METHODS AND APPARATUS FOR SYNTHESIZING NUCLEIC ACIDS
20250197921 ยท 2025-06-19
Inventors
Cpc classification
C12Y207/07031
CHEMISTRY; METALLURGY
C12Q1/6806
CHEMISTRY; METALLURGY
C12P19/34
CHEMISTRY; METALLURGY
Y02P20/582
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N9/1264
CHEMISTRY; METALLURGY
International classification
C12Q1/6806
CHEMISTRY; METALLURGY
C12N9/12
CHEMISTRY; METALLURGY
Abstract
The invention provides improved methods for synthesizing polynucleotides, such as DNA and RNA, using enzymes and specially designed nucleotide analogs. Using the methods of the invention, specific sequences of polynucleotides can be synthesized de nova, base by base, in an aqueous environment, without the use of a nucleic acid template. Because the nucleotide analogs have an unmodified 3 OH, i.e., as found in natural deoxyribose and ribose molecules, the analogs result in natural polynucleotides suitable for incorporation into biological systems.
Claims
1. A method for non-template dependent oligonucleotide synthesis, the method comprising: exposing a nucleic acid strand to a terminal transferase enzyme capable of incorporating a single nucleotide and remaining bound to the strand and preventing further nucleotide incorporation until exposed to a releasing agent or releasing condition.
2. The method of claim 1, wherein said single nucleotide is a nucleotide analog.
3. The method of claim 1, wherein the terminal transferase enzyme is a modified terminal deoxynucleotidyl transferase (TdT) enzyme.
4. The method of claim 3, wherein the modification comprises a mutation allowing the covalent attachment of a nucleotide analog to the TdT enzyme.
5. The method of claim 1, wherein the releasing reagent comprises a salt buffer or a denaturant or a reducing agent or elevated pH.
6. The method of claim 1, wherein the releasing condition is a temperature increase or agitation.
7. A method for non-template dependent oligonucleotide synthesis, the method comprising: exposing a covalent blocker-nucleic acid strand complex to an exonuclease to remove un complexed, unmodified nucleic acid strands; removing the exonuclease; and exposing the covalent blocker-nucleic acid strand complex to a releasing agent or a releasing condition.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
DETAILED DESCRIPTION
[0032] The invention provides improved methods for synthesizing polynucleotides, such as DNA and RNA, using enzymes and nucleic acid analogs. Using the disclosed methods, specific sequences of polynucleotides can be synthesized de nova, base by base, in an aqueous environment, without the use of a nucleic acid template. Additionally, because the nucleotide analogs have an unmodified 3 hydroxyls, i.e., as found in natural deoxyribose and ribose molecules, the analogs result in natural nucleotides when a cleavable blocking group is removed from the base. Other nucleotide analogs can also be used which, for example, include self-eliminating linkers, or nucleotides with modified phosphate groups. In most instances, the blocking group is designed to not leave behind substantial additional molecules, i.e., designed to leave behind scarless nucleotides that are recognized as natural nucleotides by the enzyme. Thus, at the conclusion of the synthesis, upon removal of the last blocking group, the synthesized polynucleotide is chemically and structurally equivalent to the naturally occurring polynucleotide with the same sequence. The synthetic polynucleotide can, thus, be incorporated into living systems without concern that the synthesized polynucleotide will interfere with biochemical pathways or metabolism.
[0033] The process and analogs of the current invention can be used for the non-templated enzymatic synthesis of useful oligo-and oligodeoxynucleotides especially of long oligonucleotides (<5000 nt). Products can be single strand or partially double strand depending upon the initiator used. The synthesis of long oligonucleotides requires high efficiency incorporation and high efficiency of reversible terminator removal. The initiator bound to the solid support consists of a short, single strand DNA sequence that is either a short piece of the user defined sequence or a universal initiator from which the user defined single strand product is removed.
