ARGINASE1 POLYPEPTIDES
20250205318 ยท 2025-06-26
Inventors
Cpc classification
C12N9/78
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
A61K38/50
HUMAN NECESSITIES
A61K40/11
HUMAN NECESSITIES
International classification
A61K38/50
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
C12N9/78
CHEMISTRY; METALLURGY
A61K40/11
HUMAN NECESSITIES
Abstract
The present invention relates to novel polypeptides which are derived from Arginase1. The invention also relates to polynucleotides encoding the polypeptides. The invention also relates to compositions comprising the polypeptides and polynucleotides. The invention also concerns uses of the polypeptides, polynucleotides, and compositions.
Claims
1. An isolated polynucleotide encoding a polypeptide fragment of Arginase 1 protein, wherein the polypeptide fragment consists of TABLE-US-00008 (SEQIDNO:1) ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
2. (canceled)
3. (canceled)
4. A composition comprising the polynucleotide of claim 1 or a vector comprising the polynucleotide of claim 1.
5. The composition according to claim 4, comprising at least one pharmaceutically acceptable diluent, carrier or preservative.
6. The composition according to claim 14 wherein the adjuvant is selected from the group consisting of bacterial DNA based adjuvants, oil/surfactant based adjuvants, viral dsRNA based adjuvants, imidazoquinolines, and a Montanide ISA adjuvant.
7. A method of treating or preventing a disease or condition in a subject, the method comprising administering to the subject the polynucleotide of claim 1, or a composition thereof; or vector comprising the polynucleotide of claim 1, or a composition thereof.
8. The method of claim 7 wherein the disease or condition is characterized at least in part by inappropriate or excessive immune suppressive function of an Arginase, and/or wherein said disease or condition is cancer.
9. The method of claim 7 wherein the disease or condition is cancer and optionally wherein the method further comprises the simultaneous or sequential administration of an additional cancer therapy, preferably an antibody.
10. The method of claim 7 wherein said cancer is breast, lung, colon or prostate cancer, or is a melanoma, or is a leukemia, preferably acute myeloid leukemia (AML).
11. (canceled)
12. (canceled)
13. A vector comprising the polynucleotide of claim 1.
14. The composition of claim 4, further comprising an adjuvant.
15. The composition of claim 14, comprising at least one pharmaceutically acceptable diluent, carrier or preservative.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0011]
[0012] IFN ELISPOT responses against ArgLong, ArgLong2 and ArgLong3 peptides in PBMCS from four healthy donors (HD). Bars represent the mean number of spots per well+standard error of the mean. Corresponding ELISPOT well images with and without the addition of peptides are also shown for each donor. Experiments were performed with 510.sup.5 PBMCs/well in triplicates. TNTCtoo numerous to count. *-p0.05 according to the distribution free resampling (DFR) rule.
[0013]
[0014] IFN ELISPOT responses against Arg.sub.171-190, Arg.sub.181-200, Arg.sub.191-210 and ArgLong2 in 19 healthy donors (top) and 16 cancer patients (bottom). Each dot represents an average number of peptide specific spots for a single patient/donor. Responses were calculated by subtracting the average spot count in control wells from the average spot count in peptide stimulated wells. Experiments performed with 4.5-510.sup.5 PBMCs/well for healthy donors and 2.2-510.sup.5 PBMCs/well for cancer patients, in triplicates or duplicates. Responses against ArgLong2 were too numerous to count (TNTC) in six healthy donors and 2 cancer patients and set to be >500 spots.
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022] Bars represent average spot counts in peptide stimulated and controls wells+SEM.
[0023]
[0024]
[0025]
[0026]
[0027]
[0028] 0.510.sup.6 MC38 tumour cells were inoculated subcutaneously on the right flank of 30 mice on day 0, as shown in
[0029]
[0030] 0.510.sup.6 B16F10 tumour cells were inoculated subcutaneously on the right flank of 30 mice on day 0, as shown in
[0031]
[0032]
[0033]
[0034] PBMCs were treated with either Arginase 1-inducing Th2 cytokine (IL-4/IL-13) or ArgLong2 peptide for 7 days before ArgLong2-specific T cells were quantified in vitro by IFN ELISPOT.
BRIEF DESCRIPTION OF THE SEQUENCES
[0035] SEQ ID NOs: 1-9 are each an amino acid sequence of a polypeptide derived from the region corresponding to positions 161-210 of full length human Arginase 1 or murine Arginase 1.
[0036] SEQ ID NOs: 10 and 11 are the amino acid sequences of full length human Arginase 1 and murine Arginase 1, respectively.
[0037] SEQ ID NO: 12 is the amino acid sequence of the region corresponding to positions 161-210 of full length human Arginase 1.
[0038] SEQ ID NO: 13 is the amino acid sequence of the region corresponding to positions 161-210 of full length murine Arginase 1.
DETAILED DESCRIPTION OF THE INVENTION
[0039] It is to be understood that different applications of the disclosed products and methods may be tailored to the specific needs in the art. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments of the invention only, and is not intended to be limiting.
[0040] In addition as used in this specification and the appended claims, the singular forms a, an, and the include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to a polypeptide includes polypeptides, and the like.
[0041] A polypeptide is used herein in its broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs, or other peptidomimetics. The term polypeptide thus includes short peptide sequences and also longer polypeptides and proteins. As used herein, the term amino acid refers to either natural and/or unnatural or synthetic amino acids, including both D or L optical isomers, and amino acid analogs and peptidomimetics.
[0042] The terms patient and subject are used interchangeably and typically refer to a human.
[0043] All publications, patents and patent applications cited herein, whether supra or infra, are hereby incorporated by reference in their entirety.
[0044] The present inventors have previously identified a 50 amino acid region of human and murine Arginase 1 which is a hot spot for immunogenicity. This region corresponds to positions 161-210 of full length human Arginase 1 (SEQ ID NO: 10) or full length murine Arginase 1 (SEQ ID NO: 11). The region and peptide fragments derived from it are described in WO2018065563. The present inventors have now identified that a polypeptide consisting of a specific contiguous amino acid sequence of this region is surprisingly immunogenic relative to other amino acid sequences from the same region.
