ATP-Dependent Agonists of Immune Cells Function as Anticancer Agents
20250197521 ยท 2025-06-19
Inventors
Cpc classification
C07K16/2875
CHEMISTRY; METALLURGY
C07K16/2866
CHEMISTRY; METALLURGY
C07K16/2809
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
C07K2318/10
CHEMISTRY; METALLURGY
C07K14/70575
CHEMISTRY; METALLURGY
C07K16/2896
CHEMISTRY; METALLURGY
International classification
C07K14/705
CHEMISTRY; METALLURGY
Abstract
The present disclosure provides polypeptide constructs that act as agonists of immune cell function when exposed to sufficient levels of ATP to cause their assembly into dimers or higher level complexes (e.g., trimers, tetramers, etc.). The complexes of the constructs are capable of stimulating immune cells (e.g., cytotoxic CD8+ T cell and/or NK cells) that function to promote anti-tumor immune responses. The constructs may be employed as anticancer agents/therapeutics for the treatment of solid tumors that have elevated levels of ATP.
Claims
1. A polypeptide construct comprising a nucleotide binding domain (NBD) amino acid (aa) sequence, and tumor-specific binder (TSB) aa sequence, optionally joined by a linker peptide sequence; wherein the NBD comprises one or more adenosine triphosphate (ATP) binding sites and can either homodimerize or heterodimerize with a cognate non-identical NBD in the presence of ATP (e.g., the NBD of TAP1 or TAP2 which can heterodimerize).
2.-12. (canceled)
13. A polypeptide construct comprising a nucleotide binding domain (NBD) amino acid (aa) sequence, and an activating domain (AD) aa sequence, optionally joined by a linker peptide sequence; wherein the NBD comprises one or more adenosine triphosphate (ATP) binding sites and can either homodimerize or heterodimerize with a cognate non-identical NBD in the presence of ATP.
14. The polypeptide construct of claim 13, further comprising a scaffold aa sequence.
15. The polypeptide construct of claim 13, wherein the AD is selected from: (i) IL-7, IL-15, IL-12 or a subunit thereof; (ii) an aa sequence that binds to one of PD1, CD40, 4-1BB, IL-10R, CTLA-4, or CD28.
16. A composition comprising a first polypeptide construct and a second polypeptide construct of claim 13, wherein: the first polypeptide construct comprises a first NBD aa sequence and the second polypeptide construct comprises a second NBD aa sequence, and the first and second NBD aa sequences are cognate sequences that may heterodimerize; and the first polypeptide construct comprises the p40 subunit of IL-12 and the second polypeptide construct comprises the p35 subunit of IL-12.
17. The composition of claim 16, wherein the first NBD comprises a TAP1 NBD aa sequence and the second NBD comprises a TAP2 NBD aa sequence.
18. A polypeptide construct comprising a nucleotide binding domain (NBD) amino acid (aa) sequence, and an immune cell engager (ICE) aa sequence, optionally joined by a linker peptide sequence; wherein the NBD comprises one or more adenosine triphosphate (ATP) binding sites and can heterodimerize with a cognate non-identical NBD in the presence of ATP (e.g., the NBD of TAP1 or TAP2 which can heterodimerize).
19. The polypeptide construct of claim 18, further comprising a scaffold aa sequence.
20. A composition comprising a first polypeptide construct comprising a nucleotide binding domain (NBD) amino acid (aa) sequence, and tumor-specific binder (TSB) aa sequence, optionally joined by a linker peptide sequence; wherein the NBD comprises one or more adenosine triphosphate (ATP) binding sites and optionally a scaffold sequence, and a second polypeptide construct of claim 18, wherein: (i) the first polypeptide construct comprises one or more first heterodimerizing NBD aa sequences and the second polypeptide construct comprises one or more second heterodimerizing NBD aa sequences; (ii) each of the one or more first heterodimerizing NBD aa sequences are cognate binding partners of the one or more second heterodimerizing NBD aa sequences; (iii) the first polypeptide construct and the second polypeptide construct bind to each other through interactions between at least one of the one or more first heterodimerizing NBD aa sequences and at least one of the one or more second heterodimerizing NBD sequences in the presence of ATP to form a heterodimer or higher order complex of the first and second polypeptide constructs; (iv) the TSB of the first polypeptide construct binds to a tumor-associated antigen (TAA) from the group consisting of: mesothelin, Epithelial Cell Adhesion Molecule (EpCAM), Cytotoxic T-Lymphocyte Associated Protein 4 (CTLA-4), carbonic anhydrase IX (CAIX), cadherins, carcinoembryonic antigen (CEA), cellular-mesenchymal epithelial transition factor (c-MET), Epidermal Growth Factor Receptor (EGFR) family members, Ephrin Type-A Receptor 3 (EphA3), Fibroblast Activation Protein Alpha (FAP), folate-binding protein, Folate Receptor alpha (FR-alpha), Erb-B2 Receptor Tyrosine Kinase 2 (HER2), Erb-B2 Receptor Tyrosine Kinase 3 (HER3), Insulin Like Growth Factor 1 Receptor (IGF-1R), integrin V3, integrin 5, Solute Carrier Family 39 Member 6 (Liv1), a Melanoma-Associated Antigen family A member (MAGEA), a Melanoma-Associated Antigen family C member (MAGEC), a mucin (e.g., MUC1), a New York Esophageal Squamous Cell Carcinoma 1 protein (NY-ESO-1, Cancer/Testis Antigen 1A, Cancer/Testis Antigen 1B), Cancer/Testis Antigen 2 (NY-ESO-2, CTAG2), Prostate-Specific Membrane Antigen (PSMA), Receptor Activator of Nuclear Factor Kappa B Ligand (RANKL), Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1), tenascin, TNF Receptor Superfamily Member 10a (TRAILR1), TNF Receptor Superfamily Member 10b (TRAILR2), and Vascular Endothelial Growth Factor Receptor (VEGFR); and (v) the ICE of the second polypeptide construct comprises a Fab, Fab, scFv, aptamer, or nanobody with affinity for a protein selected from the group consisting of: CD3, CD4, CD8, TCR, CD2, TCR chain, TCR chain, TCR, TCR chain, TCR chain, TRGV9, CD84, CXCR1, CD13, CD33, CD34, and CD16.
21. A method of treating a cancer comprising administering a construct or composition of claim 13 to a patient or subject.
22. The use of a construct or composition of claim 13 for the preparation of a medicament for the treatment of a cancer.
23. A polypeptide construct or composition of claim 13 for the treatment of a cancer.
24. The method of claim 21, wherein the cancer comprises a solid tumor.
25. The method of claim 24, wherein the cancer is a mesothelioma, melanoma, sarcoma, carcinoma, carcinosarcoma, lymphoma, or a germ cell tumor.
26. A nucleic acid comprising a sequence encoding one or more constructs, or one or more constructs of a composition of claim 13.
27. A vector comprising the nucleic acid of claim 26, optionally under the control of a constitutive promoter or an inducible promoter.
28. A cell comprising the nucleic acid of claim 26.
29. The cell of claim 28, wherein the cell is a mammalian cell, yeast cell, insect cell, or bacterial cell.
Description
IV. BRIEF DESCRIPTION OF THE DRAWINGS
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
V. DETAILED DESCRIPTION
A. Definitions
[0023] As used herein amino acid (aa singular or aas plural) means the naturally occurring proteogenic amino acids incorporated into polypeptides and proteins in mammalian cell translation. Unless stated otherwise these are: L (Leu, leucine), A (Ala, alanine), G (Gly, glycine), S (Ser, serine), V (Val, valine), F (Phe, phenylalanine), Y (Tyr, tyrosine), H (His, histidine), R (Arg, arginine), N (Asn, asparagine), E (Glu, glutamic acid), D (Asp, asparagine), C (Cys, cysteine), Q (Gln, glutamine), I (Ile, isoleucine), M (Met, methionine), P (Pro, proline), T (Thr, threonine), K (Lys, lysine), and W (Trp, tryptophan). Aa also includes the aas hydroxyproline and selenocysteine, which appear in some proteins found in mammalian cells; however, unless their presence is expressly indicated, they are not understood to be included.
[0024] Substitutions of aa at specific locations in a sequence are indicated by the original aa given in single or triple letter code, the numerical position of that aa, and the aa which is substituted into the sequence in single or triple letter code. By way of example an alanine (A) at position 12 of a sequence substituted with a proline (P) would be indicated as A12P using single letter code, or Ala12Pro using triple letter code. Where more than one substitution appears in the same sequence they may be separated by a slash /. Accordingly the above-mentioned A12P substitution in the same sequence as a V23A and a Q41G substitution may be indicated by the sequence A12P/V23A/Q41G.
[0025] The terms polypeptide and protein are used interchangeably herein, and refer to a polymeric form of aas, which unless stated otherwise are the naturally occurring proteinogenic L-aas that are incorporated biosynthetically into proteins during translation in a mammalian cell.
[0026] Alignments to identify corresponding residues of different sequences may be conducted using the US National Center for Biotechnology Information (NCBI) BLAST program (blastp release of BLAST+2.9.0 on the world wide web at blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE=Proteins) or the European Bioinformatics Institute's Clustal Omega program (version 1.2.4 available at www.ebi.ac.uk/Tools/msa/clustalo/) using default parameters. Unless stated otherwise, Clustal Omega is used to identify corresponding residues in different sequences.
[0027] The percent sequence identity refers to the percentage of amino acids or nucleotides that are the same between two amino acid or nucleic acid sequences that have been aligned. Unless stated otherwise, the percentage sequence identity is determined using BLAST+release 2.9.0 employing a blastp alignment for polypeptides or a blastn alignment for nucleic acids with default parameters.
[0028] The term substantially is intended to encompass both wholly and largely but not wholly unless indicated otherwise. For example, an Ig Fc that substantially does not induce cell lysis via ADCC or CDC means an Ig Fc that induces no cell lysis at all or that largely but not wholly induces no cell lysis via ADCC or CDC.
B. Description
[0029] The microenvironment within tumors differs in a number of ways from nonmalignant tissues, including differences in any one or more of its pH, ATP content, limited oxygen levels (hypoxia), and tumor protease (e.g., MMPs) levels. Extracellular ATP levels in normal (non-tumor) tissues are typically in the range of 0.01-0.1 micromolar (M) in normal tissues, whereas the extracellular level of ATP in solid tumors is generally in the range of 50-200 M. The present disclosure describes and provides for the use of the ATP levels found in tumor microenvironments to bring about an immune response to cells in the tumor. More specifically, some constructs described herein may comprise an immune cell activating domain (AD) (i.e., an activating domain of an immunomodulatory molecule that engages and stimulates an immune cell) and at least one NBD that forms a substantial amount of dimers or other higher order complexes in the presence of ATP at the levels found in the tumor microenvironment (TME). Dimerization or higher order complex formation of the NBD results in a complex presenting two or more immune cell ADs. The use of immune cell ADs that can stimulate immune cells such as NK cells and CD8+ T cells when presented as dimers or higher order complexes, but that do not by themselves stimulate the same immune cells to the same degree when presented singly, permits intratumoral stimulation of an immune response within the TME.
[0030] Other constructs described herein may comprise tumor-specific binding domains that bind to TAAs or immune cell engaging domains and at least one NBD that forms a substantial amount of dimers or other higher order complexes in the presence of ATP at the levels found in the tumor microenvironment. Such constructs may optionally comprise an AD. Dimerization or higher order complex formation of the NBD results in dimers or higher order complexes that can recruit and/or stimulate immune cells in the TME. Because dimerization or other higher order complexes of such constructs do not form higher order complexes outside of the TME, they permit intratumoral stimulation of an immune response while limiting immune stimulation outside of the tumor.
[0031] Because the ADs, tumor-specific binding domains, and immune cell engagers of the uncomplexed constructs do not effectively stimulate cells such as NK cells and CD8+ T effector cells when presented singly, the constructs do not result in systemic immune activation and the associated toxic effects. The constructs described herein do, however, provide immune stimulation localized to the TME where there is sufficient ATP to drive complex formation, and may thus be considered a form of ATP-dependent agonists of immune cell function whose action is limited to that environment. In addition, because the complexed forms of the constructs (e.g., dimers, trimers, etc.) have an increase in size and molecular weight, their diffusion from the TME is reduced further, restricting their action to the TME. Those dimers or higher order complexes that do diffuse out of the TME will dissociate into ineffective individual monomers as the ATP levels in the surrounding non-malignant tissue are too low to support their complexation. Accordingly, the immune stimulation provided by the complexes of the constructs described herein is understood to be reversible and restricted to microenvironments where ATP levels are sufficiently high to induce complexation.