[0034] In one aspect, the disclosed methods employ commercially available nucleotidyl transferase enzymes, such as terminal deoxynucleotidyl transferase (TdT), to synthesize polynucleotides from nucleotide analogs in a step-by-step fashion. The nucleotide analogs are of the form: [0035] NTP-linker-inhibitor
wherein NTP is a nucleotide triphosphate (i.e., a dNTP or an rNTP), the linker is a cleavable linker between the pyridine or pyrimidine of the base, and the inhibitor is a group that prevents the enzyme from incorporating subsequent nucleotides. At each step, a new nucleotide analog is incorporated into the growing polynucleotide chain, whereupon the enzyme is blocked from adding an additional nucleotide by the inhibitor group. Once the enzyme has stopped, the excess nucleotide analogs can be removed from the growing chain, the inhibitor can be cleaved from the NTP, and new nucleotide analogs can be introduced in order to add the next nucleotide to the chain. By repeating the steps sequentially, it is possible to quickly construct nucleotide sequences of a desired length and sequence. Advantages of using nucleotidyl transferases for polynucleotide synthesis include: 1) 3-extension activity using single strand (ss) initiating primers in a template-independent polymerization, 2) the ability to extend primers in a highly efficient manner resulting in the addition of thousands of nucleotides, and 3) the acceptance of a wide variety of modified and substituted NTPs as efficient substrates. In addition, the invention can make use of an initiator sequence that is a substrate for nucleotidyl transferase. The initiator is attached to a solid support and serves as a binding site for the enzyme. The initiator is preferably a universal initiator for the enzyme, such as a homopolymer sequence and is recyclable on the solid support, the formed oligonucleotide being cleavable from the initiator.
[0036] Methods of the invention are well-suited to a variety of applications that currently use synthetic nucleic acids, e.g., phosphoramidite-synthesized DNA oligos. For example, polynucleotides synthesized with the methods of the invention can be used as primers for nucleic acid amplification, hybridization probes for detection of specific markers, and for incorporation into plasmids for genetic engineering. However, because the disclosed methods produce longer synthetic strings of nucleotides, at a faster rate, and in an aqueous environment, the disclosed methods also lend themselves to high-throughput applications, such as screening for expression of genetic variation in cellular assays, as well as synthetic biology. Furthermore, the methods of the invention will provide the functionality needed for next-generation applications, such as using DNA as synthetic read/write memory, or creating macroscopic materials synthesized completely (or partially) from DNA.
[0037] The invention and systems described herein provide for synthesis of polynucleotides, including deoxyribonucleic acids (DNA) and ribonucleic acids (RNA). While synthetic pathways for natural nucleotides, such as DNA and RNA, are described in the context of the common nucleic acid bases, e.g., adenine (A), guanine (G), cytosine (C), thymine (T), and uracil (U), it is to be understood that the methods of the invention can be applied to so-called non-natural nucleotides, including nucleotides incorporating universal bases such as 3-nitropyrrole 2-deoxynucloside and 5-nitroindole 2-deoxynucleoside, alpha phosphorothiolate, phosphorothioate nucleotide triphosphates, or purine or pyrimidine conjugates that have other desirable properties, such as fluorescence. Other examples of purine and pyrimidine bases include pyrazolo [3,4-d]pyrimidines, 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo (e.g., 8-bromo), 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other 5-substituted uracils and cytosines, 7-methylguanine and 7-methyladenine, 8-azaguanine and 8-azaadenine, deazaguanine, 7-deazaguanine, 3-deazaguanine, deazaadenine, 7-deazaadenine, 3-deazaadenine, pyrazolo [3,4-d]pyrimidine, imidazo [1,5-a]1,3,5 triazinones, 9-deazapurines, imidazo [4,5-d]pyrazines, thiazolo [4,5-d]pyrimidines, pyrazin-2-ones, 1,2,4-triazine, pyridazine; and 1,3,5 triazine. In some instances, it may be useful to produce nucleotide sequences having unreactive, but approximately equivalent bases, i.e., bases that do not react with other proteins, i.e., transcriptases, thus allowing the influence of sequence information to be decoupled from the structural effects of the bases.
Analogs
[0038] The invention provides nucleotide analogs having the formula NTP-linker-inhibitor for synthesis of polynucleotides in an aqueous environment. With respect to the analogs of the form NTP-linker-inhibitor, NTP can be any nucleotide triphosphate, such as adenosine triphosphate (ATP), guanosine triphosphate (GTP), cytidine triphosphate (CTP), thymidine triphosphate (TTP), uridine triphosphate (UTP), nucleotide triphosphates, deoxyadenosine triphosphate (dATP), deoxyguanosine triphosphate (dGTP), deoxycytidine triphosphate (dCTP), deoxythymidine triphosphate (dTTP), or deoxyuridine triphosphate (dUTP).
[0039] The linker can be any molecular moiety that links the inhibitor to the NTP and can be cleaved, e.g., chemically cleaved, electrochemically cleaved, enzymatically cleaved, or photolytically cleaved. For example, the linkers can be cleaved by adjusting the pH of the surrounding environment. The linkers may also be cleaved by an enzyme that is activated at a given temperature, but inactivated at another temperature. In some embodiments, the linkers include disulfide bonds.