[0045] By immunogenic herein it is meant that a polypeptide is capable of eliciting an immune response to the Arginase 1 protein, preferably when said protein is present in or on cells expressing the Arginase 1 protein. In other words, the polypeptide may be described as immunogenic to Arginase 1. The polypeptide may alternatively be described as an immunogenic fragment of Arginase 1. The immune response is preferably a T cell response. The immune response may be detected in at least one individual (or in sample taken from the individual) after administration of the polypeptide to said individual (or said sample).
[0046] A polypeptide may be identified as immunogenic using any suitable method, including in vitro methods. For example, a peptide may be identified as immunogenic if it has at least one of the following characteristics: [0047] (i) It is capable of eliciting IFN--producing cells in a PBL population of a healthy subject and/or a cancer patient as determined by an ELISPOT assay, and/or [0048] (ii) It is capable of in situ detection in a sample of tumor tissue of CTLs that are reactive with Arginase 1; and/or [0049] (iii) It is capable of inducing the in vitro growth of specific T-cells.
Methods suitable for determining whether a polypeptide is immunogenic active are also described in the Examples section below.
[0050] The polypeptide of the invention may consist of: [0051] the amino acid sequence corresponding to positions 169-206 of full length human Arginase 1. This polypeptide may be referred to herein as ArgLong2. Its sequence is provided as SEQ ID NO: 1. [0052] the amino acid sequence corresponding to positions 169-206 of full length murine Arginase 1. This polypeptide may be referred to herein as mArgLong2. Its sequence is provided as SEQ ID NO: 2. [0053] the amino acid sequence corresponding to positions 169-200 of full length human Arginase 1. This polypeptide may be referred to herein as ArgLong3. Its sequence is provided as SEQ ID NO: 3. [0054] the amino acid sequence corresponding to positions 169-200 of full length murine Arginase 1. This polypeptide may be referred to herein as mArgLong3. Its sequence is provided as SEQ ID NO: 4. [0055] the amino acid sequence corresponding to positions 169-210 of full length human Arginase 1. This polypeptide may be referred to herein as ArgLong. Its sequence is provided as SEQ ID NO: 5. [0056] the amino acid sequence corresponding to positions 169-210 of full length murine Arginase 1. This polypeptide may be referred to herein as mArgLong. Its sequence is provided as SEQ ID NO: 6.
[0057] The polypeptide preferably consists of the amino acid sequence of corresponding to positions 169-206 of full length human or murine Arginase 1, that is it consist of the amino acid sequence of SEQ ID NO: 1 or 2. That is, the polypeptide is preferably ArgLong2 or mArgLong2.
[0058] The polypeptide most preferably consists of the amino acid sequence of corresponding to positions 169-206 of full length human Arginase 1, that is it consists of the amino acid sequence of SEQ ID NO: 1. That is, the polypeptide is preferably ArgLong2.
[0059] In any polypeptide described herein, the amino acid sequence may be modified by one, two, three, four, or five (that is up to five) additions, deletions or substitutions, provided that a polypeptide having the modified sequence exhibits the same or increased immunogenicity to Arginase 1, as compared to a polypeptide having the unmodified sequence. By the same it is to be understood that the polypeptide of the modified sequence does not exhibit significantly reduced immunogenicity to Arginase 1 as compared to polypeptide of the unmodified sequence. Any comparison of immunogenicity between sequences is to be conducted using the same assay. Unless otherwise specified, modifications to a polypeptide sequence are preferably conservative amino acid substitutions. Conservative substitutions replace amino acids with other amino acids of similar chemical structure, similar chemical properties or similar side-chain volume. The amino acids introduced may have similar polarity, hydrophilicity, hydrophobicity, basicity, acidity, neutrality or charge to the amino acids they replace. Alternatively, the conservative substitution may introduce another amino acid that is aromatic or aliphatic in the place of a pre-existing aromatic or aliphatic amino acid. Conservative amino acid changes are well-known in the art and may be selected in accordance with the properties of the 20 main amino acids as defined in Table A1 below. Where amino acids have similar polarity, this can be determined by reference to the hydropathy scale for amino acid side chains in Table A2.
TABLE-US-00002 TABLE A1 Chemical properties of amino acids Ala (A) aliphatic, hydrophobic, neutral Met (M) hydrophobic, neutral Cys (C) polar, hydrophobic, neutral Asn (N) polar, hydrophilic, neutral Asp (D) polar, hydrophilic, charged () Pro (P) hydrophobic, neutral Glu (E) polar, hydrophilic, charged () Gln (Q) polar, hydrophilic, neutral Phe (F) aromatic, hydrophobic, neutral Arg (R) polar, hydrophilic, charged (+) Gly (G) aliphatic, neutral Ser (S) polar, hydrophilic, neutral His (H) aromatic, polar, hydrophilic, charged (+) Thr (T) polar, hydrophilic, neutral Ile (I) aliphatic, hydrophobic, neutral Val (V) aliphatic, hydrophobic, neutral Lys (K) polar, hydrophilic, charged (+) Tip (W) aromatic, hydrophobic, neutral Leu (L) aliphatic, hydrophobic, neutral Tyr (Y) aromatic, polar, hydrophobic
TABLE-US-00003 TABLE A2 Hydropathy scale Side Chain Hydropathy Ile 4.5 Val 4.2 Leu 3.8 Phe 2.8 Cys 2.5 Met 1.9 Ala 1.8 Gly 0.4 Thr 0.7 Ser 0.8 Trp 0.9 Tyr 1.3 Pro 1.6 His 3.2 Glu 3.5 Gln 3.5 Asp 3.5 Asn 3.5 Lys 3.9 Arg 4.5
[0060] In any polypeptide disclosed herein, any one or more of the following modifications may be made to improve physiochemical properties (e.g. stability), provided that the polypeptide exhibits the same or increased immunogenicity to Arginase 1, as compared to a polypeptide having the unmodified sequence: [0061] a) Replacement of the C terminal amino acid with the corresponding amide (may increase resistance to carboxypeptidases); [0062] b) Replacement of the N terminal amino acid with the corresponding acylated amino acid (may increase resistance to aminopeptidases); [0063] c) Replacement of one or more amino acids with the corresponding methylated amino acids (may improve proteolytic resistance); [0064] d) Replacement of one or more amino acids with the corresponding amino acid in D-configuration (may improve proteolytic resistance).
