obtain a CAR that enable T or NK cells to exert strong targeting tumoricidal activity. Preferably, the amino acid sequence of the intracellular domain is selected from position 209 to 255 of 4-1BB and position 52 to 164 of CD3, wherein, the amino acid sequence number of CD3 is UniProtKB-P20963, and the amino acid sequence number of 4-1BB is UniProtKB-Q07011. The amino acid sequence of the intracellular domain is more preferably as shown in SEQ ID NO:45.
(99) The present invention further selects the spacer region and the transmembrane region, thereby obtaining a CAR with a particular combination of antigen-binding domain-spacer region-transmembrane region-intracellular domain. The spacer region connects the antigen-binding domain and the transmembrane region. The structure of this region should be flexible, so that the antigen-binding domain can be adapted to different directions to promote the corresponding recognition and binding to antigens. The simplest form of the spacer region is the hinge region of immunoglobulin IgG1, and it can also be a part of the C.sub.H2C.sub.H3 region of an immunoglobulin. The transmembrane region is generally a hydrophobic alpha helix that spans the cell membrane. The spacer region can be derived from the hinge region of CD8, the hinge region of IgG or the hinge region of IgD. The transmembrane region can be derived from the transmembrane region of CD8, the transmembrane region of CD3, the transmembrane region of CD4 or the transmembrane region of CD28.
(100) Through researches and experimentations, the present invention found that the spacer region is more preferably derived from the hinge region of CD8, and the transmembrane region is more preferably derived from the transmembrane region of CD8. CD8 is a transmembrane glycosylated membrane protein composed of and subunits, which works with T cell surface receptors to allow T cells to bind to specific antigen. CD8 specifically binds to MHC I and mediates killing effect of cytotoxic T cells.
(101) More preferably, the spacer region and the transmembrane region constitute a spacer transmembrane region, and the amino acid sequence of the spacer transmembrane region is consistent with the amino acid sequence at position Y to 210 of CD8, and 118Y128 wherein Y is an integer. The UniProtKB number of the amino acid sequence of CD8 can be P01732. In other words, the amino acid sequence of the spacer transmembrane region is preferably selected from position 118 to 210 of CD8 and comprises the amino acids at position 128 to 210. For example, the amino acid sequence of the spacer transmembrane region is as shown in any one of the amino acid sequences selected from the group: position 118 to 210, position 119 to 210, position 120 to 210, position 121 to 210, position 122 to 210, position 123 to 210, position 124 to 210, position 125 to 210, position 126 to 210, position 127 to 210, or position 128 to 210 of CD8.
(102) Preferably, the expression of the chimeric antigen receptor is guided by a signal peptide which has the function of guiding the secretion of the target protein to the cell surface. The present invention found that the combination of the above-mentioned antigen-binding domain and the signal peptide from the GM-CSF chain can make the chimeric antigen receptor effectively expressed on the surface of immune effector cells. The GM-CSF chain signal peptide is the leader sequence that targets the chimeric antigen receptor of the present invention to the secretory pathway, the coding sequence of which is first translated into protein in the cell together with the coding sequence of the chimeric antigen receptor to guide the synthesized protein to enter into intracellular secretion pathway. The signal peptide is removed before the chimeric antigen receptor is expressed on the cell surface.
(103) Preferably, the amino acid sequence of the signal peptide is selected from position 1 to 22 of the amino acid sequence of GM-CSF, wherein the amino acid sequence number of the signal peptide is UniProtKB-P15509. More preferably, the amino acid sequence of the signal peptide is as shown in SEQ ID NO:8.
(104) In a specific embodiment of the present invention, the chimeric antigen receptor comprises in sequence an antigen-binding domain, a spacer region, a transmembrane region, and an intracellular domain that are operatively linked. In a more specific embodiment of the present invention, the antigen-binding domain is ScFv, the light chain and the heavy chain are respectively derived from the light chain and the heavy chain of anti-Myc, HA or Strep tag antibody, the spacer region is derived from the hinge region of human CD8, the transmembrane region is derived from the transmembrane region of human CD8, and the intracellular domain is derived from the combination of the intracellular signaling region of CD3 and 4-1BB.
(105) In the present invention, the signal peptide, the antigen-binding domain, the spacer region, the transmembrane region and the intracellular domain are connected in sequence. The signal peptide and the antigen-binding domain, the antigen-binding domain and the spacer region, the spacer region and the transmembrane region, the transmembrane region and the intracellular domain are operatively linked. For example, they may be connected by a linker or be connected directly without any linker. In one embodiment of the present invention, the signal peptide and the antigen-binding domain are connected by a linker, such as GAHA, the antigen-binding domain and the spacer region are connected by a linker (the linker, for example, is -Ala-Ser-), while the spacer region and the transmembrane region, the transmembrane region and the intracellular domain are connected directly without a linker.
(106) In a preferred embodiment of the present invention, the amino acid sequence of the chimeric antigen receptor is as shown in SEQ ID NO: 46 (corresponding to targeting TT1), SEQ ID NO: 47 (corresponding to targeting TT2) or SEQ ID NO: 48 (corresponding to targeting TT3).
(107) TABLE-US-00006 SEQIDNO:46:
(108) The dark gray shows the scFv of the chimeric antigen receptor, the italic shows the linker that connects the light chain and the heavy chain, the light gray shows the spacer region, the single underline shows the transmembrane region, the boldface shows the part from 4-1BB in the intracellular signal region, and the double underline shows the part from CD3 in the intracellular signal region.
(109) TABLE-US-00007 SEQIDNO:47:
(110) The dark gray shows the ScFv of the chimeric antigen receptor, the italic shows the linker that connects the light chain and the heavy chain, the light gray shows the spacer region, the single underline shows the transmembrane region, the boldface shows the part from 4-1BB in the intracellular signal region, and the double underline shows the part from CD3 in the intracellular signal region.
(111) TABLE-US-00008 SEQIDNO:48:
(112) The dark gray shows the ScFv of the chimeric antigen receptor, the italic shows the linker that connects the light chain and the heavy chain, the light gray shows the spacer region, the single underline shows the transmembrane region, the boldface shows the part from 4-1 BB in the intracellular signal region, and the double underline shows the part from CD3 in the intracellular signal region.
(113) Chimeric Antigen Receptor Encoding DNA
(114) The coding DNA of the chimeric antigen receptor of the present invention comprises in sequence an antigen-binding domain coding element, a spacer region coding element, a transmembrane coding element and an intracellular domain coding element that are operatively linked, which is characterized in that, the antigen-binding domain encoded by the antigen-binding domain coding element can recognize and bind to the extracellular antigen determining region of the labeling polypeptide of the present invention.
(115) The nucleotide sequence of coding element of the antigen-binding domain encodes the amino acid sequence of the antigen-binding domain. Preferably, the nucleotide sequence of the coding element of the antigen-binding domain targeting TT1 is as shown in SEQ ID NO:49. Preferably, the nucleotide sequence of the coding element of the antigen-binding domain targeting TT2 is as shown in SEQ ID NO:50. Preferably, the nucleotide sequence of the coding element of the antigen-binding domain targeting TT3 is as shown in SEQ ID NO:51.
(116) The nucleotide sequence of the intracellular domain coding element encodes the amino acid sequence of the intracellular domain. Preferably, the coding element of the intracellular activation signal transduction region is derived from the encoding DNAs of the intracellular signal region of CD3 and DAP12, and the coding element of the co-stimulatory signal transduction region is derived from the encoding DNAs of intracellular signal region of 4-1 BB, CD28, CD27, OX40, GITR and/or ICOS. More preferably, the coding element of the intracellular domain is derived from the encoding DNAs of intracellular signal region of 4-1 BB and CD3. More preferably, the nucleotide sequence of the coding element of the intracellular domain is as shown in SEQ ID NO:52.
(117) The spacer region coding element is preferably derived from CD8 hinge region coding DNA, IgG hinge region coding DNA or IgD hinge region coding DNA. The transmembrane region coding element is preferably derived from CD8 transmembrane region coding DNA, CD3 transmembrane region coding DNA, CD4 transmembrane region coding DNA or CD28 transmembrane region coding DNA. Wherein, the spacer region coding element is more preferably derived from the hinge region coding DNA of CD8, and the transmembrane region coding element is more preferably derived from the transmembrane region coding DNA of CD8.
(118) Preferably, the spacer region coding element and the transmembrane region coding element constitute a spacer transmembrane region coding element, and the nucleotide sequence of which encodes the amino acid sequence of the spacer transmembrane region. Preferably, the nucleotide sequence of the spacer region coding element comprises the sequence as shown in SEQ ID NO:22.
(119) Preferably, the expression of the chimeric antigen receptor is guided by a signal peptide, and the nucleotide sequence of the signal peptide encodes the amino acid sequence of the signal peptide. Preferably, the amino acid sequence of the signal peptide is selected from position 1 to 22 of the amino acid sequence of GM-CSF. Preferably, the nucleotide sequence of the signal peptide coding element is as shown in SEQ ID NO:23.
(120) In a specific embodiment of the present invention, the chimeric antigen receptor encoding DNA comprises in sequence an antigen-binding domain coding element, a spacer region coding element, a transmembrane region coding element and an intracellular region coding element that are operatively linked, which is characterized in that the coding elements of the light chain and the heavy chain of the antigen-binding domain are derived from the coding DNA of the light chain and heavy chain of the anti-Myc tag, HA tag or Strep tag II antibody, respectively, the spacer region coding element is derived from the hinge region coding DNA of CD8, the transmembrane region coding element is derived from the transmembrane region coding DNA of CD8, and the intracellular domain is derived from the intracellular signal region coding DNAs of 4-1BB and CD3.