[0040] The linker can be attached, for example, at the N4 of cytosine, the N3 or 04 of thymine, the N2 or N3 of guanine, and the N6 of adenine, or the N3 or 04 of uracil because attachment at a carbon results in the presence of a residual scar after removal of the polymerase-inhibiting group. The linker is typically on the order of at least about 10 Angstroms long, e.g., at least about 20 Angstroms long, e.g., at least about 25 Angstroms long, thus allowing the inhibitor to be far enough from the pyridine or pyrimidine to allow the enzyme to bind the NTP to the polynucleotide chain via the attached sugar backbone. In some embodiments, the cleavable linkers are self-cyclizing in that they form a ring molecule that is particularly non-reactive toward the growing nucleotide chain.
[0041] The nucleotide analogs can include any moiety linked to the NTP that inhibits the coupling of subsequent nucleotides by the enzyme. The inhibitory group can be a charged group, such as a charged amino acid, or the inhibitory group can be a group that becomes charged depending upon the ambient conditions. In some embodiments, the inhibitor may include a moiety that is negatively charged or capable of becoming a negatively charged. In other embodiments, the inhibitor group is positively charged or capable of becoming positively charged. In some other embodiments, the inhibitor is an amino acid or an amino acid analog.
[0042] The inhibitor may be a peptide of 2 to 20 units of amino acids or analogs, a peptide of 2 to 10 units of amino acids or analogs, a peptide of 3 to 7 units of amino acids or analogs, a peptide of 3 to 5 units of amino acids or analogs. In some embodiments, the inhibitor includes a group selected from the group consisting of Glu, Asp, Arg, His, and Lys, and a combination thereof (e.g., Arg, Arg-Arg, Asp, Asp-Asp, Asp, Glu, Glu-Glu, Asp-Glu-Asp, Asp-Asp-Glu or AspAspAspAsp, etc.). Peptides or groups may be combinations of the same or different amino acids or analogs. The inhibitory group may also include a group that reacts with residues in the active site of the enzyme thus interfering with the coupling of subsequent nucleotides by the enzyme.
[0043] An example of a nucleotide analog of the type NTP-linker-inhibitor is shown in
[0044] An exemplary scheme for synthesizing a dCTP analog of
##STR00001##
[0045] In a fashion analogous to
[0046] The invention is not limited to the linking chemistry of Scheme 1, however, as carbamate, amide, or other self-eliminating linkages could also be employed. For example, nucleotides can also be prepared with Staudinger linkers, as shown in Scheme 2.
##STR00002##
[0047] A deoxycytidine triphosphate (dCTP) analog created with a Staudinger linker (Scheme 2) to an Asp-Asp blocking group is shown in
[0048] The methodologies of Scheme 1 can be used to produce corresponding ribonucleotide analogs, e.g., as shown in
Enzymes
[0049] The methods of the invention employ nucleotidyl transferases to assemble the nucleotide analogs into polynucleotides. Nucleotidyl transferases include several families of related transferase and polymerase enzymes. Some nucleotidyl transferases polymerize deoxyribonucleotides more efficiently than ribonucleotides, some nucleotidyl transferases polymerize ribonucleotides more efficiently than deoxyribonucleotides, and some nucleotidyl transferases polymerize ribonucleotides and deoxyribonucleotides at approximately the same rate.
[0050] Of particular import to the invention, transferases having polymerase activity, such as terminal deoxynucleotidyl transferase (TdT), are capable of catalyzing the addition of deoxyribonucleotides to the 3 end of a nucleotide chain, thereby increasing chain length in DNA nucleotides. TdT will only catalyze the addition of 1-2 ribonucleotides to the growing end of a DNA strand which could be useful in the construction of site specific DNA-RNA chimeric polynucleotides. In particular, calf thymus TdT, sourced from engineered E. coli, is suitable for use with the invention and available from commercial sources such as Thermo Scientific (Pittsburgh, PA). The amino acid sequence corresponding to calf TdT is listed in Table 1 as SEQ ID NO. 1.