For the modification of types (c) and (d), a preferred example is the modification of the Tyr residue in the position corresponding to position 29 of SEQ ID NO: 1 (e.g. replace with N-methyl(Tyr) or replace with D configuration Tyr). This is because the Tyr appears immediately following a Lys residue at position 28, and is thus at a potential site for proteolysis by Trypsin-like proteases (which typically cleave after Lys).
[0065] Any polypeptide disclosed herein may have attached at the N and/or C terminus at least one additional moiety to improve solubility, stability and/or to aid with manufacture/isolation, provided that the polypeptide exhibits the same or increased immunogenicity to Arginase 1, as compared to a polypeptide lacking the additional moiety. Suitable moieties include hydrophilic amino acids. For example, the amino acid sequences KK, KR or RR may be added at the N terminus and/or C terminus. Other suitable moieties include Albumin or PEG (Polyethylene Glycol).
[0066] A polypeptide as disclosed herein may be produced by any suitable means. For example, the polypeptide may be synthesised directly using standard techniques known in the art, such as Fmoc solid phase chemistry, Boc solid phase chemistry or by solution phase peptide synthesis. Alternatively, a polypeptide may be produced by transforming a cell, typically a bacterial cell, with a nucleic acid molecule or vector which encodes said polypeptide. The invention provides nucleic acid molecules and vectors which encode a polypeptide of the invention. The invention also provides a host cell comprising such a nucleic acid or vector.
[0067] The terms nucleic acid molecule and polynucleotide are used interchangeably herein and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Non-limiting examples of polynucleotides include a gene, a gene fragment, messenger RNA (mRNA), cDNA, recombinant polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. A polynucleotide of the invention may be provided in isolated or substantially isolated form. By substantially isolated, it is meant that there may be substantial, but not total, isolation of the polypeptide from any surrounding medium. The polynucleotides may be mixed with carriers or diluents which will not interfere with their intended use and still be regarded as substantially isolated. A nucleic acid sequence which encodes a selected polypeptide is a nucleic acid molecule which is transcribed (in the case of DNA) and translated (in the case of mRNA) into a polypeptide in vivo when placed under the control of appropriate regulatory sequences, for example in an expression vector. The boundaries of the coding sequence are determined by a start codon at the 5 (amino) terminus and a translation stop codon at the 3 (carboxy) terminus. For the purposes of the invention, such nucleic acid sequences can include, but are not limited to, cDNA from viral, prokaryotic or eukaryotic mRNA, genomic sequences from viral or prokaryotic DNA or RNA, and even synthetic DNA sequences. A transcription termination sequence may be located 3 to the coding sequence.
[0068] Polynucleotides can be synthesised according to methods well known in the art, as described by way of example in Sambrook et al (1989, Molecular Cloninga laboratory manual; Cold Spring Harbor Press). The nucleic acid molecules of the present invention may be provided in the form of an expression cassette which includes control sequences operably linked to the inserted sequence, thus allowing for expression of the polypeptide of the invention in vivo. These expression cassettes, in turn, are typically provided within vectors (e.g., plasmids or recombinant viral vectors). Such an expression cassette may be administered directly to a host subject. Alternatively, a vector comprising a polynucleotide of the invention may be administered to a host subject. Preferably the polynucleotide is prepared and/or administered using a genetic vector. A suitable vector may be any vector which is capable of carrying a sufficient amount of genetic information, and allowing expression of a polypeptide of the invention.
[0069] The present invention thus includes expression vectors that comprise such polynucleotide sequences. Such expression vectors are routinely constructed in the art of molecular biology and may for example involve the use of plasmid DNA and appropriate initiators, promoters, enhancers and other elements, such as for example polyadenylation signals which may be necessary, and which are positioned in the correct orientation, in order to allow for expression of a peptide of the invention. Other suitable vectors would be apparent to persons skilled in the art. By way of further example in this regard we refer to Sambrook et al.
[0070] The invention also includes cells that have been modified to express a polypeptide of the invention. Such cells typically include prokaryotic cells such as bacterial cells, for example E. coli. Such cells may be cultured using routine methods to produce a polypeptide of the invention.
[0071] The polypeptide of the invention may be in a substantially isolated form. It may be mixed with carriers, preservatives, or diluents (discussed below) which will not interfere with the intended use, and/or with an adjuvant (also discussed below) and still be regarded as substantially isolated. It may also be in a substantially purified form, in which case it will generally comprise at least 90%, e.g. at least 95%, 98% or 99%, of the protein in the preparation.
Compositions Comprising Polypeptides or Polynucleotides
[0072] In another aspect, the present invention provides a composition comprising a polypeptide of the invention. The present invention also provides a composition comprising a polynucleotide encoding a polypeptide of the invention. For example, the invention provides a composition comprising one or more polypeptides of the invention, and at least one pharmaceutically acceptable carrier, preservative or excipient. Alternatively, the invention provides a composition comprising one or more polynucleotides encoding a polypeptide of the invention, and at least one pharmaceutically acceptable carrier, preservative or excipient. The carrier, preservative and excipient must be acceptable in the sense of being compatible with the other ingredients of the composition and not deleterious to a subject to which the composition is administered. Typically, all components and the final composition are sterile and pyrogen free. The composition may be a pharmaceutical composition. The composition may preferably comprise an adjuvant.