(121) Preferably, the nucleotide sequence of the DNA having the signal peptide coding sequence and the chimeric antigen receptor coding sequence is as shown in SEQ ID NO: 53 (corresponding to targeting TT1), SEQ ID NO: 54 (corresponding to targeting TT2) or SEQ ID NO: 55 (corresponding to targeting TT3).
(122) CAR-Modified Immune Cells
(123) The immune cells include T cells or NK cells; wherein, the NK cells include autologous NK cells, allogeneic NK cells or NK cell strain, and the T cells include primitive T cells or their precursor cells, effector T cells, memory T cell, NKT cell, or T cell strain.
(124) The modification of chimeric antigen receptor to immune cells can be performed through lentiviral infection and mRNA electrotransfection.
(125) Preferably, the first composition and the second composition are present separately in the therapeutic agent without being mixed together.
(126) The nucleic acid having the labeling polypeptide coding sequence includes DNA or RNA; the RNA includes mRNA transcribed from the DNA. Preferably, the first composition comprises a therapeutically effective amount of the DNA or a therapeutically effective amount of the mRNA. Preferably, the first composition comprises the DNA or mRNA at a dose of 0.01-10 mg/day.
(127) Preferably, the first composition comprises a therapeutically effective amount of the recombinant virus. More preferably, the first composition comprises a total dose of 510.sup.7 to 510.sup.12 virus particles or 510.sup.7 to 510.sup.12 PFU of the recombinant oncolytic vaccinia virus per treatment course.
(128) Preferably, the second composition comprises a therapeutically effective amount of the CAR-modified immune cells. Preferably, a total dose of 110.sup.4 to 110.sup.9 cells/Kg body weight of the CAR-modified immune cells per treatment course is comprised.
(129) The DNA can be formulated to be administered via intratumoral injection or intravenously; the mRNA can be formulated to be administered via intratumoral injection or intravenously. For example, it can be administered by direct intratumoral injection in the form of plasmids, or by intratumoral injection after being packaged by a liposome, or by intratumoral injection after the connection to nanoparticles (such as polymers like poly-L-lysine, polyamino acid, polyethyleneimine and chitosan, and the like), or by electrotransfection after intratumoral injection to enhance the transfection rate.
(130) The recombinant virus can be formulated to be administered by intratumoral injection or intravenously.
(131) The CAR-modified immune cells can be formulated to be administered via intravenous or topical administration.
(132) Preferably, the therapeutic agent is composed of the first composition and the second composition.
(133) Those skilled in the art can understand that the therapeutic agent of the present invention may also comprise suitable pharmaceutically acceptable excipients, including pharmaceutical or physiological carriers, excipients, diluents (includes physiological saline, PBS solution), and various additives including sugars, lipids, polypeptides, amino acids, antioxidants, adjuvants, preservatives, etc.
(134) The present invention also provides the use of the therapeutic agent in the preparation of drugs for the treatment of tumors and/or cancers.
(135) The tumors and/or cancers include breast cancer, head and neck tumor, synovial cancer, kidney cancer, connective tissue cancer, melanoma, lung cancer, esophageal cancer, colon cancer, rectal cancer, brain cancer, liver cancer, bone cancer, choriocarcinoma, gastrinoma, pheochromocytoma, prolactinoma, von Hippel-Lindau disease, Zollinger-Ellison syndrome, anal cancer, cholangiocarcinoma, bladder cancer, ureteral carcinoma, glioma, neuroblastoma, meningioma, spinal cord tumor, osteochondroma, chondrosarcoma, Ewing's sarcoma, cancer of unknown primary site, carcinoid, fibrosarcoma, Paget's disease, cervix carcinoma, gallbladder cancer, eye cancer, Kaposi's sarcoma, prostate cancer, testicular cancer, cutaneous squamous cell carcinoma, mesothelioma, multiple myeloma, ovarian cancer, pancreatic endocrine tumor, glucagon tumor, pancreatic cancer , penile cancer, pituitary cancer, soft tissue sarcoma, retinoblastoma, small bowel cancer, gastric cancer, thymic cancer, trophoblastic carcinoma, hydatidiform mole, endometrial cancer, vaginal cancer, vulvar cancer, mycosis fungoides, insulinoma, heart cancer, meningeal cancer, peritoneal cancer, pleural cancer and blood cancer.
(136) The present invention also provides the above-mentioned labeling polypeptide of the present invention. The various embodiments of the labeling polypeptide are as described above.
(137) Preferably, the amino acid sequence of the labeling polypeptide is as shown in SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14 or SEQ ID NO: 15.
(138) The present invention also provides an isolated nucleic acid having the coding sequence of the labeling polypeptide of the present invention. The various embodiments of the nucleic acid are as described above.
(139) The nucleic acid comprises in sequence an promoter, a signal peptide coding sequence and the coding sequence of the labeling polypeptide of the present invention that are operatively linked.
(140) The nucleic acid comprises DNA and mRNA. Preferably, the nucleic acid is DNA, and its nucleotide sequence is as shown in SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO: 30.
(141) The present invention also provides a recombinant expression vector, wherein the recombinant expression vector comprises in sequence an promoter, a signal peptide coding sequence, and the coding sequence of the labeling polypeptide of the present invention that are operatively linked.
(142) In order to labeling a tumor cell with two or more labeling polypeptides simultaneously, the recombinant expression vector may comprise two or more coding sequences of the labeling polypeptide of the present invention.
(143) Preferably, the recombinant expression vector (for example, pFastbac1-TT1, pFastbac1-TT2, pFastbac1-TT3, pFastbac1-C1&2a, pFastbac1-C1&2b) used to prepare the m RNA of the labeling polypeptide comprises in sequence a CMV promoter, a T7 promoter, a 5UTR with kozak sequence, and a GM-CSF chain signal peptide coding sequence before the coding sequence of the labeling peptide according to the present invention; and comprises a 3UTR of the alpha globulin with polyA signal after the coding sequence of the labeling polypeptide of the present invention. The combination of the mentioned functional elements of the recombinant expression vector of the present invention can promote DNA transcription and translation, and enhance the stability of mRNA. The present invention also optimizes the structure of the above-mentioned functional elements as recited below, so as to better exert their due functions. Preferably, in the present invention, the sequence of the CMV promoter is as shown in SEQ ID NO:56. The function of the CMV promoter is to start the transcription of the downstream DNA sequences.
(144) Preferably, in the present invention, the sequence of the T7 promoter is as shown in SEQ ID NO:57. The function of the T7 promoter is to start the transcription of the downstream DNA sequences.
(145) Preferably, in the present invention, the sequence of the 5UTR with the kozak sequence is as shown in SEQ ID NO: 58 and the function of the 5UTR with the kozak sequence is to enhance the translation efficiency of mRNA.
(146) Preferably, in the present invention, the sequence of the GM-CSF chain signal peptide coding sequence is as shown in SEQ ID NO:23.
(147) Preferably, in the present invention, the sequence of the 3UTR of alpha globulin is as shown in SEQ ID NO: 59, which comprises a polyA signal. Its function is to enhance the stability of mRNA.
(148) In a specific embodiment, the basic backbone of the recombinant expression vector is commercially available pFastbac1 vector which is then inserted with the above-mentioned elements.
(149) Since the present invention optimizes the 3UTR and 5UTR structures, it is possible to use, for example, Tail-PCR to synthesize a DNA double-stranded template with PolyA in the positive strand and the corresponding PolyT in the reverse strand from the recombinant expression vector. By which, the instability of the DNA template is reduced, and mRNA can be synthesized in vitro. The number of the A in the PolyA of the positive chain (or the number of T in the PolyT of the reverse chain) is in the range of 140 to 170, preferably 150 to 170, more preferably more or less than 150 (for example, 150).
(150) Methods of introducing this recombinant expression vector into tumor cells include methods via viral and non-viral. Non-viral methods include biological, physical, and chemically mediated gene transfection methods. Biological transfection methods include direct injection, receptor-mediated gene transfer, etc. Physical transfection methods include electrotransfection, microinjection, etc. Chemical transfection methods include liposomes and various cationic polymer-mediated transfections.
(151) The present invention also provides an isolated recombinant virus, wherein the genome of the recombinant virus comprises in sequence a promoter, a signal peptide coding sequence, and a coding sequence of the labeling polypeptide of the present invention that are operatively linked, wherein the labeling polypeptide can be expressed to form modification on the surface of tumor cells and/or cancer cells; and the recombinant virus includes a replication-selective recombinant oncolytic virus or a replication-deficient recombinant virus.
(152) Preferably, the recombinant virus is a replication-selective recombinant oncolytic virus, and the recombinant oncolytic virus is derived from a genetically mutated virus with oncolytic effect and a wild-type virus with oncolytic effect; preferably, the recombinant oncolytic virus is derived from adenovirus, poxvirus, herpes simplex virus, measles virus, Semliki forest virus, vesicular stomatitis virus, polio virus, retrovirus, reovirus, Seneca valley virus, Echo-type enterovirus, Coxsackie virus, Newcastle disease virus and Malaba virus with oncolytic effect.
(153) The various embodiments of the recombinant virus are as described above.
(154) The present invention also provides a recombinant expression vector (pFastbac1-TT3-PuroGFP (the nucleotide sequence of which is as shown in SEQ ID NO: 38)) for preparing recombinant virus, which comprises the coding sequence of the TT3 labeling peptide described above (i.e., SEQ ID NO: 28) operatively linked to pS promote, the coding sequence of the puro-GFP screening gene described above operatively linked to the p7.5 promoter, the LoxP site, left and right homology arms and gRNA cleavage site donor DNA. The recombinant expression vector is used to construct a recombinant oncolytic vaccinia virus using Crisper-Cas9 gene editing technique.