TABLE-US-00001 TABLE1 AminoAcidSequenceofBovineTdT SEQIDNO.1: MAQQRQHQRLPMDPLCTASSGPRKKRPRQVGASMASPPHD IKFQNLVLFILEKKMGTTRRNFLMELARRKGFRVENELSD SVTHIVAENNSGSEVLEWLQVQNIRASSQLELLDVSWLIE SMGAGKPVEITGKHQLVVRTDYSATPNPGFQKTPPLAVKK ISQYACQRKTTLNNYNHIFTDAFEILAENSEFKENEVSYV TFMRAASVLKSLPFTIISMKDTEGIPCLGDKVKCIIEEII EDGESSEVKAVLNDERYQSFKLFTSVFGVGLKTSEKWFRM GFRSLSKIMSDKTLKFTKMQKAGFLYYEDLVSCVTRAEAE AVGVLVKEAVWAFLPDAFVTMTGGFRRGKKIGHDVDFLIT SPGSAEDEEQLLPKVINLWEKKGLLLYYDLVESTFEKFKL PSRQVDTLDHFQKCFLILKLHHQRVDSSKSNQQEGKTWKA IRVDLVMCPYENRAFALLGWTGSRQFERDIRRYATHERKM MLDNHALYDKTKRVFLKAESEEEIFAHLGLDYIEPWERNA
[0051] The nucleotide sequence corresponding to calf TdT is listed in Table 2 as SEQ ID NO. 2.
TABLE-US-00002 TABLE2 NucleicAcidSequenceofBovineTdT SEQIDNO.2: ctcttctggagataccacttgatggcacagcagaggcagc atcagcgtcttcccatggatccgctgtgcacagcctcctc aggccctcggaagaagagacccaggcaggtgggtgcctca atggcctcccctcctcatgacatcaagtttcaaaatttgg tcctcttcattttggagaagaaaatgggaaccacccgcag aaacttcctcatggagctggctcgaaggaaaggtttcagg gttgaaaatgagctcagtgattctgtcacccacattgtag cagaaaacaactctggttcagaggttctcgagtggcttca ggtacagaacataagagccagctcgcagctagaactcctt gatgtctcctggctgatcgaaagtatgggagcaggaaaac cagtggagattacaggaaaacaccagcttgttgtgagaac agactattcagctaccccaaacccaggcttccagaagact ccaccacttgctgtaaaaaagatctcccagtacgcgtgtc aaagaaaaaccactttgaacaactataaccacatattcac ggatgcctttgagatactggctgaaaattctgagtttaaa gaaaatgaagtctcttatgtgacatttatgagagcagctt ctgtacttaaatctctgccattcacaatcatcagtatgaa ggatacagaaggaattccctgcctgggggacaaggtgaag tgtatcatagaggaaattattgaagatggagaaagttctg aagttaaagctgtgttaaatgatgaacgatatcagtcctt caaactctttacttctgtttttggagtgggactgaagaca tctgagaaatggttcaggatggggttcagatctctgagta aaataatgtcagacaaaaccctgaaattcacaaaaatgca gaaagcaggatttctctattatgaagaccttgtcagctgc gtgaccagggccgaagcagaggcggttggcgtgctggtta aagaggctgtgtgggcatttctgccggatgcctttgtcac catgacaggaggattccgcaggggtaagaagattgggcat gatgtagattttttaattaccagcccaggatcagcagagg atgaagagcaacttttgcctaaagtgataaacttatggga aaaaaagggattacttttatattatgaccttgtggagtca acatttgaaaagttcaagttgccaagcaggcaggtggata ctttagatcattttcaaaaatgctttctgattttaaaatt gcaccatcagagagtagacagtagcaagtccaaccagcag gaaggaaagacctggaaggccatccgtgtggacctggtta tgtgcccctacgagaaccgtgcctttgccctgctaggctg gactggctcccggcagtttgagagagacatccggcgctat gccacacacgagcggaagatgatgctggataaccacgctt tatatgacaagaccaagagggtatttctcaaagcggaaag tgaagaagaaatctttgcacatctgggattggactacatt gaaccatgggaaagaaatgcttaggagaaagctgtcaact tttttcttttctgttctttttttcaggttagacaaattat gcttcatattataatgaaagatgccttagtcaagtttggg attctttacattttaccaagatgtagattgcttctagaaa taagtagttttggaaacgtgatcaggcaccccctgggtta tgctctggcaagccatttgcaggactgatgtgtagaactc gcaatgcattttccatagaaacagtgttggaattggtggc tcatttccagggaagttcatcaaagcccactttgcccaca gtgtagctgaaatactgtatacttgccaataaaaatagga aac
[0052] While commercially available TdT is suitable for use with the methods of the invention, modified TdT, e.g., having an amino acid sequence at least 95% in common with SEQ ID NO. 1, e.g., having an amino acid sequence at least 98% in common with SEQ ID NO. 1, e.g., having an amino acid sequence at least 99% in common with SEQ ID NO. 1, may be used with the methods of the invention. An organism that expresses a suitable nucleotidyl transferase may comprise a nucleic acid sequence at least 95% in common with SEQ ID NO. 2, e.g., at least 98% in common with SEQ ID NO. 2, e.g., at least 99% in common with SEQ ID NO. 2. In some instances, a modified TdT will result in more efficient generation of polynucleotides or allow better control of chain length. Other modifications to the TdT may change the release characteristics of the enzyme, thereby reducing the need for aqueous reducing agents such as TCEP or DTT.