[0073] Adjuvants are any substance whose admixture into the composition increases or otherwise modifies the immune response elicited by the composition. Adjuvants, broadly defined, are substances which promote immune responses. Adjuvants may also preferably have a depot effect, in that they also result in a slow and sustained release of an active agent from the administration site. A general discussion of adjuvants is provided in Goding, Monoclonal Antibodies: Principles & Practice (2nd edition, 1986) at pages 61-63.
[0074] Adjuvants may be selected from the group consisting of: AlK(SO4)2, AlNa(SO4)2, AlNH4 (SO4), silica, alum, Al(OH)3, Ca3 (PO4)2, kaolin, carbon, aluminum hydroxide, muramyl dipeptides, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-DMP), N-acetyl-nomuramyl-L-alanyl-D-isoglutamine (CGP 11687, also referred to as nor-MDP), N-acetylmuramyul-L-alanyl-D-isoglutaminyl-L-alanine-2-(12-dipalmitoyl-sn-glycero-3-hydroxphosphoryloxy)-ethylamine (CGP 19835A, also referred to as MTP-PE), RIBI (MPL+TDM+CWS) in a 2% squalene/Tween-80 emulsion, lipopolysaccharides and its various derivatives, including lipid A, Freund's Complete Adjuvant (FCA), Freund's Incomplete Adjuvants, Merck Adjuvant 65, polynucleotides (for example, poly IC and poly AU acids), wax D from Mycobacterium, tuberculosis, substances found in Corynebacterium parvum, Bordetella pertussis, and members of the genus Brucella, Titermax, ISCOMS, Quil A, ALUN (see U.S. Pat. Nos. 58,767 and 5,554,372), Lipid A derivatives, choleratoxin derivatives, HSP derivatives, LPS derivatives, synthetic peptide matrixes or GMDP, Interleukin 1, Interleukin 2, Montanide ISA-51 and QS-21. Various saponin extracts have also been suggested to be useful as adjuvants in immunogenic compositions. Granulocyte-macrophage colony stimulating factor (GM-CSF) may also be used as an adjuvant.
[0075] Preferred adjuvants to be used with the invention include oil/surfactant based adjuvants such as Montanide adjuvants (available from Seppic, Belgium), preferably Montanide ISA-51. Other preferred adjuvants are bacterial DNA based adjuvants, such as adjuvants including CpG oligonucleotide sequences. Yet other preferred adjuvants are viral dsRNA based adjuvants, such as poly I:C. GM-CSF and Imidazochinilines are also examples of preferred adjuvants.
[0076] The adjuvant is most preferably a Montanide ISA adjuvant. The Montanide ISA adjuvant is preferably Montanide ISA 51 or Montanide ISA 720.
[0077] In Goding, Monoclonal Antibodies: Principles & Practice (2nd edition, 1986) at pages 61-63 it is also noted that, when an antigen of interest is of low molecular weight, or is poorly immunogenic, coupling to an immunogenic carrier is recommended. A polypeptide of the invention may therefore be coupled to a carrier. A carrier may be present independently of an adjuvant. The function of a carrier can be, for example, to increase the molecular weight of a polypeptide fragment in order to increase activity or immunogenicity, to confer stability, to increase the biological activity, or to increase serum half-life. Furthermore, a carrier may aid in presenting the polypeptide or fragment thereof to T-cells. Thus, in the composition, the polypeptide may be associated with a carrier such as those set out below.
[0078] The carrier may be any suitable carrier known to a person skilled in the art, for example a protein or an antigen presenting cell, such as a dendritic cell (DC). Carrier proteins include keyhole limpet hemocyanin, serum proteins such as transferrin, bovine serum albumin, human serum albumin, thyroglobulin or ovalbumin, immunoglobulins, or hormones, such as insulin or palmitic acid. Alternatively the carrier protein may be tetanus toxoid or diphtheria toxoid. Alternatively, the carrier may be a dextran such as sepharose. The carrier must be physiologically acceptable to humans and safe.
[0079] If the composition comprises an excipient, it must be pharmaceutically acceptable in the sense of being compatible with the other ingredients of the composition and not deleterious to the recipient thereof. Auxiliary substances, such as wetting or emulsifying agents, pH buffering substances and the like, may be present in the excipient. These excipients and auxiliary substances are generally pharmaceutical agents that do not induce an immune response in the individual receiving the composition, and which may be administered without undue toxicity. Pharmaceutically acceptable excipients include, but are not limited to, liquids such as water, saline, polyethyleneglycol, hyaluronic acid, glycerol and ethanol. Pharmaceutically acceptable salts can also be included therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. A thorough discussion of pharmaceutically acceptable excipients, vehicles and auxiliary substances is available in Remington's Pharmaceutical Sciences (Mack Pub. Co., N.J. 1991).
[0080] Formulation of a suitable composition can be carried out using standard pharmaceutical formulation chemistries and methodologies all of which are readily available to the reasonably skilled artisan. Such compositions may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Injectable compositions may be prepared, packaged, or sold in unit dosage form, such as in ampoules or in multi-dose containers optionally containing a preservative. Compositions include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations. In one embodiment of a composition, the active ingredient is provided in dry (for e.g., a powder or granules) form for reconstitution with a suitable vehicle (e. g., sterile pyrogen-free water) prior to administration of the reconstituted composition. The composition may be prepared, packaged, or sold in the form of a sterile injectable aqueous or oily suspension or solution. This suspension or solution may be formulated according to the known art, and may comprise, in addition to the active ingredient, additional ingredients such as the adjuvants, excipients and auxiliary substances described herein. Such sterile injectable formulations may be prepared using a non-toxic parenterally-acceptable diluent or solvent, such as water or 1,3-butane diol, for example. Other acceptable diluents and solvents include, but are not limited to, Ringer's solution, isotonic sodium chloride solution, and fixed oils such as synthetic mono- or di-glycerides. Other compositions which are useful include those which comprise the active ingredient in microcrystalline form, in a liposomal preparation, or as a component of a biodegradable polymer systems. Compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials such as an emulsion, an ion exchange resin, a sparingly soluble polymer, or a sparingly soluble salt. Alternatively, the active ingredients of the composition may be encapsulated, adsorbed to, or associated with, particulate carriers. Suitable particulate carriers include those derived from polymethyl methacrylate polymers, as well as PLG microparticles derived from poly(lactides) and poly(lactide-co-glycolides). See, e.g., Jeffery et al. (1993) Pharm. Res. 10:362-368. Other particulate systems and polymers can also be used, for example, polymers such as polylysine, polyarginine, polyomithine, spermine, spermidine, as well as conjugates of these molecules.