(155) The present invention optimizes the structure of the above-mentioned functional elements as recited below, so as to better exert their due functions.
(156) Preferably, in the present invention, the sequence of the pS promoter is as shown in SEQ ID NO:37. The function of pS promoter is to start transcription of downstream TT3 labeling polypeptide coding sequence.
(157) Preferably, in the present invention, the sequence of the p7.5 promoter is as shown in SEQ ID NO:36. The function of the p7.5 promoter is to start transcription of the downstream puro-GFP coding sequence.
(158) Preferably, in the present invention, the sequence of the LoxP site is as shown in SEQ ID NO:60. The function of LoxP site is to provide convenience for removing the screening gene.
(159) Preferably, in the present invention, the sequence of the left homology arm is as shown in SEQ ID NO: 33 and the sequence of the right homology arm is as shown in SEQ ID NO: 34. The function of the homology arms is to homologously recombine the vaccinia virus genome with the donor plasmid.
(160) Preferably, in the present invention, the sequence of the gRNA-1 cleavage site is as shown in SEQ ID NO: 61 and the sequence of the gRNA-2 cleavage site is as shown in SEQ ID NO: 62. The function of the gRNA cleavage site is to enable Crisper-Cas9 to cut the donor plasmid so as to improve the efficiency of homologous recombination.
(161) In a specific embodiment, the basic backbone of the recombinant expression vector is commercially available pFastbac1 vector which is then inserted with each element described above.
(162) The present invention also provides a chimeric antigen receptor which comprises orderly an antigen-binding domain, a spacer region, a transmembrane region, and an intracellular domain that are operatively linked, which is characterized in that the antigen-binding domain can recognize and bind to the extracellular antigen determining region of the labeling polypeptide of the present invention.
(163) The various embodiments of the chimeric antigen receptor are as described above.
(164) Preferably, the amino acid sequence of the chimeric antigen receptor is as shown in SEQ ID NO: 46 (corresponding to targeting TT1), SEQ ID NO: 47 (corresponding to targeting TT2) or SEQ ID NO: 48 (corresponding to targeting TT3).
(165) The present invention also provides an isolated DNA having the coding sequence encoding the chimeric antigen receptor of the present invention.
(166) The various embodiments of the DNA having the coding sequence of the chimeric antigen receptor are as described above.
(167) Preferably, the nucleotide sequence of the DNA is as shown in SEQ ID NO: 53 (corresponding to targeting TT1), SEQ ID NO: 54 (corresponding to targeting TT2) or SEQ ID NO: 55 (corresponding to targeting TT3).
(168) The present invention also provides an isolated mRNA transcribed from the DNA of the present invention.
(169) The present invention also provides a recombinant expression vector (for example, pFastbac1-aTT1-CD8a-4-1BB-CD3, pFastbac1-aTT2-CD8a-4-1BB-CD3, pFastbac1-aTT3-CD8a-4-1BB-CD3), wherein the recombinant expression vector comprises orderly a promoter, a signal peptide coding sequence, and a chimeric antigen receptor coding sequence of the present invention that are operatively linked.
(170) Preferably, the recombinant expression vector comprises orderly a CMV promoter, a T7 promoter, a 5UTR with a kozak sequence, and a GM-CSF chain signal peptide coding sequence before the coding sequence of the chimeric antigen receptor of the present invention; and comprises a 3UTR of the alpha globulin with polyA signal after the coding sequence of the chimeric antigen receptor of the present invention. The combination of the mentioned functional elements of the recombinant expression vector of the present invention can promote DNA transcription and translation and enhance the stability of mRNA. The present invention also optimizes the structure of the above-mentioned functional elements as recited below so as to better exert their due functions.
(171) Preferably, in the present invention, the sequence of the CMV promoter is as shown in
(172) SEQ ID NO:56. The function of CMV promoter is to start transcription of downstream DNA sequence.
(173) Preferably, in the present invention, the sequence of the T7 promoter is as shown in SEQ ID NO:57. The function of the T7 promoter is to start transcription of downstream DNA sequences.
(174) Preferably, in the present invention, the sequence of the 5UTR with the kozak sequence is as shown in SEQ ID NO: 58 and the function thereof is to enhance the translation efficiency of mRNA.
(175) Preferably, in the present invention, the sequence of the GM-CSF chain signal peptide coding sequence is as shown in SEQ ID NO:23.
(176) Preferably, in the present invention, the sequence of the 3UTR of alpha globulin is as shown in SEQ ID NO: 59, which comprises a polyA signal. Its function is to enhance the stability of mRNA.
(177) In a specific embodiment, the basic backbone of the recombinant expression vector is commercially available pFastbac1 vector which is then inserted with the above-mentioned elements.
(178) Since the present invention optimizes the 3UTR and 5UTR structures, it is possible to use, for example, Tail-PCR to synthesize a DNA double-stranded template with PolyA in the positive strand and the corresponding PolyT in the reverse strand from the recombinant expression vector. By which, the instability of the DNA template is reduced and mRNA can be synthesized in vitro. The number of the A in the PolyA of the positive chain (or the number of the T in the PolyT of the reverse chain) is in the range of 140 to 170, preferably 150 to 170, more preferably more or less than 150 (for example, 150).
(179) The present invention also provides a CAR-modified immune cell, the surface of which is modified by the chimeric antigen receptor of the present invention.
(180) The immune cells can be T cells or NK cells; wherein, the NK cells include autologous NK cells, allogeneic NK cells or NK cell strain, and the T cells include primitive T cells or their precursor cells, effector T cells, memory T cell, NKT cell, or T cell strain.
(181) The chimeric antigen receptor can modify immune cells through lentivirus infection, transposon and mRNA electrotransfection.
(182) The present invention also provides a kit of combinational drug with synergistic effect for treatment of tumors and/or cancers, comprising: a first container containing the first composition of the therapeutic agent of the present invention; a second container containing the second composition of the therapeutic agent of the present invention, wherein the first container is separate from the second container; and instructions specifying timing and routes of administration.
(183) The present invention also provides the use of the isolated nucleic acid having the coding sequence of the labeling polypeptide of the present invention in the preparation of drugs for treatment or prevention of tumors and/or cancers.
(184) The invention also provides the use of the recombinant virus in the preparation of drugs for treatment or prevention of tumors and/or cancers.
(185) The present invention also provides the use of the CAR-modified immune cells in the preparation of drugs for treatment or prevention of tumors and/or cancers.
(186) The invention also provides the use of the kit in the preparation of drugs for treatment or prevention of tumors and/or cancers.
(187) The tumors and/or cancers include breast cancer, head and neck tumor, synovial cancer, kidney cancer, connective tissue cancer, melanoma, lung cancer, esophageal cancer, colon cancer, rectal cancer, brain cancer, liver cancer, bone cancer, choriocarcinoma, gastrinoma, pheochromocytoma, prolactinoma, von Hippel-Lindau disease, Zollinger-Ellison syndrome, anal cancer, cholangiocarcinoma, bladder cancer, ureteral carcinoma, glioma, neuroblastoma, meningioma, spinal cord tumor, osteochondroma, chondrosarcoma, Ewing's sarcoma, cancer of unknown primary site, carcinoid, fibrosarcoma, Paget's disease, cervix carcinoma, gallbladder cancer, eye cancer, Kaposi's sarcoma, prostate cancer, testicular cancer, cutaneous squamous cell carcinoma, mesothelioma, multiple myeloma, ovarian cancer, pancreatic endocrine tumor, glucagon tumor, pancreatic cancer , penile cancer, pituitary cancer, soft tissue sarcoma, retinoblastoma, small bowel cancer, gastric cancer, thymic cancer, trophoblastic carcinoma, hydatidiform mole, endometrial cancer, vaginal cancer, vulvar cancer, mycosis fungoides, insulinoma, heart cancer, meningeal cancer, peritoneal cancer, pleural cancer and blood cancer.
(188) The present invention also provides a method for treatment of tumor and/or cancer, including: administering the first composition of the therapeutic agent of the present invention to a patient suffering from tumor and/or cancer; and administering the second composition of the therapeutic agent of the present invention to the patient suffering from tumor and/or cancer.
(189) The first composition and the second composition in the therapeutic agent may be administered simultaneously (for example, as a mixture), separately but simultaneously (for example, administered by intratumoral and intravenous injection, respectively) or in sequence (for example, first composition is administered first, and then the second composition is administered).
(190) Preferably, the method comprises the following steps in a sequential manner: 1) administering the first composition to the patient suffering from tumor and/or cancer; and 2) administering the second composition of the therapeutic agent to the patient suffering from tumor and/or cancer after the administration of the first composition.
(191) Preferably, 1 to 30 days after the administration of the first composition, administering the second composition of the therapeutic agent to the patient suffering from tumor and/or cancer.
(192) The phrase 1 to 30 days after the administration of the first composition, administering the second composition of the therapeutic agent to the patient suffering from tumor and/or cancer means that the time interval between the first administration of the second composition and the first administration of the first composition is in the range of 1 to 30 days (for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13...30 days), or the time interval between the first administration of the second composition and the most recent administration of the first composition is 1 to 30 days (for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 , 13...30 days). Preferably, the time interval between the first administration of the second composition and the most recent administration of the first composition is 1 to 30 days (for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 . . . 30 days).
(193) In a preferred embodiment of the present invention, the administration dose of the nucleic acid is 0.01mg/day to 10 mg/day, 1 to 3 times per day, and consecutively for 1 to 7 days.