C. The Structure of ATP-Dependent Agonists of Immune Cell Function
1. ATP-Dependent Agonists of Immune Cell Function Comprising NBDs and AD
[0032] In their simplest form the NBD-containing molecular constructs described herein comprise a NBD and an AD that engages and stimulates an immune cell (e.g., CD8+ T cell, NK cell, etc.). The NBD comprises one or more ATP binding sites that when occupied by ATP result in two or more molecules of the construct forming a duplex or higher order complex (triplex, etc.) due to interactions between the construct's NBDs. Such molecular constructs optionally comprise one or more independently selected scaffold aa sequences and/or one or more independently selected linker sequences. See, e.g.,
[0033] The NBD aa sequence, the scaffold aa sequence and the AD may be organized in any order. In a first case, the construct comprises (e.g., from N-terminus to C terminus) the NBD aa sequence, the scaffold aa sequence, and the AD. In a second case, the construct comprises from N-terminus to C-terminus the NBD aa sequence, the AD and the scaffold aa sequence. In a third case, the construct comprises from N-terminus to C-terminus, the AD, the scaffold aa sequence, and the NBD aa sequence. In a fourth case, the construct comprises from N-terminus to C-terminus, the AD, the NBD aa sequence, and the scaffold aa sequence. In a fifth case, the construct comprises from N-terminus to C-terminus, the scaffold aa sequence, the AD, and the NBD aa sequence. Lastly, in a sixth case, the construct comprises from N-terminus to C-terminus, the scaffold aa sequence, the NBD aa sequence, and the AD.
2. NBD-Containing Constructs Comprising Tumor-Specific Binders and/or Immune Cell Engagers
[0034] The NBD-containing constructs described herein may, in addition to the NBDs, also comprise one or more tumor-specific binding domains and/or an immune cell engaging domain. As discussed in more detail below, tumor-specific binding domains, also referred to as tumor-specific binders, are domains of NBD-containing constructs that have affinity for TAAs expressed on the surface of tumor cells. Immune cell engaging domains, also referred to as immune cell engagers, which are also discussed in more detail below, are domains of NBD-containing constructs that have affinity for cell surface molecules (e.g., antigens) of immune cells. Unless stated otherwise, immune cell engagers, which may be, for example, antibody fragments, are monovalent to avoid the potential for off-target stimulation (e.g., systemic stimulation) of the immune cells to which they bind. NBD-containing constructs comprising one or more tumor-specific binders and/or an immune cell engager may also comprise one or more ADs. See
[0035] Tumor-specific binders and immune cell engagers may be incorporated into NBD-containing constructs that form heterodimers or other higher order complexes (e.g., trimers) in the presence of ATP at the concentration found in, for example, the TME environment. Heterodimer formation may be driven by the incorporation of a first (1.sup.st) heterodimerizing NBD in the first member of the pair of constructs and a second (2.sup.nd) heterodimerizing NBD in the second member of the pair of constructs. The 1.sup.st and 2.sup.nd heterodimerizing pairs of NBDs act as cognate binding partners. In order to exemplify the type of such NBD-containing construct pairs encompassed by the present disclosure, a series of non-limiting examples of such NBD-containing construct pairs is set forth in
[0036] Entries A and B of
[0037] An exemplary pair of constructs that illustrates heterodimerization of the type shown in entries A or B of
[0038] Entries C and D of
[0039] A pair of constructs that exemplify entry C of
[0040] Entries A to I of
[0041] Entries J through M of
[0042] Exemplary pairs of constructs that illustrate heterodimerizing constructs of the type found in
[0043] Compositions comprising a mixture of constructs find use in therapeutic applications where the use of more than one tumor-specific binder directed against different TAAs can avoid having the tumors escape monotherapy with a single construct. Similarly, the use of more than one immune cell engager and/or AD can recruit more than one type of immune cell and provide a more vigorous immune response to the tumor cells, thereby effectuating a more robust immune response to the tumor than would occur using monotherapy with a single construct.
3. NBD-Containing Constructs Comprising Two or More NBDs and the Formation of Complexes of NBD-Containing Molecular Constructs
[0044] The NBD-containing constructs described herein may comprise two or more NBDs that permit the constructs to effectively polymerize into complexes in the presence of ATP. The two or more NBDs may, for example, be arranged as a tandem pair. When placed in tandem the NBDs are adjacent to each other in the construct and are not separated by any element of the constructs other than an intervening linker aa sequence (e.g., no AD(s), scaffold, tumor-specific binding domain(s), or immune cell engaging domain(s) are present between the tandem NBDs). Additional NBDs may be located in the construct so that they are not placed in tandem. For example, NBD-containing constructs comprising two or more NBDs may be formed by replacing the NBD of the first through sixth cases described above in section C.1. (ATP-dependent agonists of immune cell function comprising NBDs and AD) with a pair of NBDs in tandem. NBD-containing constructs comprising two or more NBDs (e.g., in tandem) may also be formed from constructs comprising an immune cell engager or tumor-specific binder.
[0045] Complexes of NBD-containing molecular constructs comprising at least two NBDs can be formed by placing the constructs in an environment, such as a TME, where ATP levels are sufficiently high for ATP to occupy the binding sites. Such complexes are exemplified in
[0046] Complexes may comprise at least two NBDs arranged in tandem, with at most a linker aa sequence (e.g., a rigid linker) separating the NBD aa sequences (see
[0047] NBD-containing constructs comprising at least two NBDs and an AD are exemplified in
[0048] In addition to the NBD-containing constructs described above, this disclosure provides for NBD-containing constructs that comprise at least two NBDs and a tumor-specific binding aa sequence (tumor-specific binder) exemplified by
[0049] Once present in the TME where ATP levels permit the NBD domains to form higher order complexes (e.g., dimers), constructs that comprise at least two NBDs and a tumor-specific binder and/or an immune cell engager form large complexes that can lead to immune stimulation. Constructs comprising at least two NBDs, a scaffold comprising an IgFc, and a tumor-specific binder can form a complex in the TME (see, e.g.,
[0050] Combining a NBD-containing construct comprising at least two NBDs and a tumor-specific binder (e.g.,
[0051] The tumor-specific binder and/or immune cell engager aa sequences present in each construct used to form a complex need not be the same. Accordingly, the complexes of
[0052] Because the tumor-specific binders, immune cell engagers, and ADs are provided by different constructs that enter into the complex formed in the TME, the composition of the complex can be controlled by mixing different constructs (e.g., prior to or during administration to a patient). Thus, a single construct may find use in different therapeutic combinations.
D. Elements of NBD-Containing Constructs
1. NBDs and Interactions With ATP
[0053] NBDs for incorporation into the constructs described herein may be selected based on several criteria. Where the constructs are intended for human therapeutic use, the NBDs are preferentially derived from human ATP binding proteins to limit their immunogenicity and are preferably able to undergo solution phase dimerization or higher complex formation when exposed to sufficient ATP. Where non-human proteins that are immunogenic are employed, immunogenic portions may be humanized by altering the immunogenic regions to more closely or completely match their human homologs. The solution phase formation of dimers or higher order complexes used in the constructs described herein occurs at ATP concentrations found in the target TME, but not in normal tissues. Accordingly, a NBD for use in the constructs provided herein may have, for example, a dissociation constant for ATP from about an order of magnitude above (10 times above) the upper level found in the extracellular space of normal tissues (i.e., about 1 M or higher) up to about the level of ATP found in the TME. In some cases the affinity of a NBD will be from about 1 M to about 200 M. For example, the ATP affinity of a NBD may be in a range from about 1 M to about 5 M, or from about 5 M to about 25 M. The ATP affinity of a NBD may be in a range from about 25 M to about 50 M. In other examples, the affinity of a NBD may be in a range from about 50 M to about 100 M or from about 100 M to about 200 M.
[0054] NBDs of some proteins form homodimers in the presence of sufficient levels of ATP, while others form heterodimers in the presence of sufficient levels of ATP. Both homodimerizing NBDs and heterodimerizing NBDs may be employed in various aspects of the polypeptide constructs described herein. Where it is desirable to have the NBDs form homodimers in solution when sufficient levels of ATP are present, aa residues at the interface between the dimers may be modified to either remove or substitute aa residues that interfere with interface formation between two NBD molecules. Alternatively, it is possible to substitute aas not contributing to the interactions between the two NBD molecules with aas that will contribute to interactions resulting in homodimer formation.
a) ATP-Binding Cassettes as NBDs
[0055] A number of proteins comprise NBDs that are suitable for use as NBDs of the constructs described herein. Among those proteins, ATP-binding cassette (ABC) transporters represent suitable candidates in part because they are an abundant transporter family that is highly conserved and as such unlikely to be immunogenic. ABC transporters are a large superfamily of membrane proteins with diverse functions that utilize the energy from ATP hydrolysis to facilitate transport of substrates either into or out of the cytoplasm. See, e.g., Locher, Philos Trans R Soc Lond B Biol Sci., 364(1514): 239-245 (2009), and reference cited therein. The human genome codes for 48 or 49 distinct ABC transporters. Id. The ABC transporters are divided into seven distinct family members, ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White. A representative member of each family including TAP1 are aligned in
[0056] Where it is desirable to have the NBDs of ABC proteins form homodimers in solution when sufficient ATP is present, residues at the interface between the dimers may be modified to either remove or substitute aa residues that interfere with interface formation, or to substitute aas not contributing to the interface interactions with aas that can contribute to the interactions. By way of example, it is known that the NBD of rat TAP1 homodimerizes in solution and can be used as a model for the formation of the ATP-sandwich interface to bring about solution phase homodimerization in the presence of ATP (see, e.g., Vakkasoglu et al., (2107) PLoS ONE, 12(5): e0178238. https://doi.org/10.1371/journal.pone.0178238). Alignment of a NBD aa sequence with a sequence known to undergo homodimerization, e.g., the rat TAP1 NBD, can be used to guide alterations in a target sequence. Alignments may be carried out using the US National Center for Biotechnology Information (NCBI) BLAST program (blastp release of BLAST+2.9.0 on the world wide web at blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE=Proteins) or the European Bioinformatics Institute's Clustal Omega program (version 1.2.4 available at www.ebi.ac.uk/Tools/msa/clustalo/) using default parameters. Unless stated otherwise Clustal Omega is employed.
[0057] A NBD aa sequence of an ABC containing protein may comprise all or part of the NBD domain of a Phospholipid-Transporting ATPase (ABC or ABCA1 transporter) encoded by the ABCA1 gene, UniProtKB-O95477 (SEQ ID NO:1). A NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:1.
[0058] A NBD aa sequence may comprise all or part of the NBD domain of Multidrug Resistance Protein 1 (MDR/TAP) encoded by the ABCB1 gene, UniProtKB-P08183 (SEQ ID NO:2). A NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:2.
[0059] A NBD aa sequence may comprise all or part of the NBD domain of a Multidrug resistance-associated protein (MRP, Multidrug resistance-associated protein 1) encoded by the ABCC1 gene, UniProtKB-P33527 (SEQ ID NO:3). A NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:3.
[0060] A NBD aa sequence may comprise all or part of the NBD domain of an ATP-binding cassette subfamily D member 1 protein (ALD, Adrenoleukodystrophy Protein) encoded by the ABCD1 gene, UniProtKB/Swiss-Prot: P33897 (SEQ ID NO:4). A NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:4.
[0061] A NBD aa sequence may comprise all or part of the NBD domain of an ATP-binding cassette subfamily E member 1 protein (OABP, 2-5-Oligoadenylate-Binding Protein) encoded by the ABCE1 gene, UniProtKB/Swiss-Prot: P61221 (SEQ ID NO:5). A NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:5.
[0062] A NBD aa sequence may comprise all or part of the NBD domain of an ATP-binding cassette subfamily F member 1 protein (GCN20, TNFalpha-Inducible ATP-Binding Protein) encoded by the ABCF1 gene, UniProtKB-Q8NE71 (SEQ ID NO:6). A NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:6.
[0063] A NBD aa sequence may comprise all or part of the NBD domain of an ATP-binding cassette subfamily G member 1 protein (White, Homolog Of Drosophila White) encoded by the ABCG2 gene, UniProtKB/Swiss-Prot: P45844 (SEQ ID NO:7). A NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:7.