[0053] For the synthesis of RNA polynucleotides, a nucleotidyl transferase like E. coli poly (A) polymerase can be used to catalyze the addition of ribonucleotides to the 3 end of a ribonucleotide initiator. In other embodiments, E. coli poly (U) polymerase may be more suitable for use with the methods of the invention. Both E. coli poly (A) polymerase and E. coli poly (U) polymerase are available from New England Biolabs (Ipswich, MA). The amino acid and nucleotide sequences for E. coli Poly (A) polymerase and E. coli Poly (U) polymerase are reproduced below. Modified E. coli Poly (A) polymerase or E. coli Poly (U) polymerase may be suitable for use with the methods of the invention. For example, an enzyme, having an amino acid sequence at least 95% in common with SEQ ID NO. 3, e.g., having an amino acid sequence at least 98% in common with SEQ ID NO. 3, e.g., having an amino acid sequence at least 99% in common with SEQ ID NO. 3, may be used with the methods of the invention. An organism that expresses a suitable enzyme may comprise a nucleic acid sequence at least 95% in common with SEQ ID NO. 4, e.g., at least 98% in common with SEQ ID NO. 4, e.g., at least 99% in common with SEQ ID NO. 4. Alternatively, an enzyme having an amino acid sequence at least 95% in common with SEQ ID NO. 5, e.g., having an amino acid sequence at least 98% in common with SEQ ID NO. 5, e.g., having an amino acid sequence at least 99% in common with SEQ ID NO. 5, may be used with the methods of the invention. An organism that expresses a suitable enzyme may comprise a nucleic acid sequence at least 95% in common with SEQ ID NO. 6, e.g., at least 98% in common with SEQ ID NO. 6, e.g., at least 99% in common with SEQ ID NO. 6.
TABLE-US-00003 TABLE3 AminoAcidSequenceofE.coliPoly(A) polymerase SEQIDNO.3: MFTRVANFCRKVLSREESEAEQAVARPQVTVIPREQHAIS RKDISENALKVMYRLNKAGYEAWLVGGGVRDLLLGKKPKD FDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGPEIIEV ATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQR RDFTINSLYYSVADFTVRDYVGGMKDLKDGVIRLIGNPET RYREDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLND IPPARLFEESLKLLQAGYGYETYKLLCEYHLFQPLFPTIT RYFTENGDSPMERIIEQVLKNTDTRIHNDMRVNPAFLFAA MFWYPLLETAQKIAQESGLTYHDAFALAMNDVLDEACRSL AIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRAA YDLLALRAEVERNAELQRLVKWWGEFQVSAPPDQKGMLNE LDEEPSPRRRTRRPRKRAPRREGTA
[0054] The nucleotide sequence corresponding to E. coli poly (A) polymerase is listed in Table 4 as SEQ ID NO. 4.