(194) In a preferred embodiment of the present invention, the administration dose of the recombinant oncolytic vaccinia virus is: about 510.sup.7 to 510.sup.12 virus particles (for single administration or multiple administrations) for total dose per treatment course or any value in the range, or the administration dose of the recombinant oncolytic vaccinia virus is: about 510.sup.7 to 510.sup.12 PFU (for single or multiple administrations) for total dose per treatment course or any value in the range. Its precise dose also depends on the judgment of the practitioner and the unique circumstance of each individual. In the case of multiple administrations, it is administered 1 to 3 times a day, consecutively for 1 to 7 days.
(195) In a preferred embodiment of the present invention, the administered dose of the CAR-modified immune cells is 110.sup.4 to 110.sup.9 cells/Kg body weight for total dose per treatment course. Preferably, it is administered 1 to 3 times a day, consecutively for 1 to 7 days.
(196) In certain embodiments, the method for treatment of tumor and/or cancer further includes administering other medicaments for treatment of tumor and/or cancer to the patient, and/or medicaments for regulating the patient's immune system, to enhance the number and the function of CAR-modified immune cells in the body. Said other medicaments for treatment of tumor and/or cancer include but are not limited to: chemotherapy drugs, such as cyclophosphamide, fludarabine; radiotherapy drugs; immunosuppressants, such as cyclosporine, azathioprine, Methotrexate, mycophenolate, FK50; antibodies, such as antibodies against CD3, IL-2, IL-6, IL-17, TNF.
(197) The DNA can be formulated to be administered via intratumoral injection or intravenously; the mRNA can be formulated to be administered via intratumoral injection or intravenously. For example, it can be administered by direct intratumoral injection in the form of plasmids, by intratumoral injection after package in a liposome, or by intratumoral injection after connection to nanoparticles (such as polymers like poly-L-lysine, polyamino acid, polyethyleneimine and chitosan, etc.), or by electrotransfection after intratumoral injection to enhance the transfection rate.
(198) The recombinant virus can be formulated to be administered via intratumoral injection or intravenously.
(199) The CAR-modified immune cells can be formulated to be administered via intravenous or topical administration.
(200) The following will further explain or illustrate the content of the present invention by way of examples, but these examples should not be construed as limiting the protection scope of the present invention.
EXAMPLES
(201) Unless otherwise specified, the experimental methods used in the following examples are performed using conventional experimental procedures, operations, materials, and conditions in the field of medical biological engineering.
(202) Unless otherwise specified, all the percentage concentrations (%) of the respective agents indicate percentage by volume (%(v/v)).
(203) Unless otherwise specified, cell culture is conducted at the condition of 37 C., 5% CO.sub.2, and humidification (95% relative humidity).
(204) The sources of the experimental materials used in the following examples are as follows: PBMC is derived from the peripheral blood of healthy donors. Human recombinant IL-2 (hrIL2) was purchased from Peprotech. DPBS was purchased from Gibco. The electric shock cup was purchased from Bio-Rad. Unless otherwise specified, FBS was purchased from Sigma. Human ovarian cancer cell line SKOV3-luc, human T cell line Jurkat, human liver cancer cell line SK-HEP-1, African green monkey kidney cell CV-1, human osteosarcoma cell 143B cells were purchased from ATCC, and human colorectal cancer cell line HCT116-luc was purchased from Perkin Elmer.
(205) Vaccinia virus (DDVV-RFP): the oncolytic vaccinia virus DDVV-RFP is known, which belongs to the oncolytic vaccinia virus WR strain (see, for example, X Song, et al. T-cell Engager-armed Oncolytic Vaccinia Virus Significantly Enhances Antitumor Therapy. Molecular Therapy. (2014); 22 1, 102-111), functionally deficient in both TK gene and VGF gene and carries an exogenous red fluorescent protein (RFP) gene. Since the RFP gene only plays a role of screening/reporting, the anti-tumor function of the oncolytic vaccinia virus DDVV-RFP is substantially equivalent to the oncolytic vaccinia virus functionally deficient in TK gene and VGF gene. Moreover, the oncolytic vaccinia virus DDw-RFP can also be obtained by genetic modification of VSC20 vaccinia virus using conventional techniques in the art. VSC20 vaccinia virus is a vaccinia virus lack of VGF gene. For the preparation method of VSC20 vaccinia virus, please see McCart, JA, et al. Systemic cancer therapy with a tumor-selective vaccinia virus mutant lacking thymidine kinase and vaccinia growth factor genes. Cancer Res (2001) 61: 8751-8757. The genetic modification involves the use of an artificial synthetic vaccinia virus early/late promoter pSEL to regulate the exogenous DsRed gene (i.e., the RFP gene), and insertion of the DsRed gene into the TK gene region of the vaccinia virus VSC20 strain using in vitro intracellular recombination technique, thereby constructing the oncolytic vaccinia virus DDVV-RFP.
Preparation Example 1: Preparation of Tumor Cells Labeled Respectively with TT1, TT2, TT3, C1&2a, C1&2b by Electroporation Technique
(206) 510.sup.6 Jurkat, HCT116-luc, SKOV3-luc or SK-HEP-1 cells and 5 g of mRNAs with TT1 (SEQ ID NO: 11), TT2 (SEQ ID NO: 12) or TT3 (SEQ ID NO: 13), C1&2a (SEQ ID NO: 14), C1&2b (SEQ ID NO: 15) coding sequences (obtained by the method of Preparation Example 8 respectively), respectively, were mixed in electrotransfer fluid P3 (product name P3Primary Cell 4D-X Kit L, Lonza, item number V4XP-3012), put in a 100 l of Nucleocuvette tube (product name P3Primary Cell 4D-X Kit L, Lonza, item number V4XP-3012), and placed in ice bath for 5 minutes. Then, the electroporator of 4D-Nucleofector system (Lonza) was used and the electrotransfection was performed using the tumor cell electrotransfection program thereof. After electrotransfection, the cells were taken out and placed in corresponding tumor cell culture medium. Jurkat culture medium is RPMI (Gibco)+10% FBS (Hyclone), SKOV3-luc and HCT116-luc culture medium is McCoy's 5A+10% FBS, and SK-HEP-1 culture medium is EMEM (Gibco)+10% FBS. DNase (Roche) was added to the medium to final concentration of 10 ng/mL, and then was placed in an incubator at 37 C. in 5% CO.sub.2 to recover overnight. After 24 hours, the cells were harvested and the electrotransfected cells were identified using a flow cytometer (purchased from BD, C6Samplar). Tumor cells labeled receptively with TT1, TT2, TT3, C1&2a, or C1&2b were obtained.
Test Example 1: Verification of the Label of Tumor Cells with Labeling Peptides by Electroporation
(207) According to the method of Preparation Example 1, the mRNAs with TT1 (SEQ ID NO: 11), TT2 (SEQ ID NO: 12) or TT3 (SEQ ID NO: 13) coding sequences (obtained by the method of Preparation Example 8 respectively), respectively, was electrotransfected to Jurkat immortalized T lymphocytes, human ovarian cancer cell SKOV3-luc, human colorectal cancer cell HCT116-luc or human liver cancer cell SK-HEP-1 by 4D-NucleofectorTM system (Lonza), respectively. Staining was performed with a FITC-conjugated anti-Myc antibody (Santa Cruz), a FITC-conjugated anti-HA antibody (Biolegend), a FITC-conjugated anti-Strep tag II antibody (Genscript) (the dilution ratio is 1:50, respectively). The cells were identified by Flow cytometry (purchased from BD, C6Samplar).
(208) The results are shown in
Preparation Example 2: Preparation of CAR-T Cells Targeting TT1, TT2, and TT3, Respectively
(209) 210.sup.6 human PBMC cells were resuspended in 1 ml T cell culture medium (AIMV (Gibco) supplemented with 1% human AB serum (Valley Biomedical)), and OKT3 (eBioscience) with a final concentration of 100 ng/mland 3001U/ ml of hrlL-2 (Peprotech) were added, then incubated into one well of a 24-well plate and placed in a humidified cell culture incubator (Thermo Fisher) at 37 C. in 5% CO.sub.2. hrlL-2 with a final concentration of 300lU/ml was supplemented every 2 to 3 days. Fresh T cell culture medium was supplemented according to the condition of cell growth and the number of cells was adjusted to 110.sup.6 cells/ml.
(210) T cells cultured for 7 to 14 days (110.sup.7 cells) and 4pg of aTT3-CD8-41BB-CD3 mRNA (i.e., the mRNA corresponding to the nucleotide sequence as shown in SEQ ID NO: 55 (obtained by the method of Preparation Example 8)) were mixed in electrotransfer fluid P3 (product name P3Primary Cell 4D-X Kit L, Lonza, item number V4XP-3012), and placed in a 100 l of Nucleocuvette tube (product name P3Primary Cell 4D-X Kit L, Lonza, Item No. V4XP-3012), and frozen in an ice bath for 5 minutes. Then, the electrotransfection was performed using 4D-Nucleofector system (Lonza) and T cell electrotransfection program thereof. After electrotransfection, the cells were taken out and placed in T culture medium, 300lU/ml (final concentration) of hrIL2 and 10 ng/mL of DNase (Roche) were added, and then placed in an incubator at 37 C. in 5% CO.sub.2 to recover overnight. After 24 hours, the cells were harvested, and the electrotransfected cells were identified by a flow cytometry. CAR-modified T cells targeting TT3 (i.e., aTT3-CD8-41BB-CD3 CAR) were obtained.
(211) The preparation methods of CAR-T cells targeting TT1 and TT2 are similar with the above method except that aTT1-CD8-41BB-CD3 mRNA (i.e., the mRNA corresponding to the nucleotide sequence as shown in SEQ ID NO: 53 (obtained by the method of Preparation Example 8)), aTT2-CD8-41BB-CD3 mRNA (i.e., the mRNA corresponding to the nucleotide sequence as shown in SEQ ID NO: 54 (obtained by the method of Preparation Example 8)) were used.