(1) TAP1 and TAP2 ATP Binding Cassettes as NBDs
[0064] The TAP1 and TAP2 proteins are cognate binding partners that act as a transporter coupling ATP binding and heterodimerization with peptide translocation across inner cell membranes. TAP1 and TAP2 are members of the ABC transporter superfamily that represents a source of NBDs for use in the constructs provided herein. Rat TAP1 NBD is known to undergo homodimerization in the presence of ATP. The NBD of human TAP1 does not undergo homodimerization in the presence of ATP, but can be induced to undergo homodimerization using previously defined substitutions. See, e.g., Vakkasoglu et al. (2017) D-helix influences dimerization of the ATP-binding cassette (ABC) transporter associated with antigen processing 1 (TAP1) nucleotide-binding domain, PLoS ONE, 12(5): e0178238; on the world wide web at doi.org/10.1371/journal.pone.0178238. Substitutions leading to TAP1 homodimerization include those at one or more (e.g., each of) N676, S677, Q680, E682, and Q683, which are bolded and italicized in SEQ ID NO:8. For example, the TAP1 substitutions leading to homodimerization may include one or more (e.g., all) of N676G, S677N, Q680R, E682Q, and Q683R substitutions. The portions (e.g., domains) of TAP1 and TAP2 proteins employed as NBDs may also include substitutions of one or more cysteines present in the sequence (e.g., with serine residues) to prevent undesirable disulfide bond formation leading to non-functional folding or undesirable intermolecular disulfide bond formation. TAP1 and TAP2 NBDs may also include a His tag, for example at the C-terminus of the domain for purification of constructs comprising those NBDs.
[0065] A NBD aa sequence from human TAP1 (SEQ ID NO:9) may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to the NBD aa sequence (aas 492-748) of NCBI Reference Sequence: NP_000584.3 of SEQ ID NO:8, or of UniProtKB-Q03518-2:
TABLE-US-00001 (ReferenceSequence:NP_000584.2,SEQIDNO:8) 1 MASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAV 61 GLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWG 121 APGSADSTRLLHWGSHPTAFVVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCL 181 GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAV 241 LEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLS 301 ENLSLFLWYLVRGLCLLGIMLWGSVSLIMVTLITLPLLFLLPKKVGKWYQLLEVQVRESL 361 AKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGM 421 LLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFE 481 YLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPN 541 GSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIA 601 YGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRK 661 PCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAI 721 REGGTHQQLMEKKGCYWAMVQAPADAPE;
[0066] The TAP1 NBD domain common to both the NCBI and UniProt sequence is: [0067] 1 GLLTPLHLEG LVQFQDVSFA YPNRPDVLVL QGLTFTLRPG EVTALVGPN GSGKSTVAALL [0068] 61 QNLYQPTGGQ LLLDGKPLPQ YEHRYLHRQV AAVGQEPQVF GRSLQENIA YGLTQKPTMEE [0069] 121 ITAAAVKSGA HSFISGLPQG YDTEVDEAGS QLSGGQRQAV ALARALIRKP CVLILDDATS [0070] 181 ALDANSQLQV EQLLYESPER YSRSVLLITQ HLSLVEQADH ILFLEGGAIR EGGTHQQLME [0071] 241 KKGCYWAMVQ APADAPE (SEQ ID NO:9). Residues N676, S677, Q680, E682, and Q683 of SEQ ID NO:8, associated with homodimerization, appear as N185, S186, Q189, E191, and Q192 in SEQ ID NO:9 and are bolded and italicized. A NBD aa sequence from human TAP1 may, for example, comprise an aa sequence having greater than 97% or greater than 98% sequence identity to at least 230 contiguous aas of the NBD of the aa sequence set forth in NCBI Reference Sequence: NP_000584.2 (aas 492-748) provided as SEQ ID NO:9.
[0072] A NBD aa sequence from human TAP1 may, for example, comprise substitutions at the aa residues corresponding to C662 (e.g., C662S) and C735 (e.g., C735S) of SEQ ID NO:8. The NBD aa sequence from human TAP1 may also, for example, comprise substitutions at aas corresponding to one or more of N676, S677, Q680, E682, and Q683 (e.g., N676G, S677N, Q680R, E682Q, and/or Q683R) of SEQ ID NO:8, which are bolded and italicized in SEQ ID NO:10 below. The NBD aa sequence from human TAP1 may also comprise a substitution at, for example, the Asp corresponding to D668 of SEQ ID NO:8, which renders the NBD ATP hydrolysis-deficient. Accordingly, a NBD polypeptide aa sequence of TAP1 may, for example, comprise the aa sequence of SEQ ID NO:10, or an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence:
TABLE-US-00002 (SEQIDNO:10) 1 GLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALL 61 QNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEE 121 ITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPSVLILDNATS 181 GNQLRVQRLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLME 241 KKGSYWAMVQAPADAPE.
Alternatively, the NBD aa sequence may have greater than 97% or greater than 98% sequence identity to at least 230 or 240 contiguous aas of the sequence provided in SEQ ID NO:10.
[0073] A NBD aa sequence from human TAP1 may, for example, comprise substitutions corresponding to those at C662 (e.g., C662S) and C735 (e.g., C735S) of SEQ ID NO:8. The NBD aa sequence from human TAP1 may also, for example, comprise substitutions corresponding to those at one or more of N676, S677, Q680, E682, and Q683 (e.g., N676G, S677N, Q680R, E682Q, and/or Q683R) in SEQ ID NO:8, which are bolded and italicized in SEQ ID NO:87 below. In addition, the NBD aa sequence from human TAP1 may comprise a substitution at the Asp corresponding to D668 of SEQ ID NO:8, which renders the NBD ATP hydrolysis-deficient. Accordingly, a NBD polypeptide aa sequence of TAP1 may, for example, comprise the aa sequence of SEQ ID NO:87 or an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence:
TABLE-US-00003 (SEQIDNO:87) 1 MPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTV 61 AALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKP 121 TMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPSVLILD 181 NATSALDAGNQLRVQRLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQ 241 QLMEKKGSYWAMVQAPADAPE
Alternatively, the NBD aa sequence may have greater than 97% or greater than 98% sequence identity to at least 250 or 260 contiguous aas of the sequence provided in SEQ ID NO:87.
[0074] A NBD aa sequence from human TAP1 may, for example, comprise substitutions corresponding to those at C662 (e.g., C662S) and C735 (e.g., C735S) of SEQ ID NO:8. The NBD aa sequence from human TAP1 may also, for example, comprise substitutions corresponding to those at one or more of N676, S677, Q680, E682, and Q683 (e.g., N676G, S677N, Q680R, E682Q, and/or Q683R) in SEQ ID NO:8, which are bolded and italicized in SEQ ID NO:88 below. In addition, the NBD aa sequence from human TAP1 may comprise a substitution at the aa corresponding to D668 of SEQ ID NO:8 (e.g., a D668N substitution), which renders the NBD ATP hydrolysis-deficient. Accordingly, a NBD polypeptide aa sequence of TAP1 may, for example, comprise the aa sequence of SEQ ID NO:88 or an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence:
TABLE-US-00004 (SEQIDNO:88) 1 METEFFQQNQTGGGGSGLQTVRSFGGGGGSGGSGLLTPLHLEGLVQFQDVSFAYPNRPDV 61 LVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLH 121 RQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDE 181 AGSQLSGGQRQAVALARALIRKPSVLILDNATSALDAGNQLRVQRLLYESPERYSRSVLL 241 ITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGSYWAMVQAPADAPE
Alternatively, the NBD aa sequence may have greater than 97% or greater than 98% sequence identity to at least 300 or 310 contiguous aas of the sequence provided in SEQ ID NO:88. The NBD provided in SEQ ID NO:88 comprises, in addition to TAP1 NBD sequences, the coupling helix 1 (CH1, aas 2-11) from TAP1 and coupling helix 2 (CH2, aas 17-25) from TAP2, and associated GS linkers (aas 12-16 and 25-30), which together constitute a cap on the sequence. TAP1 NBD constructs express at substantially higher levels in biological expression systems as shown in Example 3.
[0075] In some cases NBDs from TAP proteins that do not homodimerize, but rather heterodimerize with a cognate NBD, are used to prepare pairs of constructs (see, e.g.,
[0076]
TABLE-US-00005 (SEQIDNO:11) 1 MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLG 61 FVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLS 121 PPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDIL 181 GGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGF 241 FQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHM 301 PFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALE 361 QCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVG 421 SYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNR 481 PDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHC 541 YLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDV 601 GEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIA 661 HRLQTVQRAHQILVLQEGKLQKLAQL
A NBD may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to the human TAP2 aa sequence:
TABLE-US-00006 (SEQIDNO:12) GTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPG EVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQ YEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKV MAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLA IARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTV LVIAHRLQTVQRAHQILVLQEGKLQK.
The NBD may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:12.
[0077] A mutation removing the catalytic acidic aa residue corresponding to the D668N substitution of TAP1 rendering it ATP hydrolysis deficient may be incorporated into a TAP2 NBD aa sequence.
(2) CFTR ATP Binding Cassettes as NBDs
[0078] In some cases a NBD of a construct of the present disclosure may comprise an aa sequence from the NBD from human cystic fibrosis transmembrane conductance regulator (CFTR) or an aa sequence having greater than 90% or greater than 95% sequence identity to a human CFTR. For example, the NBD may comprise an aa sequence having greater than 90% or greater than 95% sequence identity to the NBD aa sequence of UniProtKB-P13569 (SEQ ID NO:13):
TABLE-US-00007 1 MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLS 51 EKLEREWDRELASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPL 101 LLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGM 151 QMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHF 201 VWIAPLQVALLMGLIWELLQASAFCGLGELIVLALFQAGLGRMMMKYRDQ 251 RAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAA 301 YVRYENSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAV 351 TRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAF 401 WEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIER 451 GQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPG 501 TIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSG 551 GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR 601 ILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSF 651 DQFSAERRNSILTETLHRESLEGDAPVSWTETKKQSFKQTGEFGEKRKNS 701 ILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILP 751 RISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQA 801 NLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESIPAVTTWNTYL 851 RYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRN 901 NSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHH 951 KMLHSVLQAPMSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLI 1001 VIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEGRSP 1051 IFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQ 1101 MRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMSTLQWAVNSS 1151 IDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKK 1201 DDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGK 1251 STLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTF 1301 RKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGH 1351 KQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILC 1401 EHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLF 1451 PHRNSSKCKSKPQIAALKEETEEEVQDTRL
[0079] A NBD may, for example, comprise an aa sequence having greater than 80% or greater than 85% sequence identity to the human CFTR aa sequence: VLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGK IKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAV YKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDF (SEQ ID NO:14). Alternatively, the NBD may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:14. The NBD may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:14.
[0080] A NBD may, for example, comprise an aa sequence having greater than 80% or greater than 85% sequence identity to the human CFTR aa sequence Ser-NBD1[387-646(D405-436)] described in Atwell et al., (2010), Protein Engineering, Design & Selection, 23(5) 375-384: SXTTTEVVMENVTAFWEEGGTPVLKDINFKIER GQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDI SKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL KKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMX (SEQ ID NO:15), where X at position 2 may be absent or L; and X at position 229 is absent or G. Alternatively, the NBD may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:15. The NBD may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:15. A NBD may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to aas 1-216 of SEQ ID NO:16, where X at position 2 may be absent or L.
2. Scaffolds
[0081] Scaffold aa sequences may be incorporated into the ATP-dependent agonists constructs described herein as a means of structural organization, to increase the half-life of the molecules in vivo, and, where capable of inducing ADCC, ADCP, and/or CDC, to act as a basis for those effector functions. The scaffolds may be capable of forming dimers and higher order complexes (e.g., trimers) or non-dimerizable (non-dimerizing) in which case they do not form dimers or higher order complexes. Scaffolds incorporated into the constructs described herein may, for example, comprise an immunoglobulin (Ig) aa sequence or non-immunoglobulin aa sequence.
[0082] In some embodiments, the scaffold polypeptide sequence comprises an immunoglobulin heavy chain constant region (CH2-CH3) polypeptide sequence that functions as a dimerization or multimerization sequence. Where the scaffold comprises an immunoglobulin (Ig) aa sequence, it may comprise an immunoglobulin heavy chain constant region (CH2-CH3) polypeptide aa sequence (e.g., an IgFc aa sequence). The scaffold aa sequence may, for example, comprise Ig CH2 and/or CH3 aa sequences modified to prevent dimerization. Any one or more cysteines involved in interchain disulfide bonds that stabilize an Ig heavy chain dimers may be substituted (e.g., with an alanine or serine) so that the Ig heavy chain sequence cannot homodimerize and form interchain disulfide bonds. A scaffold polypeptide may comprise the wild-type (wt) Homo sapiens IgG1 Fc polypeptide sequence of (SEQ ID NO:56): [0083] 1 DKTHTCPPCP APELLGGPSV FLFPPKPKDT LMISRTPEVT CVVVDVSHED PEVKFNWYVD [0084] 61 GVEVHNAKTK PREEQYNSTY RVVSVLTVLH QDWLNGKEYK CKVSNKALPA PIEKTISKAK [0085] 121 GQPREPQVYT LPPSREEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN YKTTPPVLDS [0086] 181 DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPGK; optionally modified to prevent dimerization. Alternatively, the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:56. The scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:56.