TABLE-US-00004 TABLE4 NucleotideSequenceofE.coliPoly(A) polymerase SEQIDNO.4: atttttacccgagtcgctaatttttgccgcaaggtgctaa gccgcgaggaaagcgaggctgaacaggcagtcgcccgtcc acaggtgacggtgatcccgcgtgagcagcatgctatttcc cgcaaagatatcagtgaaaatgccctgaaggtaatgtaca ggctcaataaagcgggatacgaagcctggctggttggcgg cggcgtgcgcgacctgttacttggcaaaaagccgaaagat tttgacgtaaccactaacgccacgcctgagcaggtgcgca aactgttccgtaactgccgcctggtgggtcgccgtttccg tctggctcatgtaatgtttggcccggagattatcgaagtt gcgaccttccgtggacaccacgaaggtaacgtcagcgacc gcacgacctcccaacgcgggcaaaacggcatgttgctgcg cgacaacattttcggctccatcgaagaagacgcccagcgc cgcgatttcactatcaacagcctgtattacagcgtagcgg attttaccgtccgtgattacgttggcggcatgaaggatct gaaggacggcgttatccgtctgattggtaacccggaaacg cgctaccgtgaagatccggtacgtatgctgcgcgcggtac gttttgccgccaaattgggtatgcgcatcagcccggaaac cgcagaaccgatccctcgcctcgctaccctgctgaacgat atcccaccggcacgcctgtttgaagaatcgcttaaactgc tacaagcgggctacggttacgaaacctataagctgttgtg tgaatatcatctgttccagccgctgttcccgaccattacc cgctacttcacggaaaatggcgacagcccgatggagcgga tcattgaacaggtgctgaagaataccgatacgcgtatcca taacgatatgcgcgtgaacccggcgttcctgtttgccgcc atgttctggtacccactgctggagacggcacagaagatcg cccaggaaagcggcctgacctatcacgacgctttcgcgct ggcgatgaacgacgtgctggacgaagcctgccgttcactg gcaatcccgaaacgtctgacgacattaacccgcgatatct ggcagttgcagttgcgtatgtcccgtcgtcagggtaaacg cgcatggaaactgctggagcatcctaagttccgtgcggct tatgacctgttggccttgcgagctgaagttgagcgtaacg ctgaactgcagcgtctggtgaaatggtggggtgagttcca ggtttccgcgccaccagaccaaaaagggatgctcaacgag ctggatgaagaaccgtcaccgcgtcgtcgtactcgtcgtc cacgcaaacgcgcaccacgtcgtgagggtaccgcatga
TABLE-US-00005 TABLE5 AminoAcidSequenceofE.coliPoly(U) polymerase SEQIDNO.5: GSHMSYQKVPNSHKEFTKFCYEVYNEIKISDKEFKEKRAA LDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLM DSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSD TKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPM VLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKP PVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSL GSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTS ATEHTGSADQIIKDRYILAIEDPFEISHNVGRTVSSSGLY RIRGEFMAASRLLNSRSYPIPYDSLFEEA
[0055] The nucleotide sequence corresponding to E. coli poly (U) polymerase is listed in Table 6 as SEQ ID NO. 6.
TABLE-US-00006 TABLE6 NucleotideSequenceofE.coliPoly(A) polymerase SEQIDNO.6: ggcagccatatgagctatcagaaagtgccgaacagccata aagaatttaccaaattttgctatgaagtgtataacgaaat taaaattagcgataaagaatttaaagaaaaacgcgcggcg ctggataccctgcgcctgtgcctgaaacgcattagcccgg atgcggaactggtggcgtttggcagcctggaaagcggcct ggcgctgaaaaacagcgatatggatctgtgcgtgctgatg gatagccgcgtgcagagcgataccattgcgctgcagtttt atgaagaactgattgcggaaggctttgaaggcaaatttct gcagcgcgcgcgcattccgattattaaactgaccagcgat accaaaaacggctttggcgcgagctttcagtgcgatattg gctttaacaaccgcctggcgattcataacaccctgctgct gagcagctataccaaactggatgcgcgcctgaaaccgatg gtgctgctggtgaaacattgggcgaaacgcaaacagatta acagcccgtattttggcaccctgagcagctatggctatgt gctgatggtgctgtattatctgattcatgtgattaaaccg ccggtgtttccgaacctgctgctgagcccgctgaaacagg aaaaaattgtggatggctttgatgtgggctttgatgataa actggaagatattccgccgagccagaactatagcagcctg ggcagcctgctgcatggcttttttcgcttttatgcgtata aatttgaaccgcgcgaaaaagtggtgacctttcgccgccc ggatggctatctgaccaaacaggaaaaaggctggaccagc gcgaccgaacataccggcagcgcggatcagattattaaag atcgctatattctggcgattgaagatccgtttgaaattag ccataacgtgggccgcaccgtgagcagcagcggcctgtat cgcattcgcggcgaatttatggcggcgagccgcctgctga acagccgcagctatccgattccgtatgatagcctgtttga agaagcg
[0056] As discussed above, the inhibitor coupled to the nucleotide analog will cause the transferase, e.g., TdT, to not release from the polynucleotide or prevent other analogs from being incorporated into the growing chain. A charged moiety results in better inhibition, however, research suggests that the specific chemical nature of the inhibitor is not particularly important. For example, both phosphates and acidic peptides can be used to inhibit enzymatic activity. See, e.g., Bowers et al., Nature Methods, vol. 6, (2009) p. 593-95, and U.S. Pat. No. 8,071,755, both of which are incorporated herein by reference in their entireties. In some embodiments, the inhibitor will include single amino acids or dipeptides, like -(Asp) 2, however the size and charge on the moiety can be adjusted, as needed, based upon experimentally determined rates of first nucleotide incorporation and second nucleotide incorporation. That is, other embodiments may use more or different charged amino acids or other biocompatible charged molecule.