Example 1: The Tumor-Killing Ability of CAR-T cells Targeting Labeling Polypeptide on Tumor Cells Labeled with the Labeling Polypeptide by Electrotransfection
(212) This example tested the killing ability of CAR-T cells targeting labeling polypeptides on Jurkat cells after being labeled by electrotransfection. The CAR-modified T cells targeting TT1 or TT2 or non-CAR-modified T cells obtained by the method of Preparation Example 2 were co-cultured respectively with the human T cell line Jurkat cells labeled with TT1 or TT2 by electrotransfection obtained by the method of Preparation Example 1 in a U-shaped 96-well plate, the number ratio (E:T) of the above CAR-T effector cells to target cells ranges from 1.25:1 to 20:1. Each experiment was repeated 3 times. After 2 hours of co-cultivation, DELFIA EuTDA Cytotoxicity Kit (Perkin Elmer, USA) was used to detect the ability of CAR-T cells to lyse tumor cells. The killing effect was calculated with the following formula: % specific lysis=((experimental group release (reading)blank group release (reading))/(maximum release (reading)blank group release (reading))100.
(213) The results were shown in
Example 2: CAR-T cells Targeting a Labeling Polypeptide can Kill a Variety of Tumor Cells Labeled with the Labeling Polypeptide by Electrotransfection
(214) This example tested the broad-spectrum applicability of CAR-T cells for killing tumor cells labeled by electrotransfection. The CAR-modified T cells targeting TT3 obtained by the method of Preparation Example 2 or wild-type T cells (as the negative control group of CAR) were respectively co-cultured with the human T cell line Jurkat or human colorectal cancer cell line HCT116-luc labeled with TT3 by electrotransfection in a U-shaped 96-well plate, and the number ratio of the above-mentioned effector cells to target cells (E:T) ranges from 2.5:1 to 20:1. Each experiment was repeated 3 times. After 2 hours of co-cultivation, the DELFIA EuTDA Cytotoxicity Kit (obtained from Perkin Elmer, USA) was used to detect the ability of CAR-T cells to lyse tumor cells. The killing effect was calculated using the following formula: % specific lysis=((experimental group release (reading)blank group release (reading))/(maximum release (reading)blank group release (reading))100.
(215) The results are shown in
Example 3: CAR-T Cells Targeting Labeling Polypeptides can Specifically Kill Tumor Cells Labeled by Electrotransfection
(216) This example tested the specificity to the labeled tumor cell of the CAR-T cells targeting the labeling polypeptide of the present invention. The CAR-T cells targeting TT3 or mGFP-Z modified T cells (the GFP sequence (the Genbank number is YP_002302326.1) was used to replace the antigen binding domain in aTT3-CD8-41BB-CD3 CAR, used as the negative control group of CAR) obtained by the method of Preparation Example 2 was co-cultured respectively with the human colorectal cancer cell line HCT116-luc which is labeled with TT3 by electroporation or not labeled in a U-shaped 96-well plate. The ratio of the number of effector cells to target cells (E:T) ranges from 5:1 to 20:1. Each experiment was repeated 3 times. After 2 hours of co-cultivation, the DELFIA EuTDA Cytotoxicity Kit (obtained from PerkinElmer, USA) was used to detect the ability of CAR-T cells to lyse tumor cells. The killing effect was calculated using the following formula: % specific lysis=((experimental group release (reading)blank group release (reading))/(maximum release (reading)blank group release (reading))100.
(217) The results are shown in
Example 4: Tumor Cells can be Labeled with Two Kinds of Epitope Polypeptides and Recognized by Corresponding CAR-T Cells
(218) The two epitope polypeptides were cloned into one carrier so that the tumor cells can be simultaneously labeled with the two epitope polypeptides, thereby different CAR-T cells can be used to track and kill the labeled tumor cells simultaneously or in sequence. Furthermore, according to the method recited in Preparation Example 8, two epitope polypeptides were cloned into the pFastbac1 vector (Life Technologies) using different spacer transmembrane regions, and vectors expressing the labeling polypeptides C1&2a and C1&2b were obtained (pFastbac1-C1&2a and pFastbac1-C1&2b, respectively), and then the mRNAs of C1&2a (SEQ ID NO: 14), C1&2b (SEQ ID NO: 15) coding sequence were prepared. Further, Jurkat cells labeled with C1&2a or C1&2b were obtained according to the method of Preparation Example 1. Wherein, C1&2a comprises 3 repeated epitope polypeptides derived from Myc tag and 3 repeated epitope polypeptides derived from HA tag. C1&2b comprises two repeated epitope polypeptides derived from Myc tag and two repeated epitope polypeptides derived from HA tag. The amino acid sequence of C1&2a is as shown in SEQ ID NO: 14 and the amino acid sequence of C1&2b is as shown in SEQ ID NO: 15. The nucleotide sequence of the nucleic acid with the coding sequence of the labeling polypeptide C1&2a is as shown in SEQ ID NO: 29, and the nucleotide sequence of the nucleic acid with the coding sequence of the labeling polypeptide C1&2b is as shown in SEQ ID NO: 30.
(219) IFN ELISpot (Mabtech) was used to detect the IFN secretion of CAR-T after the stimulation by tumor cells. The T cells electrotransfected with the blank control (Mock-T) or electrotransfected with the mRNA of the CAR targeting TT1 or TT2 by electrotransfection obtained by the method of Preparation Example 2 were co-cultured respectively with the Jurkat cells labeled with C1&2a or C1&2b obtained by the method of Preparation Example 1 on an IFN ELISPOT detection plate, and the ratio of the number of CAR-T effector cells to target cells (E:T) is 10:1. Each experiment was repeated 3 times. After 24 hours of co-cultivation, development was performed and ELISPOT points were counted by using the software Immunospot.
(220) As shown in
Preparation Example 3: Preparation of Chimeric Antigen Receptor Modified NK Cells Targeting TT3
(221) 2010.sup.6 human PBMC cells and 2mL of NK cell activator I (purchased from Shenzhen Dakewe, DKW35-CYT-NK001) were mixed homogenously in 400m1 of NK culture medium (NK culture medium is AIM V medium (purchased from Life Technologies)+1% human serum (purchased from Valley Biomedical, item number HP1022H1)), inoculated in a G-Rex100 cell culture device (purchased from Wilson Wolf), and added with IL2 (final concentration: 50 IU/l), placed in a cell culture incubator at 37 C., supplemented with the entire volume of IL2 every other day (final concentration: 50 IU/ml), cultured for 10 days, and then the cells were harvested and count. 2010.sup.6 cells was taken out from the harvested cells and uniformly mixed with another 2 mL of NK cell activator I in 400 ml of NK culture medium, and then inoculated back to the G-Rex100 cell culture device, and further cultured for 7 days at the same conditions. The remaining cells on the Day 10 mentioned above were frozen for later use, and the cells on the Day 16 were harvested and counted. 210.sup.6 cells were taken out for cell phenotype analysis by a flow cytometry (using anti-CD3 and anti-CD56 antibodies, respectively: PE-conjugated anti-human CD3 antibody and APC-conjugated anti-human CD56 antibody (purchased from Miltenyi), 1:50 dilution).
(222) NK cells cultured for 16 days (110.sup.7 cells) and 4 g of aTT3-CD8-41BB-CD3 mRNA (obtained by the method of Preparation Example 8) were mixed in electrotransfer fluid P3 (product name P3Primary Cell 4D-X Kit L, Lonza, item number V4XP-3012), placed in a 100 l of Nucleocuvette tube (product name P3Primary Cell 4D-X Kit L, Lonza, item number V4XP-3012), and frozen in an ice bath for 5 minutes. Then the 4D-Nucleofector system (Lonza) was used and the NK cells electrotransfection program thereof was selected for electrotransfection. After electrotransfection, the cells were taken out and placed in the NK cell culture medium, 50 IU/ml of IL2 and 10 ng/mL of DNase were added, and placed in an incubator at 37 C. in 5% CO.sub.2 to recover overnight. After 24 hours, the cells were harvested, and the electrotransfected cells were identified using a flow cytometer (purchased from BD, C6 Samplar). CAR-modified NK cells targeting TT3 (i.e., aTT3-CD8-41BB-CD3 CAR) were obtained.
Example 5: Tumor Killing Ability of CAR-NK cells Targeting Labeling Polypeptides on Labeled Tumor Cells by Electrotransfection
(223) This example tested the killing ability of CAR-modified NK cells targeting labeling polypeptides to electrotransfected-labeled SKOV3-luc or SK-HEP-1 cells. The CAR-modified NK cells targeting TT3 or mGFP-Z-modified NK cells (the GFP sequence (the Genbank number is YP_002302326.1) was used to replace the antigen binding domain in aTT3-CD8-41BB-CD3CAR, used as the negative control group of CAR) were co-cultured respectively with the human ovarian cancer cell line SKOV3-luc or human hepatoma cell line SK-HEP-1 labeled with TT3 by electrotransfection in a U-shaped 96-well plate, and the ratio of the number of CAR-NK effector cells to target cells (E:T) is 10:1. Each experiment was repeated 3 times. After 2 hours of co-cultivation, the DELFIA EuTDA Cytotoxicity Kit (PerkinElmer, USA) was used to detect the ability of CAR-NK cells to lyse tumor cells. The killing effect was calculated using the following formula: % specific lysis'((experimental group release (reading)blank group release (reading))/(maximum release (reading)blank group release (reading))100.