Methods of Use
[0081] The polypeptide, polynucleotide or composition of the invention may be used in a method of treating or preventing a disease or condition in a subject. The polypeptide, polynucleotide or composition of the invention may be used in the manufacture of a medicament for use in a method of treating or preventing a disease or condition in a subject. The method comprises administering to the said subject the said polypeptide, the said polynucleotide or the said composition. Administration may be of a therapeutically or prophylactically effective quantity of the said polypeptide, the said polynucleotide or the said composition, to a subject in need thereof.
[0082] The disease or condition may be characterized at least in part by inappropriate or excessive immune suppressive function of Arginase 1. The disease or condition may be a cancer, preferably a cancer which expresses Arginase 1 and/or which is associated with inappropriate or excessive immune suppressive function of Arginase 1. The cancer may be breast, lung, colon or prostate cancer, or may be a leukemia, preferably acute myeloid leukemia (AML), or may be a melanoma.
[0083] The method may comprise simultaneous or sequential administration with an additional cancer therapy. The additional cancer therapy may be selected from a cytokine therapy, a T-cell therapy, an NK therapy, an immune system checkpoint inhibitor, chemotherapy, radiotherapy, immunostimulating substances, gene therapy, or an antibody.
[0084] The antibody may be Abagovomab, Abciximab, Actoxumab, Adalimumab, Adecatumumab, Afelimomab, Afutuzumab, Alacizumab pegol, ALD518, Alemtuzumab, Alirocumab, Altumomab pentetate, Amatuximab, Anatumomab mafenatox, Anrukinzumab, Apolizumab, Arcitumomab, Aselizumab, Atinumab, Atlizumab (=tocilizumab), Atorolimumab, Bapineuzumab, Basiliximab, Bavituximab, Bectumomab, Belimumab, Benralizumab, Bertilimumab, Besilesomab, Bevacizumab, Bezlotoxumab, Biciromab, Bimagrumab, Bivatuzumab mertansine, Blinatumomab, Blosozumab, Brentuximab vedotin, Briakinumab, Brodalumab, Canakinumab, Cantuzumab mertansine, Cantuzumab ravtansine, Caplacizumab, Capromab pendetide, Carlumab, Catumaxomab, CC49, Cedelizumab, Certolizumab pegol, Cetuximab, Ch.14.18, Citatuzumab bogatox, Cixutumumab, Clazakizumab, Clenoliximab, Clivatuzumab tetraxetan, Conatumumab, Concizumab, Crenezumab, CR6261, Dacetuzumab, Daclizumab, Dalotuzumab, Daratumumab, Demcizumab, Denosumab, Detumomab, Dorlimomab aritox, Drozitumab, Duligotumab, Dupilumab, Dusigitumab, Ecromeximab, Eculizumab, Edobacomab, Edrecolomab, Efalizumab, Efungumab, Elotuzumab Elsilimomab, Enavatuzumab, Enlimomab pegol, Enokizumab, Enoticumab, Ensituximab, Epitumomab cituxetan, Epratuzumab, Erlizumab, Ertumaxomab, Etaracizumab, Etrolizumab, Evolocumab, Exbivirumab, Fanolesomab, Faralimomab Farletuzumab, Fasinumab, FBTA05, Felvizumab, Fezakinumab, Ficlatuzumab, Figitumumab, Flanvotumab, Fontolizumab, Foralumab, Foravirumab, Fresolimumab, Fulranumab, Futuximab, Galiximab, Ganitumab, Gantenerumab, Gavilimomab, Gemtuzumab ozogamicin, Gevokizumab, Girentuximab, Glembatumumab vedotin, Golimumab, Gomiliximab, GS6624, Ibalizumab, Ibritumomab tiuxetan, Icrucumab, Igovomab, Imciromab, Imgatuzumab, Inclacumab, Indatuximab ravtansine, Infliximab, Intetumumab, Inolimomab, Inotuzumab ozogamicin, Ipilimumab, Iratumumab, Itolizumab, Ixekizumab, Keliximab, Labetuzumab, Lampalizumab, Lebrikizumab, Lemalesomab, Lerdelimumab, Lexatumumab, Libivirumab, Ligelizumab, Lintuzumab, Lirilumab, Lodelcizumab, Lorvotuzumab mertansine, Lucatumumab, Lumiliximab, Mapatumumab, Maslimomab, Mavrilimumab, Matuzumab, Mepolizumab, Metelimumab, Milatuzumab, Minretumomab, Mitumomab, Mogamulizumab, Morolimumab, Motavizumab, Moxetumomab pasudotox, Muromonab-CD3, Nacolomab tafenatox, Namilumab, Naptumomab estafenatox, Namatumab, Natalizumab, Nebacumab, Necitumumab, Nerelimomab, Nesvacumab, Nimotuzumab, Nivolumab, Nofetumomab merpentan, Obinutuzumab, Ocaratuzumab, Ocrelizumab, Odulimomab, Ofatumumab, Olaratumab, Olokizumab, Omalizumab, Onartuzumab, Oportuzumab monatox, Oregovomab, Orticumab, Otelixizumab, Oxelumab, Ozanezumab, Ozoralizumab, Pagibaximab, Palivizumab, Panitumumab, Panobacumab, Parsatuzumab, Pascolizumab, Pateclizumab, Patritumab, Pemtumomab, Perakizumab, Pertuzumab, Pexelizumab, Pidilizumab, Pinatuzumab vedotin, Pintumomab, Placulumab, Polatuzumab vedotin, Ponezumab, Priliximab, Pritoxaximab, Pritumumab, PRO 