[0087] A scaffold polypeptide may comprise a Homo sapiens IgG1 Fc aa sequence of SEQ ID NO:57, which comprises a LALA substitution (L234A, L235A substitutions, appearing as bolded and italicized aas 14 and 15 respectively): [0088] 1 DKTHTCPPCP APEAAGGPSV FLFPPKPKDT LMISRTPEVT CVVVDVSHED PEVKFNWYVD [0089] 61 GVEVHNAKTK PREEQYNSTY RVVSVLTVLH QDWLNGKEYK CKVSNKALPA PIEKTISKAK [0090] 121 GQPREPQVYT LPPSRDELTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN YKTTPPVLDS [0091] 181 DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPG; optionally modified to prevent dimerization. Alternatively, the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:57. The scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:57
[0092] Non-dimerizing scaffolds may be prepared as human single chain Fc (scFc) dimers. See, e.g., Zhou et al., Biomaterials 117:24-31 (2017). Such scFc dimers may be based on IgG1 and have the sequence: [0093] 1 DKTHTCPPCP APELLGGPSV FLFPPKPKDT LMISRTPEVT CVVVDVSHED PEVKFNWYVD [0094] 61 GVEVHNAKTK PREEQYNSTY RVVSVLTVLH QDWLNGKEYK CKVSNKALPA PIEKTISKAK [0095] 121 GQPREPQVYT LPPSRDELTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN YKTTPPVLDS [0096] 181 DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LSLSPGGGGG SGGGGSGGGG [0097] 241 SGGGGSGGGG SGGGGSDKTH TCPPCPAPEL LGGPSVFLFP PKPKDTLMIS RTPEVTCVVV [0098] 301 DVSHEDPEVK FNWYVDGVEV HNAKTKPREE QYNSTYRVVS VLTVLHQDWL NGKEYKCKVS [0099] 361 NKALPAPIEK TISKAKGQPR EPQVYTLPPS RDELTKNQVS LTCLVKGFYP SDIAVEWESN [0100] 421 GQPENNYKTT PPVLDSDGSF FLYSKLTVDK SRWQQGNVFS CSVMHEALHN HYTQKSLSLS [0101] 481 PG (SEQ ID NO:102). Alternatively, the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:102. The scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:102. The scaffold construct of SEQ ID NO:102 is competent for the induction of ADCC, ADCP, and CDC, but substitutions including LALA discussed below may be introduced to selectively alter the ability of the scFc to induce those effector functions.
[0102] A scaffold polypeptide may comprise the wt Homo sapiens IgG2 Fc polypeptide of SEQ ID NO:58 (see GenBank AAN76044 amino acids 99-325): [0103] 1 STKGPSVFPL APCSRSTSES TAALGCLVKD YFPEPVTVSW NSGALTSGVH TFPAVLQSSG [0104] 61 LYSLSSVVTV PSSNFGTQTY TCNVDHKPSN TKVDKTVERK CCVECPPCPA PPVAGPSVFL [0105] 121 FPPKPKDTLM ISRTPEVTCV VVDVSHEDPE VQFNWYVDGV EVHNAKTKPR EEQFNSTFRV [0106] 181 VSVLTVVHQD WLNGKEYKCK VSNKGLPAPI EKTISKTKGQ PREPQVYTLP PSREEMTKNQ [0107] 241 VSLTCLVKGF YPSDIAVEWE SNGQPENNYK TTPPMLDSDG SFFLYSKLTV DKSRWQQGNV [0108] 301 FSCSVMHEAL HNHYTQKSLS LSPGK; optionally modified to prevent dimerization. Alternatively, the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:58. The scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:58.
[0109] A scaffold polypeptide may comprise the wt Homo sapiens IgG3 Fc polypeptide of SEQ ID NO:59 (see, e.g., GenBank AAW65947 amino acids 19-246): [0110] 1 HKPSNTKVDK RVELKTPLGD TTHTCPPCPA PELLGGPSVF LFPPKPKDTL MISRTPEVTC [0111] 61 VVVDVSHEDP EVKFNWYVDG VEVHNAKTKP REEQYNSTYR VVSVLTVLHQ DWLNGKEYKC [0112] 121 KVSNKALPAP IEKTISKAKG QPREPQVYTL PPSRDELTKN QVSLTCLVKG FYPSDIAVEW [0113] 181 ESNGQPENNY KTTPPVLDSD GSFFLYSKLT VDKSRWQQGN VFSCSVMHEA LHNHYTQKSL [0114] 241 SLSPGK; optionally modified to prevent dimerization. Alternatively, the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:59. The scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:59.
[0115] A scaffold polypeptide may comprise the wt Homo sapiens IgG4 Fc polypeptide of SEQ ID NO:60: [0116] 1 PPCPSCPAPE FLGGPSVFLF PPKPKDTLMI SRTPEVTCVV VDVSQEDPEV QFNWYVDGVE [0117] 61 VHNAKTKPRE EQFNSTYRVV SVLTVLHQDW LNGKEYKCKV SNKGLPSSIE KTISKAKGQP [0118] 121 REPQVYTLPP SQEEMTKNQV SLTCLVKGFY PSDIAVEWES NGQPENNYKT TPPVLDSDGS [0119] 181 FFLYSRLTVD KSRWQEGNVF SCSVMHEALH NHYTQKSLSL SPG; optionally modified to prevent dimerization. Alternatively, the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:60. The scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:60.
[0120] Interactions of the IgG class of antibodies that lead to, for example, ADCC and ADCP, occur by their Fc region engaging with members of the Fc family of receptors (FcRs). The human protein family is comprised of FcRI (CD64), FcRII (CD32, which includes isoforms FcRIIa, FcRIIb, and FcRIIc), and FcRIII (CD16, which includes isoforms FcRIIIa and FcRIIIb). See, e.g., Lazar et al. (2006) PNAS:103 (11), 4005-4010.
[0121] Among the variants that can enhance one or more antibody related effector functions (e.g., ADCC, ADCP, and/or CDC responses) are: the individual substitutions S239D and I332E; and the double and triple substitutions at S239D/I332E and S239D/I332E/A330L in human IgG1. Substitutions corresponding to S239D, I332E, and A330L in the human IgG1 Fc sequence (SEQ ID NO:56) are S19D, I112E, and A110L. In an embodiment, the substitutions are the double and triple mutants S239D/I332E or S239D/I332E/A330L. See Lazar et al., 2006.
[0122] Other substitutions that enhance one or more antibody related effector function in IgG1 antibodies include, but are not limited to: Ser298Ala/Glu333Ala/Lys334Ala; Ser239Asp/Ala330Leu/Ile332Glu; Ser239Asp/Ile332Glu; Gly236Ala/Ser239Asp/Ala330Leu/Ile332Glu; Gly236Ala; Ser239Asp/Ile332Glu/Gly236Ala; Leu234Tyr/Gly236Trp/Ser298Ala; Phe243Leu/Arg292Pro/Tyr300Leu/Val305Ile/Pro396Leu; Lys326Trp/Glu333Ser; Lys326Ala/Glu333Ser; Lys326Met/Glu333Ser; Cys221Asp/Asp222Cys; Ser267Glu/His268Phe/Ser324Thr; His268Phe/Ser324Thr; and Glu345Arg. See, Saunders KO (2019) Front. Immunol. 10:1296.doi: 10.3389/fimmu.2019.01296. The corresponding location in the IgG1 Fc sequence of SEQ ID NO:56 can be obtained by subtracting 220 from the indicated positions. In an embodiment at least ADCC is enhanced by the substitutions. In an embodiment at least ADCP is enhanced by the substitutions. In an embodiment at least CDC is enhanced by the substitutions. In an embodiment at least complement fixation is enhanced by the substitutions.
[0123] Variants that can substantially diminish one or more antibody related effector functions of IgG1 antibodies (e.g., ADCC, ADCP, and/or CDC responses) include, but are not limited to: Leu235Glu; Leu234Ala/Leu235Ala (LALA); Ser228Pro/Leu235Glu; Leu234Ala/Leu235Ala/Pro329Gly; Pro331Ser/Leu234Glu/Leu235Phe; Asp265Ala; Gly237Ala; Glu318Ala; Glu233Pro; and Gly236Arg/Leu328Arg. As indicated above, the corresponding location of those substitutions in the IgG1 Fc sequence provided as SEQ ID NO:56 can be obtained by subtracting 220 from the indicated positions. In an embodiment, the scaffold sequence comprises an IgG1 Fc sequence with a LALA substitution (see, e.g., SEQ ID NO:57). In an embodiment at least ADCC is substantially diminished by the substitutions. In an embodiment at least ADCP is substantially diminished by the substitutions. In an embodiment at least CDC is substantially diminished by the substitutions. In an embodiment at least complement fixation is substantially diminished by the substitutions. See, e.g., Saunders 2019 and citations therein. In an embodiment the IgG1 Fc substitutions may be S239D/1332E/A330L, which permit enhancement of ADCC without substantially altering the CDC function (see Lazar et al., 2006).
[0124] Other variants in IgG1, IgG2, and IgG4 antibody sequences that can substantially diminish one or more antibody related effector functions include, but are not limited to: His268Gln/Val309Leu/Ala330Ser/Pro331Ser (IgG2m4); Val234Ala/Gly237Ala/Pro238Ser/His268Ala/Val309Leu/Ala330Ser/Pro331Ser (IgG2); Leu234Ala/L235Ala/Gly237Ala/P238Ser/His268Ala/Ala330Ser/Pro331Ser (IgG1); and S228P/Phe234Ala/Leu235Ala (IgG4PAA). See, e.g., Saunders 2019 and citations therein.
[0125] Alternative non-dimerizing scaffold domains include, but are not limited to, XTENylation, PEGylation, Lipidation (see pubs.acs.org/doi/10.1021/acsmedchemlett.8b00226 on the world wide web www), Human Serum Albumin (HSA) fusions (see nature.com/articles/s42003-021-01790-2 on the www) and anti HSA binding domains, including but not limited to anti-HSA peptides (see pubs.acs.org/doi/10.1021/acs.molpharmaceut.2c00106 on the www), antibody and antibody fragments (e.g. ScFvs, FABs, etc) and VHH domains (see semanticscholar.org/paper/Serum-albumin%E2%80%90binding-VHHs-with-variable-pH-enable-Faassen-Ryan/d34256a0d39a0ab92db9195210fa0fc7430758b6 on the www).
3. Linkers
[0126] The constructs of the present disclosure optionally have linkers located between any two elements. The linkers can be located between any two of the NBD aa sequence, the scaffold aa sequence, and the AD. Linkers are typically comprised of aa sequences from 4 to 50 aas in length (e.g., from 4 to 25 aas or from 25 to 50 aas) and may be chosen for, among other things, their rigidity. Linkers are each selected independently.
[0127] In some instances, linkers are flexible aa sequences that are comprised of glycine, serine, and/or alanine residues. In other instances, linkers are aa sequences comprised of glycine and serine. For example, the sequence GGGS (SEQ ID NO:16) or the sequence GGGGS (SEQ ID NO:26) may appear or be repeat from 1-10 times in the linkers (GGGS).sub.1-10 (SEQ ID NOs:16-25) or (GGGGS).sub.1-10 (SEQ ID NOs:26-35). In some cases where linkers comprise a GGGS or GGGGS sequence, those sequences may appear from 1-5 or from 5-10 times.
[0128] Rigid linkers may be employed where it is desirable to maintain a substantially fixed distance or spatial separation between the domains to reduce or substantially eliminate unfavorable interactions between domains of the constructs (e.g., between NBDs in the same construct). For example, a pair of NBDs present in a single molecule may kept from self-associating through the use of rigid linkers. Exemplary rigid peptide or polypeptide linkers include linkers comprising the sequence X(EAAAK)n X, where EAAAK may appear in the linker from 1-20 times (i.e., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 times, SEQ ID NOs:36-55) and where X is absent or alanine. In some cases where linkers comprise the X(EAAAK)n X sequence, n may be from 1-5 or from 5-10. In some cases where linkers comprise the X(EAAAK)n X sequence, n may be from 11-15 or from 16-20. Alternatively, rigid peptide linkers may comprise repeats of (Lys-Pro), (Glu-Pro), (Thr-Pro-Arg), and (Ala-Pro) having a length of 4 to 40 (e.g., 4-20 or 20-40 amino acids). Other rigid linkers include linkers comprising repeats of the dipeptide sequence KP or EP from 2 to 10 or 10 to 20 times.