(224) The results are shown in
Preparation Example 4: Preparation of HCT116-luc Cell Line Labeled Stably with TT3
(225) First, the recombinant expression vector pFastbac1-TT3 which can be used for mRNA synthesis was linearized with Clal restriction endonuclease, and then the linearized fragments were recovered by gel cutting. 410.sup.5 HCT116-luc cells were inoculated to one well of a 6-well plate. 2 g of linearized plasmid were mixed with 4 l of P3000 (purchased from Life Technologies) and 125 l of Opti-MEM (Gibco), which named as mixture 1; 6 l Lipo3000 (purchased from Life Technologies) was mixed with 125 l of Opti-MEM, which named as mixture 2. Mixture 1 and mixture 2 were mixed and named as mixture 3, and then incubated at room temperature for 15 minutes. The culture solution in the 6-well plate was discarded and 2 ml of McCoy's 5A+10% FBS culture solution was added and mixture 3 was added to the culture solution. After 24 hours of transfection, the culture medium was discarded and replaced with 2 ml of fresh McCoy's 5A+10% FBS medium. After one week of culture, HCT116-luc cells were stained with a FITC-conjugated anti-Strep Tag 11 antibody (purchased from Genscript, diluted by 1:50) (stained at 4 C. for half an hour), and single-cell sorting was performed by BD FACSAria Ilsorter. Cells that express TT3 (that is, FITC positive) were sorted which can be used after multiplication culture.
Preparation Example 5: Preparation of Chimeric Antigen Receptor Modified T Cells Targeting TT3 by Lentivirus
(226) The nucleotide sequence of the DNA having the coding sequence of the chimeric antigen receptor targeting TT3 (as shown in SEQ ID NO: 55) was inserted into the third-generation self-inactivated lentiviral expression vector (CD810A-1; System Biosciences) according to conventional techniques in the art. The lentivirus was produced by HEK293FT cells (Life Technologies). The virus supernatant was harvested and concentrated by ultracentrifugation at 25,000 rpm for 3 hours. To prepare CAR-T cells transduced with lentivirus, Ficoll-Paque density gradient centrifugation (GE Healthcare) was firstly used to isolate human peripheral blood mononuclear cells (PBMCs) from fresh blood of healthy donors. After the isolated PBMCs were activated with human CD3/CD28 dynabeads (Life Technologies), they were cultured in AIM-V (Life Technologies) medium supplemented with 5% human AB serum (Valley Biomedical) and 300 IU/ml of IL-2 (Peprotech). After one week of culture, the activated PBMC cells were infected with a lentivirus comprising the sequence of the chimeric antigen receptor targeting TT3, and were cultured for another week before use.
Example 6: CAR-T Cells Targeting TT3 Effectively Kills Tumor Cells Stably Labeled with TT3 by Lentivirus in Mice
(227) The mouse model implanted with human tumors was further used to test the in vivo tumor killing effect of CAR-T cells targeting TT3. The experimental mice were non-obese diabetic/severe combined immunodeficiency/IL-2Rcnull (NSG) mice (aged 6 weeks to 8 weeks, female). Each mouse was implanted with 110.sup.7 human colorectal cell line HCT116-luc labeled with TT3 (prepared by preparation example 4). Seven days after the tumor was implanted, the tumor growth was observed on the IVIS Spectrum imaging platform using in vivo biological imaging technology (BLI), and the tumor growth was recorded with an imager (purchased from Perkin Elmer, USA). Mice with similar BLI intensity (BLI intensity refers to the fluorescence intensity of tumor cells in mice recorded by in vivo imager) were randomly divided into 4 groups: phosphate buffered saline (PBS) group, control RNA CAR-T cell group, RNA CAR-T cell targeting TT3 group, and DNA CAR-T cell targeting TT3 group, 5 mice in each group. The control RNA CAR-T (transfected with mGFPZ-CAR) and the RNA CAR-T targeting TT3 were prepared by the method of Preparation Example 2, and the DNA CAR-T targeting TT3 was prepared by the preparation method of Preparation Example 5. All mice in CAR-T cell groups were injected intraperitoneally with 110.sup.7 cells/time per mouse, and each mouse in the PBS group was injected intraperitoneally with 100 L of PBS. The cell injection protocol is: injection on the Day 7 of tumor inoculation. The behavior and survival of the mice were closely observed, and the tumor development status was recorded by BLI. All optical signals and pictures were recorded and analyzed by Xenogen in vivo imaging software v2.5.
(228) As shown in
(229) DNA CAR-T is better than RNA CAR-T because the CAR elements in the DNA CAR-T are continuously expressed and the CAR-T can continue to amplify in the body after encountering antigen; while in RNA CAR-T, the CAR elements are RNA which can only be expressed for 5 days to 7 days. During these 5 days to 7 days, the expression level will become lower and lower and the RNA will be gradually diluted as the amplification of the T cells. Therefore, DNA CAR-T is more effective than RNA CAR-T. DNA CAR-T merely requires a single injection, while RNA CAR-T requires multiple injections. However, only one injection was used herein.
Preparation Example 6: Preparation of a Recombinant Oncolytic Vaccinia Virus Comprising TT3 in the Genome by Crisper-Cas9
(230) 410.sup.5 CV-1 cells were resuspended in 2m1 of DMEM (Gibco) medium supplemented with 10% FBS (Sigma) and inoculated into one well of a 6-well plate (Costar). After incubating overnight, the old medium was discarded. The vaccinia virus (DDVV-RFP) was diluted with serum-free DMEM medium and 1 ml of virus dilution (0.05 MOI) was added to the cells. After 4 hours of virus infection, the culture medium comprising virus was discarded and then 2 ml of DMEM culture medium comprising 5% FBS was added. 1.5 g of Cas9 protein (purchased from IDT), 9 pmo1 of leader RNA-1 and 9 pmol of tracr RNA (purchased from IDT) were diluted in 37.5 l of Opti-MEM (Gibco), incubated at room temperature for 10 minutes, named as mixture 1. Another 1.5 g of Cas9 protein (purchased from IDT), 9 pmol of leader RNA-2 and 9 pmol of tracr RNA (purchased from IDT) were diluted in 37.5 l of Opti-MEM (Gibco), incubated at room temperature for 10 minutes, named as mixture 2. 6 l of Lipo3000 (purchased from Life Technologies) and 150 l of Opti-MEM were mixed, named as mixture 3. Mixture 1, mixture 2, and 75 l of mixture 3 were mixed together, incubated at room temperature for 15 minutes, named as mixture 4. 2 g of donor plasmid pFastbacl-TT3-PuroGFP (as shown in
(231) The donor plasmid pFastbac1-TT3-PuroGFP (as shown in
Preparation Example 7: Preparation of Tumor Cells Expressing TT3 on the Cell Surface by the Infection with Recombinant Oncolytic Vaccinia Virus
(232) On the Day 0, 1.510.sup.6 cells of SKOV3-luc, HCT116-luc and SK-HEP-1 were inoculated to 10 cm of cell culture dishes respectively. On the Day 1, the cell culture medium (the cell culture medium of SKOV3-luc and HCT116-luc were McCoy5A+10% FBS, and the culture medium of SK-HEP-1 was EMEM+10% FBS) was discarded. The recombinant oncolytic vaccinia virus (vvDD-TT3) obtained by the method of Preparation Example 6 was diluted into 5 ml of corresponding serum-free cell culture medium respectively, and then added to SKOV3-luc, HCT116-luc and SK-HEP-1 cell culture dish, respectively. The MOI of infection was 0.02, 0.2, 0.02 respectively, and the cell culture dish was shaken gently every half an hour. After 2 hours of infection, the virus dilution was discarded and cell culture medium comprising 5% FBS (Sigma) (SKOV3-luc and HCT116-luc were McCoy5A, and SK-HEP-1 culture medium was EMEM) was added. After further culturing for 46 hours, the cells were harvested. Biotin-conjugated anti-Strep tag II antibody (Genscript) was used as the primary antibody and streptavidin-APC was used as the secondary antibody (both diluted by 1:50) for staining. Flow cytometer (purchased from BD, C6 Samplar) was used to detect the expression of TT3 on the cell surface.
(233) The results are shown in
Example 7: In Vitro Killing Effect of CAR-NK Cells Targeting TT3 on Labeled Tumor Cells by Infection with Recombinant Oncolytic Vaccinia Virus
(234) This example tested the killing ability of CAR-modified NK cells targeting the labeling polypeptide on the labeled SKOV3-luc or SK-HEP-1 cells after the infection with recombinant oncolytic vaccinia virus. The CAR-modified NK cells targeting TT3 and the mGFP-Z-modified NK cells obtained according to the method of Preparation Example 3 (GFP was used to replace the antigen binding domain in aTT3-CD8-41BB-CD3 CAR, used as the negative control group of CAR) were respectively co-cultured with SKOV3-luc and SK-HEP-1 which were labeled with TT3 by infection with recombinant oncolytic vaccinia virus (obtained according to the method of preparation example 7; each type of tumor cells was mixed with NK cells at 48 hours after the infection with the recombinant oncolytic vaccinia virus) and unlabeled SKOV3-luc and SK-HEP-1 in a U-shaped 96-well plate, and the number ratio of CAR-NK effector cells to target cells (E:T) was 10:1. Each experiment was repeated 3 times. After 2 hours of co-cultivation, DELFIA EuTDA Cytotoxicity Kit (PerkinElmer, USA) was used to detect the ability of CAR-T cells to lyse tumor cells. The killing effect was calculated with the following formula: % specific lysis=((experimental group release (reading)blank group release (reading))/(maximum release (reading)blank group release (reading))100.