140, Quilizumab, Racotumomab, Radretumab, Rafivirumab, Ramucirumab, Ranibizumab, Raxibacumab, Regavirumab, Reslizumab, Rilotumumab, Rituximab, Robatumumab, Roledumab, Romosozumab, Rontalizumab, Rovelizumab, Ruplizumab, Samalizumab, Sarilumab, Satumomab pendetide, Secukinumab, Seribantumab, Setoxaximab, Sevirumab, Sibrotuzumab, Sifalimumab, Siltuximab, Simtuzumab, Siplizumab, Sirukumab, Solanezumab, Solitomab, Sonepcizumab, Sontuzumab, Stamulumab, Sulesomab, Suvizumab, Tabalumab, Tacatuzumab tetraxetan, Tadocizumab, Talizumab, Tanezumab, Taplitumomab paptox, Tefibazumab, Telimomab aritox, Tenatumomab, Teneliximab, Teplizumab, Teprotumumab, TGN1412, Ticilimumab (=tremelimumab), Tildrakizumab, Tigatuzumab, TNX-650, Tocilizumab (=atlizumab), Toralizumab, Tositumomab, Tralokinumab, Trastuzumab, TRBS07, Tregalizumab, Tremelimumab Tucotuzumab celmoleukin, Tuvirumab, Ublituximab, Urelumab, Urtoxazumab, Ustekinumab, Vapaliximab, Vatelizumab, Vedolizumab, Veltuzumab, Vepalimomab Vesencumab, Visilizumab, Volociximab, Vorsetuzumab mafodotin, Votumumab, Zalutumumab, Zanolimumab, Zatuximab, Ziralimumab or Zolimomab aritox.
[0085] Preferred antibodies include Natalizumab, Vedolizumab, Belimumab, Atacicept, Alefacept, Otelixizumab, Teplizumab, Rituximab, Ofatumumab, Ocrelizumab, Epratuzumab, Alemtuzumab, Abatacept, Eculizumab, Omalizumab, Canakinumab, Meplizumab, Reslizumab, Tocilizumab, Ustekinumab, Briakinumab, Etanercept, Inlfliximab, Adalimumab, Certolizumab pegol, Golimumab, Trastuzumab, Gemtuzumab, Ozogamicin, Ibritumomab, Tiuxetan, Tostitumomab, Cetuximab, Bevacizumab, Panitumumab, Denosumab, Ipilimumab, Brentuximab and Vedotin.
[0086] Particularly preferred antibodies that may be used in the method of the invention include: daratumumab, nivolumab, pembrolizumab, avelumab, rituximab, trastuzumab, pertuzumab, alemtuzumab, cetuximab, panitumumab, tositumomab and ofatumumab. Daratumumab is especially preferred.
[0087] The additional cancer therapy may be selected from the group consisting of Actimide, Azacitidine, Azathioprine, Bleomycin, Carboplatin, Capecitabine, Cisplatin, Chlorambucil, Cyclophosphamide, Cytarabine, Dauno-rubicin, Docetaxel, Doxifluridine, Doxorubicin, Epirubicin, Etoposide, Fludarabine, Fluor-ouracil, Gemcitabine, Hydroxyurea, Idarubicin, Irinotecan, Lenalidomide, Leucovorin, Mechlorethamine, Melphalan, Mercaptopurine, Methotrexate, Mitoxantrone, Oxaliplatin, Paclitaxel, Pemetrexed, Revlimid, Temozolomide, Teniposide, Thioguanine, Valrubicin, Vinblastine, Vincristine, Vindesine and Vinorelbine.
[0088] The polypeptide or composition of the invention may also be used in a method of stimulating Arginase 1-specific T cells, such as CD4 and CD8 T-cells, comprising contacting cells with the said polypeptide or composition. The method may be conducted ex vivo. The cells may be present in a sample taken from a healthy subject or from a cancer patient, such as in a tumour sample.
[0089] The present invention is further illustrated by the following examples that, however, are not to be construed as limiting the scope of protection. The features disclosed in the foregoing description and in the following examples may, both separately and in any combination thereof, be material for realizing the invention in diverse forms thereof.
Example 1
Materials and Methods
Patient Material
[0090] PBMCs from healthy donors were isolated using density gradient separation over Lymphoprep (STEMCELL Technologies) and cryopreserved at 150 C. in FBS supplemented with 10% DMSO. PBMCs from cancer patients were isolated from blood sample a minimum of four weeks after the termination of any anti-cancer therapy. The protocol was approved by the Scientific Ethics Committee for The Capital Region of Denmark and conducted in accordance with the provisions of the Declaration of Helsinki. Written informed consent from the patients was obtained before study entry.
Peptides
[0091] Peptides were synthesized by standard methods and provided dissolved in DMSO to obtain a stock concentration of 10 mM. The sequences of the peptides used in these experiments are shown in full below in alignment with each other, and are also set out in the section entitled Sequences). Peptides are described by SEQ ID NO, by name, or by reference to the start and end positions of each peptide sequence within the full length sequence of Arginase 1. Each may be used interchangeably. For example, the peptide of SEQ ID NO: 1 may alternatively be referred to by the name ArgLong2, or may alternatively be referred to as Arg169-206 (given a start position of 169 and end position of 206). The intended reference in each case will be clear from the context.