4. Immune Cell Engaging Domains
[0129] Immune cell engaging domains (also referred to as an immune cell engager, ICE or ICEs when plural) are domains of the NBD-containing constructs that can bind to immune cell surface molecules. Immune cell engagers are typically antibody-related molecules/aa sequences (e.g., an antigen binding fragment of an antibody, Fab, Fab, single chain antibody, scFv, peptide aptamer, or nanobody). Unless stated otherwise, immune cell engagers are understood to be monovalent to prevent individual molecules from crosslinking the cellular target (e.g., immune cell surface antigen) and off target stimulation of the immune cell. Individual immune cell engagers are generally incapable of acting as an agonist and stimulating the immune cells to which they bind; however, when multiple constructs bearing an immune cell engager are localized in a complex (see, e.g.,
[0130] Immune cell engagers may be directed to a number of different immune cells that appear or may be recruited into the TME. Such immune cells and the targets of their corresponding immune cell engagers include those set forth in Table 1.
TABLE-US-00008 TABLE 1 Some Immune cells and their corresponding immune cell engager Immune cell engager target/immune cell engager (e.g., antibody or antibody- Immune cell related molecules directed against target) CD4+ T cell CD3/ anti-CD3 or anti-CD3; TCR/ anti-TCR chain or anti-TCR chain; CD4/anti-CD4 CD4+ T regs CD25; CD8+ T cell CD3/ anti-CD3 or anti-CD3; TCR/ anti-TCR chain or anti-TCR chain CD8/anti-CD8 T cell TCR/ anti-TCR chain or anti-TCR chain (e.g., TRGV9/ anti-TRGV9 NK Cell CD16/ anti-CD16 MDSC (myeloid derived CD84/anti-CD84; CXCR1/anti-CXCR1; DR5/anti-DR5; CD13/ anti-CD13; suppressor cells) CD33/anti-CD33; CD34/anti-CD34; CD16/ anti-CD16 Antibody related molecules include, but are not limited to, antigen binding fragments of an antibody, Fabs, Fab's, and polypeptides comprising single chain antibody, scFv, peptide aptamer, or nanobody aa sequences.
[0131] When immune cell engagers such as those listed in Table 1 are incorporated into a first NBD-containing polypeptide construct that can pair or complex with a second NBD-containing construct comprising a tumor-specific binder directed against a TAA, then trans-targeting of tumor cells leading to their cytolysis may be observed (see, e.g.,
[0132] An immune cell engager polypeptide may be a scFv, anti-human CD3 based upon the UCHT-1 monoclonal antibody having the sequence: AIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNWYQQKPGKA PKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKVEIKGGGGSG GGGSGGGGSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALIN PYKGVTTYADSVKGRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTVSS (SEQ ID NO:61). The immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:61. In addition the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:61.
[0133] An immune cell engager polypeptide may be a scFv, anti-human CD3 based upon the UCHT-1 monoclonal antibody having the sequence: AIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNWYQQKPGKA PKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPWTFGQGTKVEIKGGGGSG GGGSGGGGSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALIN PYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTVSS (SEQ ID NO:62). The immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:62. In addition the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:62.
[0134] An immune cell engager polypeptide may be an anti-human CD3 VHH having the sequence: QVQLVESGGGLVQPGGSLRLSCAASGSIFSANTMGWYRQAPGKQRELVAGMNTSGSTVYGDSVKGRFTIS RDNAKNIAYLQMNSLIPEDTAVYYCTLVQRGPNYWGQGTQVTVSS (SEQ ID NO:63). The immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:63. In addition the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:63.
[0135] An immune cell engager polypeptide may be an anti-human CD3 scFv (vH-vL) based upon the L2K antibody having the sequence: DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWVRQAPGQGLEWIGY INPSRGYTNYADSVKGRFTITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCLDYWGQGTTVTVSSG GGGSGGGGSGGGGSDIVLTQSPATLSLSPGERATLSCRASQSVSYMNWYQQKPGKAPKRWIYDTSKVASG VPARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSSNPLTFGGGTKVEIK (SEQ ID NO:64). The immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:64. In addition the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:64.
[0136] An immune cell engager polypeptide may be an anti-human CD3 scFv (vH-vL) based upon the L2K antibody having the sequence set forth in SEQ ID NO:65, which includes a disulfide bond between the cysteine substitutions at Q43C and G99C (G233C as shown): DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWV RQAPGCGLEWIGYINPSRGYTNYADSVKGRFTITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCLD YWGQGTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPATLSLSPGERATLSCRASQSVSYMNWYQQKPGKAP KRWIYDTSKVASGVPARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSSNPLTFGCGTKVEIK (SEQ ID NO:65). The immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:65. In addition the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:65.
[0137] An immune cell engager polypeptide may be an anti-human CD3 scFv (vH-vL) based upon the L2K antibody having the sequence set forth in SEQ ID NO:66, which includes a disulfide bond between the cysteine substitutions at Q43C and G100C (G234C as shown): DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHW VRQAPGCGLEWIGYINPSRGYTNYADSVKGRFTITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCL DYWGQGTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPATLSLSPGERATLSCRASQSVSYMNWYQQKPGKA PKRWIYDTSKVASGVPARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSSNPLTFGGCTKVEIK (SEQ ID NO:66). The immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:66. In addition the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:66.
[0138] An immune cell engager polypeptide may be an anti-human CD3 scFv (vH-vL) based upon the L2K antibody having the sequence set forth in SEQ ID NO:67, which includes a disulfide bond between the cysteine substitutions at G44C and :G99C (G233C as shown): DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWV RQAPGQCLEWIGYINPSRGYTNYADSVKGRFTITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCLD YWGQGTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPATLSLSPGERATLSCRASQSVSYMNWYQQKPGKAP KRWIYDTSKVASGVPARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSSNPLTFGCGTKVEIK (SEQ ID NO:67). The immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:67. In addition the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:67.
[0139] An immune cell engager polypeptide may be an anti-human CD3 scFv (vH-vL) based upon the L2K antibody having the sequence set forth in SEQ ID NO:68, which includes a disulfide bond between the cysteine substitutions at G44C and G100C (G234C as shown): [0140] 1 DVQLVQSGAE VKKPGASVKV SCKASGYTFT RYTMHWVRQA PGQCLEWIGY INPSRGYTNY [0141] 61 ADSVKGRFTI TTDKSTSTAY MELSSLRSED TATYYCARYY DDHYCLDYWG QGTTVTVSSG [0142] 121 GGGSGGGGSG GGGSDIVLTQ SPATLSLSPG ERATLSCRAS QSVSYMNWYQ QKPGKAPKRW [0143] 181 IYDTSKVASG VPARFSGSGS GTDYSLTINS LEAEDAATYY CQQWSSNPLT FGGCTKVEIK (SEQ ID NO:68). The immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:68. In addition the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:68.
[0144] The GGGS (SEQ ID NO:16) and/or GGGGS (SEQ ID NO:26) containing repeats in SEQ ID NOs:61-62 and 64-68, are linker sequences between domains.
5. Immune Cell Activating Domains (Activating Domains)
[0145] Activating Domains (ADs or AD when singular) that can be incorporated into constructs of the present disclosure include a variety of molecules or fragments of molecules (e.g., fragments of cytokines) that are capable of stimulating anti-tumor cell immune responses when presented as dimers or higher order complexes, but that have a limited ability to stimulate immune cells when presented singly. Some immune cell agonists that require receptor crosslinking for maximal activity include, but are not limited to, CD40L, CD28, IFN-g, and IL-12. Anti-tumor cell immune responses may result, for example, from the stimulation of NK cells or T cells (e.g., CD8+ T cells) by constructs comprising ADs, and may include granule dependent and granule independent responses.
[0146] ADs may comprise, for example, aa sequences of TNF superfamily members such as TNF, lymphotoxin , lymphotoxin , and BAFF (CD25). ADs may also comprise, for example, aa sequences of B7 superfamily members, such as CD80 and CD86. An AD may also comprise, for example, the aa sequence of all or part of IL-15, IL-12, IL-2, or IL-7 (e.g., all or part of the extracellular domain). An AD may comprise, for example, all or part of the aa sequence of IL-12 (e.g., one or both subunits of human IL-12).
[0147] By way of example some ADs that may be employed in constructs that homodimerize (see, e.g.,
[0148] In addition to the foregoing, nucleic acids, including nucleic acids with CpG repeats or one or more IMT504 sequences, may be used as ADs and may be incorporated into homodimerizing or heterodimerizing NBD-containing constructs.
[0149] An AD may comprise, for example, the CD80 polypeptide aa sequence: [0150] 1 VIHVTKEVKE VATLSCGHNV SVEELAQTRI YWQKEKKMVL TMMSGDMNIW PEYKNRTIFD [0151] 61 ITNNLSIVIL ALRPSDEGTY ECVVLKYEKD AFKREHLAEV TLSVKADFPT PSISDFEIPT [0152] 121 SNIRRIICST SGGFPEPHLS WLENGEELNA INTTVSQDPE TELYAVSSKL DFNMTTNHSF [0153] 181 MCLIKYGHLR VNQTFNWNTT K (SEQ ID NO:99). Alternatively, an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NO:99. An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 170 or 180 contiguous aas of SEQ ID NO:99.
[0154] An AD may comprise, for example, the CD86 polypeptide aa sequence comprising the CD86 (IgV-IgC domain):
TABLE-US-00009 (SEQIDNO:100) 1 LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMNR 61 TSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPIS 121 NITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSV 181 SFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP,;
or the CD86 IgV domain:
TABLE-US-00010 (SEQIDNO:101) 1 LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGR 61 TSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLA,.
Alternatively, an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NOs:100 or 101. An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 100 or 110 contiguous aas of SEQ ID NOs:100 or 101.
[0155] An AD may comprise, for example, an aa sequence that binds the IL-12 as an agonist (e.g., IL-12 or an anti-CD28 scFv or nanobody aa sequence). An AD may comprise, for example, a single chain IL-12 that comprises the sequence: [0156] 1 IWELKKDVYV VELDWYPDAP GEMVVLTCDT PEEDGITWTL DQSSEVLGSG KTLTIQVKEF [0157] 61 GDAGQYTCHK GGEVLSHSLL LLHKKEDGIW STDILKDQKE PKNKTFLRCE AKNYSGRFTC [0158] 121 WWLTTISTDL TFSVKSSRGS SDPQGVTCGA ATLSAERVRG DNKEYEYSVE CQEDSACPAA [0159] 181 EESLPIEVMV DAVHKLKYEN YTSSFFIRDI IKPDPPKNLQ LKPLKNSRQV EVSWEYPDTW [0160] 241 STPHSYFSLT FCVQVQGKSK REKKDRVFTD KTSATVICRK NASISVRAQD RYYSSSWSEW [0161] 301 ASVPCSGGGG SGGGGSGGGG SRNLPVATPD PGMFPCLHHS QNLLRAVSNM LQKARQTLEF [0162] 361 YPCTSEEIDH EDITKDKTST VEACLPLELT KNESCLNSRE TSFITNGSCL ASRKTSFMMA [0163] 421 LCLSSIYEDL KMYQVEFKTM NAKLLMDPKR QIFLDQNMLA VIDELMQALN FNSETVPQKS [0164] 481 SLEEPDFYKT KIKLCILLHA FRIRAVTIDR VMSYLNAS (SEQ ID NO:90), which comprises a fragment of the p40 subunit, a linker repeat of GGGGS, and a fragment of the P35 subunit. Alternatively, an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NO:90. An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 480 or 500 contiguous aas of SEQ ID NO:90.
[0165] As discussed above, the constructs of the present disclosure may comprise NBDs that heterodimerize in the presence of ATP. Accordingly, a complex between a first construct and a second construct that comprise heterodimerizing NBDs can be used to assemble an AD see, e.g.,
[0175] 061 EACLPLELTK NESCLNSRET SFITNGSCLA SRKTSFMMAL CLSSIYEDLK MYQVEFKTMN [0176] 121 AKLLMDPKRQ IFLDQNMLAV IDELMQALNF NSETVPQKSS LEEPDFYKTK IKLCILLHAF [0177] 181 RIRAVTIDRV MSYLNAS (SEQ ID NO:92), or a sequence having at least 90% or at least 95% sequence identity with SEQ ID NO:92.
[0178] An AD may comprise, for example, all or part of an aa sequence that binds to PD1 (e.g., an anti-PD1 scFv or nanobody aa sequence) or an aa sequence that binds to PDL1 (e.g., an anti-PDL1 scFv or nanobody aa sequence).