(235) The results are shown in
Preparation Example 8: The in Vitro Synthesis of mRNAs Encoding the Labeling Polypeptides TT1, TT2, TT3, C1&2a, C1&2b, and the in Vitro Synthesis of aTT1-CD8a-4-1BB-CD3 mRNA Targeting TT1, aTT2-CD8a-4-1BB-CD3 mRNA Targeting TT2, aTT3-CD8a-4-1BB-CD3 mRNA Targeting TT3
(236) Construction of recombinant expression vector pFastbac1-aTT1-CD8a-4-1BB-CD3, pFastbac1-aTT2-CD8a-4-1BB-CD3, pFastbac1-aTT3-CD8a-4-1BB-CD3: According to conventional techniques in the art, firstly, a fragment was synthesized which orderly comprises a T7 promoter, a 5UTR with Kozak sequence, a GM-CSF signal peptide, multiple cloning sites containing EcoRl, Sphl, Sall, Hind III and Clal, and globulin 3UTR (AIT Biotech), and then was inserted into the pFastbac1 vector (Life Technologies), so that a vector pFBCMV-T7 was constructed. Then another fragment was synthesized which comprises the following sequences: a linker sequence of EcoRI restriction site, a coding sequence of chimeric antigen receptor targeting TT1, TT2 or TT3, and a linker sequence of Sall restriction site. The pFBCMV-T7 vector and the synthesized gene fragments were subjected to EcoRI and Sall (NEB) double digestion reactions, and the digested products were recovered with agarose gel DNA recovery kit for DNA fragment recovery, and then ligated and transformed into One Shot Chemically Competent TOP10 chemically competent cells (purchased from Life Technologies), cultured at 37 C. for 18 hours. A single clone was picked and cultured at 37 C., 250 rpm for 16 hours, and extracted for plasmids by using a plasmid mini-extraction kit (purchased from Omega Bio Tek) to obtain pFastbac1-aTT1-CD8a-4-1BB-CD3, pFastbac1-aTT2-CD8a-4-1BB-CD3, pFastbac1-aTT3-CD8a-4-1BB-CD3. All plasmids were verified by sequencing.
(237) Construction of recombinant expression vector pFastbac1-TT1, pFastbac1-TT2, pFastbac1-TT3, pFastbac1-C1&2a, pFastbac1-C1&2b: firstly, the vector pFBCMV-T7 was obtained according to the above method, and a fragment comprising the following sequences was synthesized: a linker sequence of the EcoRI restriction site, a coding sequence of the labeling polypeptide (TT1, TT2, TT3, C1&2a or C1&2b), a linker sequence of the Sall restriction site. The pFBCMV-T7 vector and the synthesized gene fragments were subjected to EcoRI and Sall (NEB) double digestion reactions, and the digested products were recovered with agarose gel DNA recovery kit for DNA fragment recovery, and then ligated and transformed into One Shot Chemically Competent TOP10 chemically competent cells (purchased from Life Technologies), cultured at 37 C. for 18 hours. A single clone was picked and cultured at 37 C., 250 rpm for 16 hours, and extracted for plasmids by using a plasmid mini-extraction kit (purchased from Omega Bio Tek) to obtain pFastbac1-TT1, pFastbac1-TT2, pFastbac1-TT3, pFastbac1-C1&2a, pFastbac1-C1&2b. All plasmids were correct by verification by sequencing.
(238) Tail-PCR technique was used to synthesize a DNA double-stranded template with PolyA on the positive strand and corresponding PolyT on the reverse strand in a large-dose for in-vitro RNA synthesis, thereby the instability of the DNA template was reduced. The DNA having the coding sequence of labeling polypeptide TT1, TT2, TT3, C1&2a or C1&2b was amplified by Tail-PCR by using the pFastbac1-TT1, pFastbac1-TT2, pFastbac1-TT3, pFastbac1-C1&2a, pFastbac1-C1&2b vector as DNA template, respectively, so as to synthesize linearized DNA templates having the coding sequence of labeling polypeptide TT1, TT2, TT3, C1&2a, C1&2b, respectively.
(239) The DNAs having chimeric antigen receptor coding sequences were obtained by Tail-PCR amplification using the pFastbac1-aTT1-CD8a-4-1BB-CD3, pFastbac1-aTT2-CD8a-4-1BB-CD3 or pFastbac1-aTT3-CD8a-4-1BB-CD3 vector as DNA templates, so as to synthesize linearized DNA templates having coding sequence of chimeric antigen receptor aTT1-CD8a-4-1BB-CD3, aTT2-CD8a-4-1BB-CD3, aTT3-CD8a-4-1BB-CD3, respectively. The condition of Tail-PCR reaction refered to the instructions of KAPA HiFiHotStartReadyMix (2) and the reaction system (50 L) was as follows: Double distilled water (without nucleic acid enzyme): 25 L 2 KAPA HiFiHotStart Uracil+ReadyMix: 25 L P7 (SEQ ID NO: 15) (100 M): 0.15 L P8 (SEQ ID NO: 16) (100 M): 0.15 L Vector DNA template (500 ng/L): 0.5 L
(240) The above PCR products were identified with 1% (w/v) agarose gel. The correct products after identification were used for in vitro synthesis of the mRNAs of the labeling polypeptides TT1, TT2, TT3, C1&2a, C1&2b (i.e., the mRNAs corresponding to the nucleotide sequences as shown in SEQ ID Nos: 26, 27, 28, 29 and 30, respectively) and the aTT1-CD8a-4-1BB-CD3 mRNA targeting TT1, aTT2-CD8a-4-1BB-CD3 mRNA targeting TT2, aTT3-CD8a-4-1BB-CD3 mRNA targeting TT3 (i.e., the mRNAs corresponding to the nucleotide sequences as shown in SEQ ID Nos: 53, 54 and 55, respectively). The capped mRNA was synthesized using an mRNA in vitro synthesis kit which was mMESSAGEmMACHINE T7 ULTRA transcription kit (available from Invitrogen, USA) or mScript RNA system (available from Epicentre, USA). The synthesis was followed the instructions of the kit and used the reagents provided in the kit.
(241) The mRNA products synthesized in vitro were separated and identified with 1% (w/v) of agarose gel. The correct mRNAs after identification were stored at 80 C. for later use.
(242) Preparation Example 9: Preparation of SK-HEP-1 cells expressing TT3 on the cell surface by infection with recombinant oncolytic vaccinia virus
(243) On the Day 0, 110.sup.6 cells of SK-HEP-1 were inoculated to 10 cm of cell culture dishes. On the Day 1, the cell culture medium (EMEM+10% FBS) was discarded. The recombinant oncolytic vaccinia virus (vvDD-TT3) obtained by the method of Preparation Example 6 was diluted into 5 ml of the corresponding serum-free cell culture medium, and then added into the SK-HEP-1 cell culture dish. The MOI of infection was 0.25 or 0.50, and the cell culture dish was shaken gently every half an hour. After 2 hours of infection, the virus dilution was discarded and EMEM cell culture medium comprising 5% FBS (Sigma) was added. After further culture of 22 hours, the cells were harvested.
(244) The biotin-conjugated anti-Strep tag II antibody (Genscript) was used as the primary antibody and streptavidin-APC was used as the secondary antibody (both diluted by 1:50) for staining. Flow cytometer (purchased from ACEA Biosicences, Novocyte) was used to detect the expression of TT3 on the cell surface. As a result, GFP expression can be successfully detected (GFP expression can be detected directly by flow cytometer), and TT3 has high-intensity expression on the surface of infected tumor cells.
Example 8: In Vitro Killing Effect of CAR-T Targeting TT3 on Labeled Tumor Cells by Infection with Recombinant Oncolytic Vaccinia Virus
(245) This example tested the killing ability of CAR-modified T cells targeting labeling polypeptides on SK-HEP-1 cells that were labeled by infection with recombinant oncolytic vaccinia virus. The CAR modified T cells targeting TT3 and the mGFP-Z modified T cells (GFP was used to replace the antigen binding domain in aTT3-CD8-41BB-CD3 CAR, used as the negative control group of CAR) obtained by the method of Preparation Example 2 were co-cultured respectively with the SK-HEP-1 which was labeled with TT3 by infection with recombinant oncolytic vaccinia virus (obtained according to the method of Preparation Example 9; wherein the tumor cells were mixed with the above-mentioned T cells at 24 hours after the infection of the tumor cells with 0.25 MOI of recombinant oncolytic vaccinia virus; denoted as SK-HEP-1-vvDD) and unlabeled SK-HEP-1 (denoted as SK-HEP-1) in a U-shaped 96-well plate. The ratio of the number of the CAR-T effector cells to the target cells (E:T) is 40:1 (the number of CAR-T effector cells is 210.sup.6/well). Each experiment was repeated 3 times. After 3 hours of co-cultivation, the DELFIA EuTDA Cytotoxicity Kit (PerkinElmer, USA) was used to detect the ability of CAR-T cells to lyse tumor cells. The killing effect was calculated using the following formula: % specific lysis'((experimental group release (reading)blank group release (reading))/(maximum release (reading)blank group release (reading))100.