[0057] Other methods of nucleotide synthesis may be used to build de novo oligonucleotides in a template independent fashion using nucleotidyl transferases or modified nucleotidyl transferases. In one embodiment, the polymerase/transferase enzymes can be modified so that they cease nucleotide addition when they encounter a modification to the phosphate of a 3-unmodified dNTP analog. This scheme would require a deblocking reagent/reaction that modifies the phosphate end of the nucleotide analog, which frees up the nascent strand for subsequent nucleotide incorporation. Preferred embodiments of this approach would use nucleotide analogs modified only at the phosphates (alpha, beta or gamma) although modifications of the purine/pyrimidine base of the nucleotide are allowed.
[0058] Another embodiment for using non-template dependent polymerase/transferase enzymes would be to using protein engineering or protein evolution to modify the enzyme to remain tightly bound and inactive to the nascent strand after each single nucleotide incorporation, thus preventing any subsequent incorporation until such time as the polymerase/transferase is released from the strand by use of a releasing reagent/condition. Such modifications would be selected to allow the use of natural unmodified dNTPs instead of reversible terminator dNTPs. Releasing reagents could be high salt buffers, denaturants, etc. Releasing conditions could be high temperature, agitation, etc. For instance, mutations to the Loop1 and SD1 regions of TdT have been shown to dramatically alter the activity from a template-independent activity to more of a template dependent activity. Specific mutations of interest include but are not limited to 3384/391/392, del loop1 (386 398), D339A, F401A, and Q402K403C404.fwdarw.E402R403S404. Other means of accomplishing the goal of a post-incorporation tight binding TdT enzyme could include mutations to the residues responsible for binding the three phosphates of the initiator strand including but not limited to K261, R432, and R454.
[0059] Another embodiment for using non-template dependent polymerase/transferase enzymes would be to use protein engineering or protein evolution to modify the enzyme to accept 3-blocked reversible terminators with high efficiency. Most naturally occurring polymerase/transferase enzymes will not incorporate 3-blocked reversible terminators due to steric constraints in the active site of the enzyme. Modifying either single or several aa residues in the active site of the enzyme can allow the highly efficient incorporation of 3-blocked reversible terminators into a support bound initiator in a process completely analogous to that described above. After incorporation, the 3-reversible terminator is removed with a deblocking reagent/condition thus generating a completely natural (scarless) single strand molecule ready for subsequent controlled extension reactions. There are few residues close to the 3-OH of the incoming dNTP which explains the propensity of TdT for incorporating ribonucleotide triphosphates as readily as deoxyribonucleotide triphosphates; residues including but not limited to those between 1 and 2 especially R334, Loop1, and those between a13 and a14, especially R454, are likely targets for mutagenesis to accommodate the bulk of 3-reversible terminator groups and allow their efficient incorporation. Another embodiment for using template-dependent polymerases would be to use the either 3blocked or 3unblocked dNTP analogs with a plurality of primer-template pairs attached to a solid support.
[0060] Another embodiment for using non-template dependent polymerase/transferase enzymes can use protein engineering or protein evolution to modify the enzyme to optimize the use of each of the four different nucleotides or even different modified nucleotide analogs in an analog specific manner. Nucleotide specific or nucleotide analog specific enzyme variants could be engineered to possess desirable biochemical attributes like reduced Km or enhanced addition rate which would further reduce the cost of the synthesis of desired polynucleotides.
Solid State Synthesis
[0061] The methods of the invention can be practiced under a variety of reaction conditions, however the orderly construction and recovery of desired polynucleotides will, in most cases, require a solid support to which the polynucleotides can be grown. In some embodiments, the methods include the enzymatically mediated synthesis of polynucleotides on a solid support, as illustrated in
[0062] Solid supports suitable for use with the methods of the invention may include glass and silica supports, including beads, slides, pegs, or wells. In some embodiments, the support may be tethered to another structure, such as a polymer well plate or pipette tip. In some embodiments, the solid support may have additional magnetic properties, thus allowing the support to be manipulated or removed from a location using magnets. In other embodiments, the solid support may be a silica coated polymer, thereby allowing the formation of a variety of structural shapes that lend themselves to automated processing.