[0179] An AD may comprise, for example, an aa sequence that binds to CD40 (e.g., an anti-CD40 scFv or nanobody aa sequence or a CD40L aa sequence) or an aa sequence that binds to CD40L (e.g., an anti-CD40L scFv or nanobody aa sequence, or a CD40 aa sequence). A polypeptide that may be employed as an AD may comprise the CD40L aa sequence: [0180] 1 GDQNPQIAAH VISEASSKTT SVLQWAEKGY YTMSNNLVTL ENGKQLTVKR QGLYYIYAQV [0181] 61 TFCSNREASS QAPFIASLCL KSPGRFERIL LRAANTHSSA KPCGQQSIHL GGVFELQPGA [0182] 121 SVFVNVTDPS QVSHGTGFTS FGLLKL (SEQ ID NO:96), or an aa sequence having at least 90% or at least 95% sequence identity to SEQ ID NO:96. Alternatively, a polypeptide that may be employed as an AD comprises a trimer of CD40L aa sequences separated by linker sequences (e.g., linker sequences comprising GGGGS repeats): [0183] 1 GDQNPQIAAH VISEASSKTT SVLQWAEKGY YTMSNNLVTL ENGKQLTVKR QGLYYIYAQV [0184] 61 TFCSNREASS QAPFIASLCL KSPGRFERIL LRAANTHSSA KPCGQQSIHL GGVFELQPGA [0185] 121 SVFVNVTDPS QVSHGTGFTS FGLLKLGGGG SGGGGSGGGG SGDQNPQIAA HVISEASSKT [0186] 181 TSVLQWAEKG YYTMSNNLVT LENGKQLTUK RQGLYYIYAQ VTFCSNREAS SQAPFIASLC [0187] 241 LKSPGRFERI LLRAANTHSS AKPCGQQSIH LGGVFELQPG ASVFVNVTDP SQVSHGTGFT [0188] 301 SFGLLKLGGG GSGGGGSGGG GSGDQNPQIA AHVISEASSK TTSVLQWAEK GYYTMSNNLV [0189] 361 TLENGKQLTV KRQGLYYIYA QVTFCSNREA SSQAPFIASL CLKSPGRFER ILLRAANTHS [0190] 421 SAKPCGQQSI HLGGVFELQP GASVFVNVTD PSQVSHGTGF TSFGLLKL (SEQ ID NO:95), or an aa sequence having at least 90% or at least 95% sequence identity to SEQ ID NO:95.
[0191] An AD may comprise, for example, an aa sequence that binds to CD137/4-1BB (e.g., an anti-CD137 scFv or nanobody aa sequence, or a CD137L/4-1BBL aa sequence), or an aa sequence that binds to TGF (e.g., an anti-TGF scFv or nanobody aa sequence, or a TGFBRII aa sequence). A polypeptide that may be employed as an AD may comprise the 4-1BBL aa sequence: [0192] 1 ACPWAVSGAR ASPGSAASPR LREGPELSPD DPAGLLDLRQ GMFAQLVAQN VLLIDGPLSW [0193] 61 YSDPGLAGVS LTGGLSYKED TKELVVAKAG VYYVFFQLEL RRVVAGEGSG SVSLALHLQP [0194] 121 LRSAAGAAAL ALTVDLPPAS SEARNSAFGF QGRLLHLSAG QRLGVHLHTE ARARHAWQLT [0195] 181 QGATVLGLFR VTPEIPAGLP SPRSE (SEQ ID NO:94), or an aa sequence having at least 90% or at least 95% sequence identity to SEQ ID NO:94. Alternatively, a polypeptide that may be employed as an AD comprises a trimer of 4-1BBL aa sequences separated by linker sequences (e.g., linker sequences comprising GGGGS repeats): [0196] 1 ACPWAVSGAR ASPGSAASPR LREGPELSPD DPAGLLDLRQ GMFAQLVAQN VLLIDGPLSW [0197] 61 YSDPGLAGVS LTGGLSYKED TKELVVAKAG VYYVFFQLEL RRVVAGEGSG SVSLALHLQP [0198] 121 LRSAAGAAAL ALTVDLPPAS SEARNSAFGF QGRLLHLSAG QRLGVHLHTE ARARHAWQLT [0199] 181 QGATVLGLFR VTPEIPAGLP SPRSEGGGGS GGGGSGGGGS ACPWAVSGAR ASPGSAASPR [0200] 241 LREGPELSPD DPAGLLDLRQ GMFAQLVAQN VLLIDGPLSW YSDPGLAGVS LTGGLSYKED [0201] 301 TKELVVAKAG VYYVFFQLEL RRVVAGEGSG SVSLALHLQP LRSAAGAAAL ALTVDLPPAS [0202] 361 SEARNSAFGF QGRLLHLSAG QRLGVHLHTE ARARHAWQLT QGATVLGLFR VTPEIPAGLP [0203] 421 SPRSEGGGGS GGGGSGGGGS ACPWAVSGAR ASPGSAASPR LREGPELSPD DPAGLLDLRQ [0204] 481 GMFAQLVAQN VLLIDGPLSW YSDPGLAGVS LTGGLSYKED TKELVVAKAG VYYVFFQLEL [0205] 541 RRVVAGEGSG SVSLALHLQP LRSAAGAAAL ALTVDLPPAS SEARNSAFGF QGRLLHLSAG [0206] 601 QRLGVHLHTE ARARHAWQLT QGATVLGLFR VTPEIPAGL PSPRSE (SEQ ID NO:93), or an aa sequence having at least 90% or at least 95% sequence identity to SEQ ID NO:93.
[0207] An AD may comprise, for example, an aa sequence that binds to IL-10 (e.g., an anti-IL-10 scFv or nanobody aa sequence) or an aa sequence that binds to IL-10R (e.g., an anti-IL-10R scFv or nanobody aa sequence).
[0208] An AD may comprise, for example, an aa sequence that binds to CD3 (e.g., an anti-CD3 scFv or nanobody aa sequence).
[0209] An AD may comprise, for example, an aa sequence that binds to CTLA-4 (e.g., an anti-CTLA-4 scFv or nanobody aa sequence).
[0210] An AD may comprise, for example, an aa sequence that binds to CD28 (e.g., an anti-CD28 scFv or nanobody aa sequence). An anti-CD28 scFv that may be used as an AD may comprise the sequence: [0211] 1 DIELTQSPAS LAVSLGQRAT ISCRASESVE YYVTSLMQWY QQKPGQPPKL LIFAASNVES [0212] 61 GVPARFSGSG SGTNFSLNIH PVDEDDVAMY FCQQSRKVPY TFGGGTKLEI KRGGGGSGGG [0213] 121 GSGGGGSQVK LQQSGPGLVT PSQSLSITCT VSGFSLSDYG VHWVRQSPGQ GLEWLGVIWA [0214] 181 GGGTNYNSAL MSRKSISKDN SKSQVFLKMN SLQADDTAVY YCARDKGYSY YYSMDYWGQG [0215] 241 TTVTVSS (SEQ ID NO:89). Alternatively, an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NO:89. An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 220 or 230 contiguous aas of SEQ ID NO:89.
[0216] An AD may comprise, for example, an interferon- (IFN-) polypeptide sequence, or an aa sequence that binds to the IFN- receptor (e.g., an anti-IFN- receptor scFv or nanobody aa sequence). A scIFN- polypeptide that may be employed as an IFN- AD may comprise the sequence: [0217] 1 MQDPYVKEAE NLKKYFNAGH SDVADNGTLF LGILKNWKEE SDRKIMQSQI VSFYFKLFKN [0218] 61 FKDDQSIQKS VETIKEDMNV KFFNSNKKKR DDFEKLTNYS VTDLNVQRKA IDELIQVMAE [0219] 121 FSTEEQQEGP YVKEAENLKK YFNAGHSDVA DNGTLFLGIL KNWKEESDRK IMQSQIVSFY [0220] 181 FKLFKNFKDD QSIQKSVETI KEDMNVKFFN SNKKKRDDFE KLTNYSVTDL NVQRKAIHEL [0221] 241 IQVMAELSPA AKTGKRKRSQ MLFRG (SEQ ID NO:97). Alternatively, an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NO:97. An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 220 or 230 contiguous aas of SEQ ID NO:97.
[0222] An AD may comprise, for example, an aa sequence that binds to CD16 (e.g., an anti-CD16 scFv or nanobody aa sequence). Anti-CD16 VHH polypeptides that may be employed as an AD may comprise one of: [0223] 1 EVQLVESGGG LVQPGESLTL SCVVAGSIFS FAMSWYRQAP GKERELVARI GSDDRVTYAD [0224] 61 SVKGRFTISR DNIKRTAGLQ MNSLKPEDTA VYYCNAQTDL RDWTVREYWG QGTQVTVSS (SEQ ID NO:98); or [0225] 1 EVQLVESGGE LVQPGGSLRL SCAASGLTFS SYNMGWFRRA PGKEREFVAS ITWSGRDTFY [0226] 61 ADSVKGRFTI SRDNAKNTVY LQMSSLKPED TAVYYCAANP WPVAAPRSGT YWGQGTQVTV [0227] 121 SS (SEQ ID NO:103). Alternatively, an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NOs:98 or 103. An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 100 or 110 contiguous aas of SEQ ID NOs:98 or 103.
[0228] ADs do not have to be comprised of an aa sequence, and may, for example, be comprised of nucleic acid sequences. Non-limiting examples of nucleic acid ADs include nucleic acid sequences with CpG repeats (e.g., a CpG oligodeoxynucleotide sequence) or IMT504 (TCATCATTTTGTCATTTTGTCATT (SEQ ID NO:69, see, e.g., Insula et al., 2007 Stem Cells, 25:1047-1054) optionally having 1, 2 or 3 nucleotide substitutions, deletions, or insertions.
6. Tumor-Specific Binding Domains
[0229] A tumor-specific binding domain of the constructs described herein (also referred to as tumor-specific binder, or TSB) is a polypeptide aa sequence that functions as a targeting sequence directing the construct to tumor cells by binding to target molecules expressed on the tumor cell surface. The target molecules may be a tumor-associated antigen (TAA) (also referred to herein as a cancer associated antigen or CAA) whose cell surface expression is restricted, or substantially restricted, to one or more cancer cell types. In addition to molecules whose expression is restricted or substantially restricted to tumor cells, other molecules present on a tumor cell's surface may be targeted including, but not limited to, cell proteins expressed on normal (non-transformed) cells, which may be upregulated in the tumor cell. Checkpoint proteins (e.g., V-domain Ig suppressor of T cell activation or VISTA, T-cell immunoglobulin and mucin domain 3 or Tim-3, and Programmed Death Ligand 1 or PD-L1), which are expressed on normal and many tumor cells (e.g., transformed tumor cells), may also serve as target molecules for TSBs. Targeting checkpoint proteins, which are often upregulated by tumor cells as a means of immune evasion or escape, both offers a target that may be abundantly expressed on the tumor cell's surface and provides checkpoint inhibition by the TSB. Proteins not substantially restricted to expression on transformed tumor cells are considered as targets of TSBs when expressed on tumor cells. They are considered targets of TSBs because any immune response directed by the TSB is limited to the TME where ATP levels are sufficiently high to permit pairing or complexation of the TSB to an AD or immune cell engager and through the NBDs coupled to those elements (see, e.g.,
[0230] Some TAAs associated with a solid tumor that may be targeted by TSBs include, but are not limited to: carbonic anhydrase IX (CAIX), cadherins, carcinoembryonic antigen (CEA), cellular-mesenchymal epithelial transition factor (c-MET), Cytotoxic T-Lymphocyte Associated Protein 4 (CTLA-4), Epidermal Growth Factor Receptor (EGFR) family members, Epithelial Cell Adhesion Molecule (EpCAM), Ephrin Type-A Receptor 3 (EphA3), Fibroblast Activation Protein Alpha (FAP), folate-binding protein, Folate Receptor alpha (FR-alpha), Erb-B2 Receptor Tyrosine Kinase 2 (HER2), Erb-B2 Receptor Tyrosine Kinase 3 (HER3), Insulin Like Growth Factor 1 Receptor (IGF-1R), integrin V3, integrin 51, Solute Carrier Family 39 Member 6 (Liv1), a Melanoma-Associated Antigen family A member (MAGEA), a Melanoma-Associated Antigen family C member (MAGEC), mesothelin, a mucin (e.g., MUC1), a New York Esophageal Squamous Cell Carcinoma 1 protein (NY-ESO-1, Cancer/Testis Antigen 1A, Cancer/Testis Antigen 1B), Cancer/Testis Antigen 2 (NY-ESO-2, CTAG2), Prostate-Specific Membrane Antigen (PSMA), Receptor Activator of Nuclear Factor Kappa B Ligand (RANKL), Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1), tenascin, TNF Receptor Superfamily Member 10a (TRAILR1), TNF Receptor Superfamily Member 10b (TRAILR2), and Vascular Endothelial Growth Factor Receptor (VEGFR).
[0231] Some TAAs associated with a solid tumor that may be targeted by TSBs include, but are not limited to: Cancer/Testis Antigen 1A, Cancer/Testis Antigen 1B, or Cancer/Testis Antigen 2 (NY-ESO-2, CTAG2),
[0232] Some TAAs associated with a solid tumor that may be targeted by TSBs include, but are not limited to: MAGEA-1, MAGEA-4, or MAGEA-9.