TABLE-US-00004 Longerpeptidesequences: ArgLong: ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGK ArgLong2: ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL ArgLong3: ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSM 20-merpeptides: Arg.sub.171-190: AKDIVYIGLRDVDPGEHYIL Arg.sub.181-200: DVDPGEHYILKTLGIKYFSM Arg.sub.191-210: KTLGIKYFSMTEVDRLGIGK
ELISPOT Assay
[0092] For in vitro ELISPOT, PBMCs from cancer patients and healthy donors were pulsed with 20 M of Arginase 1-derived peptides and 120 U/ml IL-2 in 24-well plates for 7 days before being used in an ELISPOT assay. The cells were placed in 96-well nitrocellulose ELISPOT plates (MultiScreen MAIP N45; Millipore) pre-coated with IFN capture antibody (Mabtech). Arginase peptides added to a final concentration of 5 M and plates incubated at 37 C. for 14-16 hours. After the incubation the cells were washed off and secondary biotinylated Ab (Mabtech, cat. 3420-6-1000) was added for 2 hours at room temperature. Unbound secondary antibody was washed off and streptavidin conjugated alkaline phosphatase (AP) (Mabtech, cat. 3310-10) was added for 1 hour at room temperature. Unbound conjugated enzyme was washed off and the assay was developed by adding BCIP/NBT substrate (Mabtech, cat. 3650-10). Developed ELISPOT plates were analyzed on CTL ImmunoSpot S6 Ultimate-V analyzer using Immunospot software v5.1. Responses were reported as the difference between average numbers of spots in wells stimulated with Arginase 1 and wells without added peptide.
[0093] To check for IL-4 induced Arg1 responses, PBMCs were stimulated with IL-4 (100 or 50 U/ml) and/or IL-2 (120 or 60 U/ml) for a week before being set up in the ELISPOT assay as described above.
Intracellular Staining
[0094] Intracellular staining of cell cultures was performed after PBMCs were stimulated with arginase-derived peptides for 5 hours in the presence of BD GolgiPlug (added after the first hour of peptide stimulation). Stimulated cells were stained with fluorescently labeled antibodies for surface markers (CD3, CD4, CD8) and thereafter permeabilized by using Fixation/Permeabilization and Permeabilization Buffer (eBioscience, cat. 00-5123-43), according to manufacturer's instructions. Permeabilized cells were then stained with fluorochrome-labeled antibodies for IFN and TNF. Flow cytometry analysis was performed on a FACSCanto II (BD Biosciences). Antibodies used: IFN-APC (cat.341117), TNF-455 BV421 (cat.562783), CD4-FITC (cat.347413), CD8-PerCP (cat.345774), CD3-APC-H7 (cat. 560275) (all from BD Biosciences), dead cells stain-FVS510 (564406, BD Biosciences) according to manufacturer's instructions.
Memory T Cell Sorting
[0095] CD4+ and CD8+ memory T cells were sorted from freshly thawed healthy donor or cancer patient PBMC samples using magnetic bead sorting kits: Memory CD4+ T Cell Isolation Kit, human (cat. 130-091-893, Miltenyi Biotec) and CD8+ Memory T Cell Isolation Kit, human (cat. 130-094-412, Miltenyi Biotec). The purity of isolated cells was assessed by staining for CD4-FITC, CD8-PerCP, CD45RO-PE (all from BD Biosciences), dead cells were stained using LIVE/DEAD Fixable Near-IR Dead Cell Stain Kit (Invitrogen, ThermoFisher Scientific).
Results
Arginase 1 Peptide Length Determines the Efficiency of T Cell Stimulation
[0096] Based on the previously identified 50-amino acid long Arg1 hotspot region at positions 161-210 of Arginase 1, three different peptides that covered the major part this region were chosen, which also excluded the cysteine at position 168 of Arginase 1 (expected to improve manufacturability, solubility and stability). The three peptides were: 42-mer ArgLong (positions 169-210), 38-mer ArgLong2 (positions 169-206) and 32-mer ArgLong3 (positions 169-200).
[0097] To test whether these peptides could be used to identify Arginase 1 responses, PBMCs from 6 healthy donors were screened for responses in IFN ELISPOT. PBMCs were stimulated with ArgLong2 peptide and low dose IL-2 for 1 week prior to ELISPOT. Despite the similarities in sequence, the ArgLong2 peptide appeared to be superior at stimulating T cell responses in IFN ELISPOT. As shown in
[0098] ArgLong2 is only 4 amino acids shorter than ArgLong and 6 amino acids longer than ArgLong3. This suggests that the peptide length and sequence may play a crucial role in ensuring optimal processing and presentation of arginase peptides. As a consequence, it may have an effect on the ability of such peptides to activate Arg1 specific T cells.
[0099] To determine whether the ArgLong2 peptide is comparable to previously described individual 20-mer peptides covering the same sequence (see WO2018065563 Examples 1, 2 and 3), PBMCs from 19 healthy donors and 16 cancer patients (8 melanoma, 6 multiple myeloma, 1 breast cancer and 1 renal cell carcinoma) were screened for responses against three 20-mer peptides and the 38-mer ArgLong2. In both cancer patients and healthy donors, ArgLong2 produced the most responses compared to all three 20-mer peptides (see
CD4+ and CD8+ Responses Against Arginase 1
[0100] Previously described T cell responses against 20-mer Arg1 peptides have shown predominantly CD4+ T cell responses in cancer patients and healthy donors (see WO2018065563 Example 2). Since the ArgLong2 peptide appeared to be more efficiently processed and subsequently recognized by T cells, the type of T cell responses to ArgLong2 was investigated by intracellular staining.