(246) The result is shown in
Example 9: Cytokine Secretion of CAR-NK Cells Targeting TT3 After Co-Cultured with Labeled Tumor Cells by Infection with Recombinant Oncolytic Vaccinia virus
(247) In this example, ELISA was used to detect the secretion of GM-CSF after the CAR-modified NK cells targeting a labeling polypeptide were co-cultured with labeled SK-HEP-1 cells infected with a recombinant oncolytic vaccinia virus overnight. The CAR-modified NK cells targeting TT3 and the mGFP-Z modified NK cells obtained according to the method of Preparation Example 3 (GFP was used to replace the antigen-binding domain in aTT3-CD8-41BB-CD3 CAR, used as the negative control group of CAR) were co-cultured respectively with the SK-HEP-1 which was labeled with TT3 by infection with recombinant oncolytic vaccinia virus (obtained according to the method of Preparation Example 9; wherein the tumor cells were mixed with the above-mentioned NK cells at 24 hours after the infection of the tumor cells with 0.25 MOI or 0.50 MOI of recombinant oncolytic vaccinia virus, respectively; denoted as SK-HEP-1-vvDD (0.25 MOI) and SK-HEP-1-vvDD (0.5 MOI), respectively), the SK-HEP-1 labeled with TT3 by electrotransfection with mRNA encoding TT3 (obtained according to the method of the preparation example 1; denoted as SK-HEP-1-EP) and unlabeled SK-HEP-1 (denoted as SK-HEP-1) in a 24-well plate. The ratio of the number of the above CAR-NK effector cells and the target cells (E:T) is 5:1 (the number of CAR-NK effector cells is 2.510.sup.4/well). After the co-cultivation overnight, the GM-CSF secretion by CAR-NK cells was detected by Human GM-CSF ELISA detection kit (R&D Company, American). Each experiment was repeated twice.
(248) As shown in
Example 10: Cytokine Secretion of CAR-T targeting TT3 After Co-Cultured WITH Labeled Tumor Cells by Infection with Recombinant Oncolytic Vaccinia Virus
(249) In this example, ELISA was used to detect the secretion of IFN and GM-CSF after CAR-modified T cells targeting a labeling polypeptide were co-cultured with labeled SK-HEP-1 cells infected with a recombinant oncolytic vaccinia virus overnight. The CAR modified T cells targeting TT3 and the mGFP-Z modified T cells obtained according to the method of Preparation Example 3 (GFP was used to replace the antigen-binding domain in aTT3-CD8-41BB-CD3 CAR, used as the negative control group of CAR) were respectively co-cultured with the SK-HEP-1 which was labeled with TT3 by infection with recombinant oncolytic vaccinia virus (obtained according to the method of Preparation Example 9; wherein the tumor cells were mixed with the above-mentioned T cells at 24 hours after the infection of the tumor cells with 0.25 MOI or 0.50 MOI of recombinant oncolytic vaccinia virus, respectively; denoted as SK-HEP-1-vvDD (0.25 MOI) and SK-HEP-1-vvDD (0.5 MOI), respectively), the TT3 labeled SK-HEP-1 by electrotransfection with mRNA encoding TT3 (obtained according to the method of the preparation example 1; denoted as SK-HEP-1-EP) and unlabeled SK-HEP-1 (denoted as SK-HEP-1) in a 24-well plate. The ratio of the number of the above CAR-T effector cells and the target cells (E:T) is 5:1 (the number of CAR-T effector cells is 2.510.sup.4/well). After the co-cultivation overnight, the Human IFN ELISA detection kit (Biolegend Company, American) was used to detect IFN secretion by CAR-T cell, and the Human GM-CSF ELISA detection kit (R&D Company, American) was used to detect GM-CSF secretion by CAR-T cell. Each experiment was repeated twice.
(250) As shown in
Example 11: Distribution of TT3 in Tumor Tissue after Intratumoral Injection of Recombinant Oncolytic Vaccinia Virus
(251) The experimental mice were non-obese diabetes/severe combined immunodeficiency/IL-2Rcnull (NCG) mice (6-8 weeks, female, obtained from Jiangsu Jicui Yaokang Biotechnology Co., Ltd.). Each mouse was implanted subcutaneously with 1 10.sup.7 cells of human liver cancer cell line SK-HEP-1. Six days after the tumor implantation, 12 mice with tumor size ranging from 80-120mm.sup.3 with good molding quality were selected and were injected with 50 l 510.sup.6 pfu vvDD-TT3 per mouse via intratumoral injection. On the 7, 14, 21, and 29 days after the vaccinia virus injection, respectively, 3 mice were randomly sacrificed, and the subcutaneous tumor tissues were stripped. The tumor tissues were cut from the middle by a scalpel, fixed and embedded in paraffin, and prepared into slices with 5 m thickness. All slices were stained with hematoxylin (obtained from Shanghai Beyotime Biotechnology Co., Ltd.) for nuclear staining, and TT3 was detected with biotin anti-strep tag II antibody (Genscript) at the same time. The secondary antibody was a rabbit two-step detection kit (obtained from Beijing Zhongshan Jinqiao Biotechnology Co., Ltd.), and the color development kit was a DAB horseradish peroxidase color development kit (obtained from Shanghai Beyotime Biotechnology Co., Ltd.). Finally, the panoramic scanning of the slices was performed by Jiangfeng automatic digital pathological slice scanner.
(252) The result was shown in
Example 12: The Effect of Combined Administration of Recombinant Oncolytic Vaccinia Virus and CAR-NK on the Growth of Subcutaneous Tumors in Mice
(253) Experimental mice were non-obese diabetes/severe combined immunodeficiency/IL-2Rcnull (NCG) mice (aged 6 weeks to 8 weeks, female, obtained from Jiangsu Jicui Yaokang Biotechnology Co., Ltd.). Each mouse was implanted subcutaneously with 110.sup.7 cells of human liver cancer cell line SK-HEP-1. Six days after tumor implantation, 30 mice with tumor size ranging from 80-120mm.sup.3 with good molding quality were selected and randomly divided into 6 groups, 5 mice in each group. The first group was the blank control group (IL-2/PBS/0.9% NaCl), wherein 6 days after tumor inoculation, 50 l of PBS was injected intratumorally (denoted as Day 0 after administration), and 10 days after PBS injection (that is, on Day 10 after administration), 100 l of 0.9% NaCl was injected intratumorally, and IL-2 was injected intraperitoneally on Day 10, 12, 14, 16, 18, 20, 22, 24, and 26 after administration. The second group was vvDD-TT3 group (that is, the recombinant oncolytic vaccinia virus single-drug group (IL-2/vvDD-TT3/0.9% NaCl)), wherein 6 days after tumor inoculation, 50 l vvDD-TT3 was injected intratumorally (denoted as Day 0 after administration), and 10 days after the vvDD-TT3 injection (that is, on Day 10 after administration), 100 l of 0.9% NaCl was injected intratumorally, and IL-2 was injected intraperitoneally on Day 10, 12, 14, 16, 18, 20, 22, 24, 26 after administration. The third group was the NK mGFPZ group (that is, the negative CAR NK single-drug control group (IL-2/PBS/NK mGFPZ)), wherein 6 days after tumor inoculation, 50 l PBS was injected intratumorally (denoted as Day 0 after administration), and 10, 13, 16, 19, 23, 26 days after PBS injection (that is, on Day 10, 13, 16, 19, 23, 26 after administration), 100 l of NK mGFPZ was injected intratumorally, and IL-2 was injected intraperitoneally on Day 10, 12, 14, 16, 18, 20, 22, 24, 26 after administration. The fourth group was the NK aTT3 CAR group (that is, the positive CAR NK single-drug group (IL-2/PBS/NK aTT3 CAR)), wherein 6 days after tumor inoculation, 50 l PBS was injected intratumorally (denoted as Day 0 after administration), and 10, 13, 16, 19, 23, and 26 days after PBS injection (that is, on Day 10, 13, 16, 19, 23, 26 after administration), 100 l NK aTT3 CAR was injected intratumorally, and IL-2 was injected intraperitoneally on Day 10, 12, 14, 16, 18, 20, 22, 24, 26 after administration. The fifth group was the vvDD-TT3+NK mGFPZ group (that is, the combined administration control group (IL-2/vvDD-TT3/NK mGFPZ)), wherein 6 days after tumor inoculation, 50 l of vvDD-TT3 was injected intratumorally (denoted as Day 0 after administration), and 10, 13, 16, 19, 23, and 26 days after vvDD-TT3 injection (that is, on Day 10, 13, 16, 19, 23, 26 after administration), 100 l of NK mGFPZ was injected intratumorally, and IL-2 was injected intraperitoneally on Day 10, 12, 14, 16, 18, 20, 22, 24, 26 after administration. The sixth group was the vvDD-TT3+NK aTT3 CAR group (that is, the combined administration group of the present invention (IL-2/vvDD-TT3/NK aTT3 CAR)), wherein 6 days after tumor inoculation, 50 l vvDD-TT3 was injected intratumorally (denoted as Day 0 after administration), and 10, 13, 16, 19, 23, and 26 days after vvDD-TT3 injection (that is, on Day 10, 13, 16, 19, 23, 26 after administration), 100 l NK aTT3 CAR was injected intratumorally, and IL-2 was injected intraperitoneally on Day 10, 12, 14, 16, 18, 20, 22, 24, 26 after administration. NK mGFPZ and NK aTT3 CAR were prepared according to the method of Preparation Example 3. CAR-NK cells were administrated by way of intratumoral injection of 110.sup.7 cells per mouse every time, IL-2 was injected intraperitoneally in the amount of 20000 IU per mouse every time, and the administration dose of vvDD-TT3 was 510.sup.6 pfu per mouse. The long diameter and short diameter of the tumor were measured and recorded with a vernier caliper on the day of grouping, twice a week after the first administration, and before euthanasia, respectively. The tumor volume was calculated and the tumor growth curve was drawn based on the tumor volume. The calculation formula of tumor volume is V=long diametershort diameter.sup.2. The calculation formula of relative tumor volume (RTV) is RTV=Vt/V0, wherein the Vt was the tumor volume obtained by each measurement, the V0 was the initial tumor volume (before administration). The calculation formula of relative tumor proliferation rate (T/C)% was T/C %=average RTV of the administration group/average RTV of the blank control group100%, wherein if T/C %40%, the RTV of the experimental group to the RTV of the model group was statistically P<0.05, which means that there is inhibitory effect on tumor growth. On the contrary, if T/C %>40%, there is no inhibitory effect on tumor growth.
(254) As shown in