[0233] Some TAAs associated with a solid tumor that may be targeted by TSBs include, but are not limited to: MAGEC-1, MAGEC-2, or MAGEC-3.
[0234] Some checkpoint proteins that may serve as targets of TSBs include, but are not limited to, VISTA, TIM-3, PD-L1, CTLA-4, and LAG-3.
[0235] A TSB polypeptide may be an anti-human mesothelin scFv polypeptide related to the murine-derived SS1 antibody, also employed in Amatuximab having the sequence: QVQLQQSGPELEKPGASVKISCKASGYSFTGY TMNWVKQSHGKSLEWIGLITPYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVYFCARGGYD GRGFDYWGSGTPVTVSSGXGGSGGGGSGGGGSDIELTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQK SGTSPKRWIYDTSKLASGVPGRFSGSGSGNSYSLTISSVEAEDDATYYCQQWSKHPLTFGSGTKVEIK, where X is V or G (SEQ ID NO:70). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0236] A TSB polypeptide may comprise an anti-human mesothelin scFv (vH-vL) polypeptide related to the monoclonal antibody YP218, having the sequence: QEQLVESGGGLVQPGASLTLTCTASGIDFSRYYMCWVRQ APGKGLEGIACIYIGGSGSTYYASWAKGRFTISKASSTTVTLQMTSLTAADTATYFCARGTNLNYIFRLW GPGTLVTVSSGXGGSGGGGSGGGGSDVVMTQTPASVSEPVGGTVTIKCQASQRISSYLSWYQQKPGQRPK LLIFGASTLASGVPSRFKGSGSGTEYTLTISDLECADAATYYCQSYAYFDSNNWHAFGGGTEVVV, where X is V or G (SEQ ID NO:71). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0237] A TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody YP218, having the sequence: DVVMTQTPASVSEPVGGTVTIKCQASQRISSYLSWYQQK PGQRPKLLIFGASTLASGVPSRFKGSGSGTEYTLTISDLECADAATYYCQSYAYFDSNNWHAFGGGTEVV VGXGGSGGGGSGGGGSQEQLVESGGGLVQPGASLTLTCTASGIDFSRYYMCWVRQAPGKGLEGIACIYIG GSGSTYYASWAKGRFTISKASSTTVTLQMTSLTAADTATYFCARGTNLNYIFRLWGPGTLVTVSS, where X is V or G (SEQ ID NO:72). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0238] A TSB polypeptide may comprise an anti-human mesothelin scFv (vH-vL) polypeptide related to the monoclonal antibody 15B6, having the sequence: EVQLQQSGPVLVKPGASVKISCKASGYSFTGYYMHWVRQS NGKSLEWIGRINPYTGVPSYKHNFKDKASLTVDKSSSTAYMELHSLTSEDSAVYYCARELGGYWGQGTTL TVSSGXGGSGGGGSGGGGSQAVVTQESALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGLIA GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWFSSHWVFGGGTKLTVLG, where X is V or G (SEQ ID NO:73). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0239] A TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody 15B6, having the sequence: PDHLFTGLIAGTNNRAPGVPARFSGSLIGDKAALTITGAQ TEDEAIYFCALWFSSHWVFGGGTKLTVLGGXGGSGGGGSGGGGSEVQLQQSGPVLVKPGASVKISCKASG YSFTGYYMHWVRQSNGKSLEWIGRINPYTGVPSYKHNFKDKASLTVDKSSSTAYMELHSLTSEDSAVYYC ARELGGYWGQGTTLTVSS, where X is V or G (SEQ ID NO:74). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0240] A TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody 15B6 with a disulfide linkage between the vL and vH positions G102C and K43C (K 168C as shown), having the sequence: QAVVTQESALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGLIA GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWFSSHWVFGCGTKLTVLGGGGGSGGGGSG GGGSEVQLQQSGPVLVKPGASVKISCKASGYSFTGYYMHWVRQSNGCSLEWIGRINPYTGVPSYKHNFKD KASLTVDKSSSTAYMELHSLTSEDSAVYYCARELGGYWGQGTTLTVSS (SEQ ID NO:75). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0241] A TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody 15B6 with a disulfide linkage between the vL and vH positions G102C and S44C (S169C as shown), having the sequence: QAVVTQESALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGLIA GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWFSSHWVFGCGTKLTVLGGGGGSGGGGSG GGGSEVQLQQSGPVLVKPGASVKISCKASGYSFTGYYMHWVRQSNGKCLEWIGRINPYTGVPSYKHNFKD KASLTVDKSSSTAYMELHSLTSEDSAVYYCARELGGYWGQGTTLTVSS (SEQ ID NO:76). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0242] A TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody 15B6 with a disulfide linkage between the vL and vH positions G103C and K43C (K168C as shown), having the sequence: QAVVTQESALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGLIA GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWFSSHWVFGGCTKLTVLGGGGGSGGGGSG GGGSEVQLQQSGPVLVKPGASVKISCKASGYSFTGYYMHWVRQSNGCSLEWIGRINPYTGVPSYKHNFKD KASLTVDKSSSTAYMELHSLTSEDSAVYYCARELGGYWGQGTTLTVSS (SEQ ID NO:77). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0243] A TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody 15B6 with a disulfide linkage between the vL and vH positions G103C and S44C (S169C as shown), having the sequence: QAVVTQESALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGLIA GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWFSSHWVFGGCTKLTVLGGGGGSGGGGSG GGGSEVQLQQSGPVLVKPGASVKISCKASGYSFTGYYMHWVRQSNGKCLEWIGRINPYTGVPSYKHNFKD KASLTVDKSSSTAYMELHSLTSEDSAVYYCARELGGYWGQGTTLTVSS (SEQ ID NO:78). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0244] A TSB binder polypeptide may comprise an anti-human mesothelin (VHH) polypeptide related to the monoclonal antibody SD1, having the sequence: QVQLVQSGGGLVQPGGSLRLSCAASDFDFAAYEMSWVRQA PGQGLEWVAIISHDGIDKYYTDSVKGRFTISRDNSKNTLYLQMNTLRAEDTATYYCLRLGAVGQGTLVTV SSS (SEQ ID NO:79). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0245] A TSB polypeptide may comprise an anti-human EpCAM scFv (vH-vL) polypeptide related to the monoclonal antibody MT201 and Adecatumumab, having the sequence: EVQLLESGGGVVQPGRSLRLSCAASG FTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC AKDMGWGSGWRPYYYYGMDVWGQGTTVTVSSGXGGSGGGGSGGGGSELQMTQSPSSLSASVGDRVTITCR TSQSISSYLNWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYDI PYTFGQGTKLEIKRTV, where X is V or G (SEQ ID NO:80). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0246] A TSB polypeptide may comprise an anti-human EpCAM scFv (vL-vH) polypeptide related to the monoclonal antibody MT201 and Adecatumumab, having the sequence: ELQMTQSPSSLSASVGDRVTITCRTS QSISSYLNWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYDIPY TFGQGTKLEIKRTVGXGGSGGGGSGGGGSEVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAP GKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDMGWGSGWRPYYY YGMDVWGQGTTVTVSS, where X is V or G (SEQ ID NO:81). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0247] A TSB polypeptide may comprise an anti-human CTLA-4 scFv (vL-vH) polypeptide related to Ipilimumab, having the sequence: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRAT GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRGGGGSGGGGSGGGGSQVQ LVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRD NSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSS (SEQ ID NO:82). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0248] A TSB polypeptide may comprise an anti-human CTLA-4 scFv (vL-vH) polypeptide related to Ipilimumab with a disulfide linkage between the vL and vH positions Q101C and K43C (K 167C as shown), having the sequence: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRESGSGSGT DFTLTISRLEPEDFAVYYCQQYGSSPWTFGCGTKVEIKRGGGGSGGGGSGGGGSQVQLVESGGGVVQPGR SLRLSCAASGFTFSSYTMHWVRQAPGCGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAIYYCARTGWLGPFDYWGQGTLVTVSS (SEQ ID NO:83). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0249] A TSB polypeptide may comprise an anti-human CTLA-4 scFv (vL-vH) polypeptide related to Ipilimumab with a disulfide linkage between the vL and vH positions Q101C and G44C (G167C as shown), having the sequence: IVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIEPDRFSGSGSGT DFTLTISRLEPEDFAVYYCQQYGSSPWTFGCGTKVEIKRGGGGSGGGGSGGGGSQVQLVESGGGVVQPGR SLRLSCAASGFTFSSYTMHWVRQAPGKCLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAIYYCARTGWLGPFDYWGQGTLVTVSS (SEQ ID NO:84). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0250] A TSB polypeptide may comprise an anti-human CTLA-4 scFv (vL-vH) polypeptide related to Ipilimumab with a disulfide linkage between the vL and vH positions G102C and K43C (K167C as shown), having the sequence: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGT DFTLTISRLEPEDFAVYYCQQYGSSPWTFGQCTKVEIKRGGGGSGGGGSGGGGSQVQLVESGGGVVQPGR SLRLSCAASGFTFSSYTMHWVRQAPGCGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAIYYCARTGWLGPFDYWGQGTLVTVSS (SEQ ID NO:85). The tumor-specific binder polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the tumor-specific binder polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0251] A TSB polypeptide may comprise an anti-human CTLA-4 scFv (vL-vH) polypeptide related to Ipilimumab with a disulfide linkage between the vL and vH positions G102C and G44C (G168C as shown), having the sequence: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGT DFTLTISRLEPEDFAVYYCQQYGSSPWTFGQCTKVEIKRGGGGSGGGGSGGGGSQVQLVESGGGVVQPGR SLRLSCAASGFTFSSYTMHWVRQAPGKCLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAIYYCARTGWLGPFDYWGQGTLVTVSS (SEQ ID NO:86). The TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence. Alternatively, the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
[0252] The linker sequences in SEQ ID NOs:70-86 are bolded and italicized.
E. Methods of Preparation
[0253] The present disclosure includes and provides for the preparation of the constructs disclosed herein by transcription and translation of nucleic acids encoding the constructs in mammalian cells (CHO cells), yeast cells (e.g., Pica pastoris), sodoptera cells, or bacterial cells (e.g., E. coli cells). Portions of the constructs may also be prepared separately, such as by cellular expression as discussed above, chemical synthesis, etc., and then conjugated together using one or more chemical or enzymatic processes. Indeed, enzymatic means, self-catalyzed protein splicing, or chemical crosslinking (e.g., with a heterobifunctional crosslinker) can be used to couple (e.g. covalently attach), for example, ADs to NBDs, TSBs to NBDs, and/or NBDs to immune cell engagers. Where the components to be coupled are both comprised of aa sequences, enzymatic means and self-catalyzed protein splicing represent coupling options that permit both the stoichiometry and structure of the coupling reaction, while substantially avoiding potential secondary coupling reactions. For example, sortases and split inteins may be utilized to append a sequence comprising a NBD to an AD, a TSB binder, or an immune cell engager. See, e.g., Bhagawati et al., Proc Natl Acad Sci USA, 116(44):22164-22172 (2019). Alternatively, the enzyme catalyzed SpyTag/SpyCatcher system, which may employ the CnaB2 domain of the FbaB protein from Streptococcus pyogenes, can be utilized for conjugating an AD to a polypeptide comprising a NBD. See, e.g., Reddington and Howarth, Curr. Opin in Chem. Biol., 29: 94-99 (2015).
[0254] In addition to pure enzymatic and chemical conjugation methods for coupling components of the constructs described herein, affinity guided methods that combine the specificity of protein-protein interactions with chemical conjugation may be employed. Affinity guided chemical conjugations offer efficient, facile, and specific chemical conjugation reactions. One such method, PEptide-Directed Photo-cross-linking (PEDIP) has been described by Park et al. (2018), Bioconjug Chem., 29:3240-3244, and demonstrated for coupling polypeptides to antibody heavy chain constant regions. See also Kishomoto et al., (2019), Bioconjug Chem., 30(3):697-702.
[0255] Where the AD is not an aa sequence that can be translated in a biological system (e.g., it is a nucleic acid such as a CpG oligodeoxynucleotide), it may be coupled to the other portions of the molecule using, for example, bifunctional crosslinkers (e.g., homobifunctional or heterobifunctional crosslinkers).
[0256] The constructs may be purified using a variety of methods known in the art. For example, where the construct comprises an IgFc region as a scaffold, it may be purified by protein A or protein G chromatography. The constructs may be purified by nucleotide affinity chromatography or dye-ligand affinity chromatography using Cibacron Blue F3GA, Procion Blue HB, or Reactive blue 2 as affinity ligands. Size exclusion chromatography may also be used alone or in combination with affinity chromatography to purify the products.