Synthesizers
[0063] To capitalize on the efficiency of the disclosed methods, an aqueous phase DNA synthesizer can be constructed to produce desired polynucleotides in substantial quantities. In one embodiment, a synthesizer will include four wells of the described NTP analog reagents, i.e., dCTP, dATP, dGTP, and dTTP, as well as TdT at concentrations sufficient to effect polynucleotide growth. A plurality of initiating sequences can be attached to a solid support that is designed to be repeatedly dipped into each of the four wells, e.g., using a laboratory robot. The robot could be additionally programmed to rinse the solid support in wash buffer between nucleotide additions, cleave the linking group by exposing the support to a deblocking agent, and wash the solid support a second time prior to moving the solid support to the well of the next desired nucleotide. With simple programming, it is possible to create useful amounts of desired nucleotide sequences in a matter of hours, and with substantial reductions hazardous waste. Ongoing synthesis under carefully controlled conditions will allow the synthesis of polynucleotides with lengths in the thousands of base pairs. Upon completion, the extension products are released from the solid support, whereupon they can be used as finished nucleotide sequences.
[0064] A highly parallel embodiment could consist of a series of initiator-solid supports on pegs in either 96 or 384 well formats that could be individually retracted or lowered so that the pegs can be indexed to contact the liquids in the wells in a controlled fashion. The synthesizer could thus consist of the randomly addressable peg device, four enzyme-dNTP analog reservoirs in the same format as the peg device (96 or 384 spacing), additional reagent reservoirs (washing, deblocking, etc.) in the same format as the peg device (96 or 384 spacing), and a transport mechanism (e.g., a laboratory robot) for moving the peg device from one reservoir to another in a user programmable controlled but random access fashion. Care must be taken to avoid contaminating each of the four enzyme-dNTP reservoirs since the contents are reused throughout the entire synthesis process to reduce the cost of each polynucleotide synthesis.
[0065] In alternative embodiments, the reagents (e.g., nucleotide analogs, enzymes, buffers) will be moved between solid supports, allowing the reagents to be recycled. For example, a system of reservoirs and pumps can move four different nucleotide analog solutions, wash buffers, and/or reducing agent solutions between one or more reactors in which the oligonucleotides will be formed. The reactors and pumps can be conventional, or the devices may be constructed using microfluidics. Because of the non-anhydrous (aqueous) nature of the process, no special care needs to be taken in the design of the hardware used to eliminate exposure to water. The synthesis process can take place with only precautions to control evaporative loss. A highly parallel embodiment could consist of a monolithic series of initiator-solid supports on pegs in either 96 or 384 well format that can be interfaced to a series of wells in the same matching format. Each well would actually be a reaction chamber that is fed by four enzyme-dNTP analog reservoirs and additional reagent reservoirs (washing, deblocking, etc.) with appropriate valves. Provisions would be made in the fluidics logic to recover the enzyme-dNTP reactants in a pristine fashion after each extension reaction since they are reused throughout the entire synthesis process to reduce the cost of each polynucleotide synthesis. In other embodiments, a system of pipetting tips could be used to add and remove reagents.
[0066] After synthesis, the released extension products can be analyzed by high resolution PAGE to determine if the initiators have been extended by the anticipated number of bases compared to controls. A portion of the recovered synthetic DNA may also be sequenced to determine if the synthesized polynucleotides are of the anticipated sequence.
[0067] Because the synthesizers are relatively simple and do not require the toxic components needed for phosphoramidite synthesis, synthesizers of the invention will be widely accessible for research institutions, biotechs, and hospitals. Additionally, the ability to reuse/recycle reagents will reduce the waste produced and help reduce the costs of consumables. The inventors anticipate that the methods and systems will be useful in a number of applications, such as DNA sequencing, PCR, and synthetic biology.
Incorporation by Reference
[0068] References and citations to other documents, such as patents, patent applications, patent publications, journals, books, papers, web contents, have been made throughout this disclosure. All such documents are hereby incorporated herein by reference in their entirety for all purposes.
Equivalents
[0069] Various modifications of the invention and many further embodiments thereof, in addition to those shown and described herein, will become apparent to those skilled in the art from the full contents of this document, including references to the scientific and patent literature cited herein. The subject matter herein contains important information, exemplification and guidance that can be adapted to the practice of this invention in its various embodiments and equivalents thereof.