F. Formulations and Methods of Treatment
[0257] The NBD-containing constructs and complexes disclosed herein (see, e.g.,
[0258] The compositions may be prepared for parenteral and/or other forms of administration. The constructs or compositions comprising the constructs may be administered by any suitable route, such as intravenously, intramuscularly, subcutaneously, intratumorally, or intralymphatically. The constructs may also be administered in conjunction with one or more other agents that act synergistically or non-synergistically with the constructs. For example, constructs of the present disclosure (e.g., those with IL-12 activating domains) may be administered with immune checkpoint inhibitors such as Pembrolizumab (Keytruda, targeting PD-1), Avelumab (Bavencio, targeting PD-L1), or Ipilimumab (Yervoy, targeting CTLA-4).
[0259] Any solid tumor that contains elevated levels of ATP relative to normal tissue may be treated utilizing the constructs of the present disclosure. Treatable tumors include mesotheliomas, melanomas, sarcomas, carcinomas, carcinosarcomas, lymphomas, and germ cell tumors. Representative carcinomas include, but are not limited to, colorectal carcinoma, breast carcinoma, neuroendocrine tumors, lung carcinoma, and gastric carcinoma. For example, the tumors may be lung, liver, skin, gastrointestinal, pancreatic, brain, or reproductive tissue (e.g., ovarian sarcomas) tumors.
VI. Aspects
[0260] 1. A polypeptide construct comprising a nucleotide binding domain (NBD) amino acid (aa) sequence, and an activating domain (AD) aa sequence, optionally joined by a linker peptide sequence; wherein the NBD comprises one or more adenosine triphosphate (ATP) binding sites and can homodimerize or heterodimerize with a cognate non-identical NBD in the presence of ATP (e.g., the NBD of TAP1 or TAP2 which can heterodimerize). [0261] 2. The polypeptide construct of aspect 1, wherein the construct is organized in the N-terminal to C-terminal direction as (i) NBD, optional linker, and AD aa sequences, or (ii) AD, optional linker, and NBD aa sequences. [0262] 3. The polypeptide construct of aspect 1 or 2, comprising a NBD aa sequence, scaffold aa sequence, and AD sequence optionally joined by independently selected linker aa sequences. [0263] 4. The polypeptide construct of aspect 3, wherein the construct comprises in the N-terminal to C-terminal direction the NBD, scaffold, and AD aa sequences. [0264] 5. The polypeptide construct of aspect 3, wherein the construct comprises in the N-terminal to C-terminal direction the NBD, AD, and scaffold aa sequences. [0265] 6. The polypeptide construct of aspect 3, wherein the construct comprises in the N-terminal to C-terminal direction, the AD, scaffold, and NBD aa sequences. [0266] 7. The polypeptide construct of aspect 3, wherein the construct comprises in the N-terminal to C-terminal direction, the AD, NBD, and scaffold aa sequences. [0267] 8. The polypeptide construct of aspect 3, wherein the construct comprises in the N-terminal to C-terminal direction, the scaffold, AD, and NBD aa sequences. [0268] 9. The polypeptide construct of aspect 3, wherein the construct comprises in the N-terminal to C-terminal direction, the scaffold, NBD, and AD aa sequences. [0269] 10. The polypeptide construct of any one of aspects 1-9, comprising two or more (e.g., three or more) independently selected AD aa sequences, wherein the AD aa sequences are optionally placed in tandem. [0270] 11. The polypeptide construct of any one of aspects 1-10, comprising two or more (e.g., three or more) independently selected NBD aa sequences, optionally placed in tandem (constrained so that no two NBDs within the same molecule can interact to form a complex in the presence of ATP). [0271] 12. The polypeptide construct of aspect 11, further comprising a rigid linker that substantially prevents interactions between the two or more NBD aa sequences in the presence of ATP. [0272] 13. The polypeptide construct of any one of aspects 1-12, wherein each NBD aa sequence may homodimerize in the presence of ATP (e.g. comprises an identical homodimerizing aa sequence). [0273] 14. The polypeptide construct of aspect 13, wherein the construct comprises a NBD (e.g., a single NBD) aa sequence. See e.g.,
VII. EXAMPLES
Example 1
[0451] In order to test the functionality of TAP1 NBD to homodimerize in solution, a human TAP1 NBD comprising: [0452] (i) N676, S677, Q680, E682, and Q683 (e.g., N676G, S677N, Q680R, E682Q, and Q683R substitutions, [0453] (ii) substitutions of cysteines present in the sequence with serines (SEQ ID NO:10) and (iii) a C-terminal His tag for purification was expressed in E. coli and subsequently purified. Samples of the molecular weight markers and the purified protein were subject to SDS-PAGE gel analysis under reducing and non-reducing conditions as shown in
[0454] Samples of the purified TAP1 NBD were exposed to 1 mM ADP or 1 mM ATP and subject to size exclusion chromatography. The results, shown in
TABLE-US-00011 Sample Name Polydispersity Index (PI) Size distribution by volume (nm) NBD1 in ADP Buffer 0.3356 5.157 NBD1 in ATP Buffer 0.6278 8.057
Example 2
[0455] The TAP1 NBD of SEQ ID NO:87 with a peptide comprising a SpyTag3, TEV protease, and a His tag attached at the C-terminus was expressed in E.coli. and the cells pelleted and frozen until analysis. The TAP1 NBD fragment was purified by cell lysis followed by chromatograph on a HisTrap column. For the analysis cell pellets were thawed and resuspended with 200 ml lysis buffer (20 mM Tris-Cl pH 8.0, 500 mM NaCl, 5 mM MgCl.sub.2, 10% glycerol, 2 mM ATP) supplemented with 100 g/ml lysozyme, 2 protease inhibitor tablets (Thermo Pierce A32965) and Universal Nuclease (Thermo Pierce 88702) added to 12.5 U/ml. Cells were incubated with stirring at 4 C. for 30 minutes then lysed by sonication at 80% intensity for a total of 4 minutes active time (5 seconds on, 15 seconds rest on ice per cycle). Lysate was then clarified by centrifugation at 12,000g for 1 hour at 4 C., then 0.22-m filtered and loaded onto a 1 ml HisTrap HP column (Cytiva) at 0.5 ml/min recirculating with a peristaltic pump overnight. The following day, the column was switched to flow-through, and after complete lysate loading at 1 ml/min, the column was washed with 10 column volumes (CV) of lysis buffer supplemented with 7 mM -mercaptoethanol and 20 mM imidazole. The column was then transferred to an KTAxpress FPLC, and bound proteins were eluted with an imidazole gradient from 0 to 500 mM over 40 CV in binding buffer (20 mM Tris-Cl pH 8.0, 200 mM NaCl, 5 mM MgCl.sub.2, 10% glycerol, 2 mM ATP, 0.5 mM PMSF). Column fractions were assessed by SDS-PAGE, and fractions containing target protein were pooled and concentrated (10 kDa MWCO) to 10 ml before loading as 3 injections (3.3 ml per injection) onto a Superdex 200 16/600 column equilibrated in target buffer (20 mM Tris-Cl pH 8.0, 50 mM NaCl, 5 mM MgCl.sub.2, 10% glycerol, 1 mM ATP). Elution peak fractions were assessed by SDS-PAGE, and target protein-containing fractions were pooled and concentrated (10 kDa molecular weight cutoff) to 10 mg/ml before aliquotting (500 l/tube) and and storage at 4 C.
[0456] The purified protein was subject to SDS-PAGE along with molecular weight samples. The coomassie blue stained gel is provided in
[0457] Samples of the purified protein (1 mg each) were buffer-exchanged on PD-10 columns (Cytiva 17085101) according to manufacturer instructions. For the buffer exchange PD-10 desalting columns were equilibrated with target buffer (20 mM Tris-Cl pH 8.0, 50 mM NaCl, 5 mM MgCl2, 10% glycerol) containing either 1 mM ATP or 1 mM ADP. One milligram (100 l of 10 mg/ml stock) of protein was added to each column along with 2.4 ml of target buffer, the column was centrifuged at 1000g for 2 minutes in a 50-ml conical tube, and the eluate was collected. Buffer-exchanged proteins were then concentrated to 0.5 ml (60 M) and loaded onto a Superdex S200 Increase column (Cytiva) equilibrated in the appropriate buffer containing ATP or ADP and eluted at 0.5 ml/min. The ATP-containing sample eluted at a volume of 15.75 ml, corresponding to a molecular weight of approximately 65 kDa, while the ADP sample eluted at 16.81 ml, corresponding to approximately 38 kDa. Traces of the chromatographic analysis are provided in
[0458] For determination of molecular weight by size exclusion chromatography in the presence of ADP and ATP, purified protein samples (1 mg each) were buffer-exchanged on PD-10 columns (Cytiva 17085101) according to manufacturer instructions. Briefly, PD-10 desalting columns were equilibrated with target buffer (20 mM Tris-Cl pH 8.0, 50 mM NaCl, 5 mM MgCl.sub.2, 10% glycerol) containing either 1 mM ATP or ADP. One milligram (100 l of 10 mg/ml stock) of protein was added to each column along with 2.4 ml of target buffer, the column was centrifuged at 1000g for 2 minutes in a 50-ml conical tube, and the eluate was collected. Buffer-exchanged proteins were then concentrated to 0.5 ml (60 M), loaded onto a Superdex S200 Increase column (Cytiva), and equilibrated in the appropriate buffer containing ATP or ADP at 0.5 ml/min. The ATP-containing sample eluted at a volume of 15.75 ml, corresponding to a molecular weight of approximately 65 kDa, while the ADP sample eluted at 16.81 ml, corresponding to approximately 38 kDa.
Example 3
[0459] For assessment of the uninduced and induced expression of NBD polypeptide, samples of E. coli BL21 (DE3) were transformed with a vector that permits isopropyl-beta-D-thiogalactoside (IPTG) inducible expression of the NBD of SEQ ID NO:87 or SEQ ID NO:88 with a peptide comprising a SpyTag3, TEV protease site, and His tagged at the C-terminus. For analysis of the uninduced and induced fractions, the optical density (OD) at 600 nm for each of the cultures was monitored up until induction at 0.4 OD when an aliquot equivalent to 1 OD-ml (e.g. 2.5 ml of 0.4 OD) was taken. The cells in the aliquots were pelleted at 6800g for 3 minutes, and the pellet resuspended in 300 l of 1 PBS, after which the resuspended material was frozen at 80 C. After induction with 80 M IPTG the cells were grown and a comparable sample of 1 OD-ml (e.g. 0.25 ml of 4 OD) was collected during the final harvest after induction. For analysis of induction the frozen samples were thawed and the cells in all samples were lysed by mixing with an equal volume of 2 lysis buffer (1 PBS with 0.2% Triton X-100, 100 g/ml lysozyme and 2 concentration of Universal Nuclease from Pierce). Samples were incubated on a rocker at 4 C. for 30 minutes, after which the lysates were spun at 21,000g for 10 minutes to pellet debris. Samples (30 l) of the supernatant were mixed with 10 l of 4 SDS-PAGE loading buffer, heated at 70 C. for about 5 minutes, then loaded on a SDS-PAGE gel. Results are shown in
[0460] For determination expression levels and molecular weight by size exclusion chromatography, samples of the NBD polypeptides of SEQ ID NOs:87 and 88 were expressed in E. coli and purified for SDS-PAGE and chromatographic analysis as in Example 2. The results of chromatographic molecular weight determinations and protein yield, which is about two orders of magnitude (90-fold) higher for the capped NBD of SEQ ID NO:88 relative to that of SEQ ID NO:87 are provided in the table that follows.
TABLE-US-00012 TAP1 polypeptide Yield from Culture MW in 1 mM ADP buffer MW in 1 mM ATP buffer SEQ ID NO: 87 100 g/liter 38 kDa 65 kDa SEQ ID NO: 88 9 mg/liter 38.1 kDa 78 kDa
[0461]
TABLE-US-00013 Gel (B) Evaluation of the purified NBD polypeptide Gel (A) Induced vs. Uninduced Expression of SEQ ID NO: 88 Lane Sample Lane Sample 1 Molecular Weight Markers 1 Molecular Weight Markers 2 Expression of the NBD polypeptide of f SEQ ID 2 Additional purified NBD polypeptide NO: 87 prior to induction 3 Expression of the NBD polypeptide of SEQ ID 3 Additional purified NBD polypeptide NO: 87 after induction (see white box and arrow) 4 Expression of the NBD polypeptide of SEQ ID 4 The purified NBD polypeptide of SEQ ID NO: 88 prior to induction NO: 88 5 Expression of the NBD polypeptide of SEQ ID NO: 88 after induction (see white box)