[0101] PBMCs from two healthy donors (HD384, HD400) and one breast cancer patient (BD30) that had previously shown strong responses against ArgLong2 in ELISPOT were tested by intracellular staining one week after in vitro stimulation with ArgLong2 and low dose IL-2. Remarkably, both CD4+ and CD8+ T cell responses against ArgLong2 peptide were identified in the cancer patient and healthy donors. Both CD4+ responses (left panel of
[0102] Interestingly, detectable CD4+ and CD8+ responses against ArgLong2 were also seen in intracellular staining of PBMCs without prior peptide stimulation. PBMCs from two cancer patients (one malignant melanoma (MM27) and one breast cancer (BC30)) were thawed and directly tested for responses against ArgLong2 peptide in ex vivo intracellular staining. We were able to detect ex vivo CD4+ responses in PBMCs from both cancer patients (
Memory CD4+ and CD8+ Responses Against Arginase 1
[0103] Strong responses seen against ArgLong2 indicated that the frequencies of Arg1-specific T cells could be more commonly detectable in PBMCs without any prior peptide stimulation. PBMCs from 4 healthy donors and 2 cancer patients (1 breast cancer and 1 malignant melanoma) that had shown strong responses in in vitro ELISPOT were directly tested for responses to ArgLong2 peptide in ex vivo IFN ELISPOT. We found significant spontaneous responses in all 6 donors (See
[0104] Presence of strong spontaneous ex vivo responses against ArgLong2 peptide in PBMCs of healthy donors and cancer patient suggested that Arginase 1-specific cells are a natural part of the immune system. To test that CD4+ and CD8+ memory T cells were sorted from PBMCs of cancer patients and healthy donors that had shown a strong spontaneous immune response ex vivo. CD4+ or CD8+ memory T cells were sorted from PBMCs of 4 healthy donors and 2 cancer patients using magnetic bead sorting and set up in ex vivo IFN ELISPOT. The purity of memory T cell isolation was confirmed by flow cytometric analysis for CD4+CD45RO+ and CD8+CD45RO+ T cells and was determined to be >95%. We found CD4+ memory responses against ArgLong2 peptide in 2 cancer patients and 3 healthy donors (see
IL4 Upregulated Arginase 1 Expression Increases T Cell Responses Against ArgLong2
[0105] Since Arg1-specific CD4+ and CD8+ memory T cells are present in both cancer patients and healthy donors, it was tested whether these T cells could be involved in immune regulation in response to upregulated Arg1 expression. Arg1 has been previously described to be upregulated in myeloid cells in response to IL-4.
[0106] First, PBMCs from a single melanoma patient that had previously been shown to have a strong spontaneous against ArgLong2 peptide response ex vivo were tested. The PBMCs were thawed and stimulated with IL-4, (50 U/ml or 100 U/ml), IL-2 (120 U/ml) or a combination of IL-4 and IL-2 (50 U/ml and 60 U/ml respectively) for one week before being tested in IFN ELISPOT for responses against ArgLong2. Non-stimulated cells were used as control. Strong significant responses were seen in all IL-4 stimulated groups: highest responses were seen against IL-4 stimulated groups as compared to no stimulation or stimulation with IL-2 alone, suggesting that Arg1 specific T cells are activated in response to upregulated Arg1 expression. See
[0107] Next, PBMCs from 2 cancer patients (BC30 (breast cancer), MM27 (malignant melanoma)) and 6 healthy donors that had previously shown strong spontaneous ex vivo responses against ArgLong2 were stimulated with either low dose IL-2 (120 U/ml) or IL-4 (100 U/ml) for 7 days. Non-stimulated cells were used as control. After 7 days in culture, PBMCs were tested for reactivity against ArgLong2 in IFN ELISPOT. 6 out of 8 cultures showed increase responses against ArgLong2 in IL-4 stimulated cultures compared to unstimulated and IL-2 stimulated controls, further confirming the possible common mechanism of Arg1specific T cell activation in vivo. See
DISCUSSION
[0108] The existence of Arg1 specific T cells has been previously described. Such T cells may be called anti-Tregs due to their role in targeting immune regulatory proteins. Anti-Treg responses against other immune regulatory proteins, such as PD-L1 and IDO have also been described. The above experiments demonstrate that Arginase 1 specific anti-Tregs are not only spontaneously present in cancer patients and healthy donors but also exist as part of memory T-cell repertoire, as responses against ArgLong2 peptide were seen in isolated CD4+ and CD8+ memory T cell populations.
[0109] In order to keep the immune balance, regulatory immune cells, e.g., Tregs, different dendritic cell subtypes, myeloid derived suppressor cells, and M2 macrophages suppress or terminate immune responses. This regulatory arm secures unresponsiveness or tolerance to self-antigens. Regulatory immune cells suppress immunity through a number of different cellular and extracellular factors. In contrast, specific anti-Tregs recognizing HLA-restricted derived epitopes which are generated from intracellular degraded antigens are able directly to eliminate regulatory immune cells. In addition, anti-Tregs can boost local immune activation by the secretion of effector cytokines.
[0110] T.sub.H2-driven lung inflammation increases Arginase 1 expression in myeloid cells. Especially, IL-4, the prototypical inducer of the macrophage M2 phenotype, induced Arginase 1 upregulation. It has been shown here that Arginase 1-specific T cells are activated in response to the T.sub.H2 cytokine IL-4. Hence, this suggests that Arginase 1 specific T.sub.H1 cells infiltrate IL-4 increased environments and drive the immune response back into the T.sub.H1 pathway, which could be an important role of Arginase 1 specific anti-Tregs in controlling the immune inhibition and promoting inflammation. However, Arginase 1-specific anti-Tregs themselves are hampered by the suppressive effects of Arginase 1 expressing regulatory immune cells. Thus, in immune regulatory networks, Arginase 1 specific anti-Tregs suppress the function of Arginase 1+ regulatory immune cells and vice versa. Hence, under normal physiological conditions equilibrium between immune activation and suppression may be necessary to maintain immune homeostasis.
[0111] The findings of memory T cells specific for Arginase 1 in healthy individuals, which are expanded in response to IL-4, is in line with previously findings regarding IDO and PD-L1 specific anti-Tregs. Circulating IDO- or PD-L1 specific anti-Tregs have been identified as present in healthy donors, although detection was not as frequent as detection in patients with cancer. Additionally, it has been found that the pro-inflammatory cytokines IL-2 and IFN-, which are known to induce IDO and PD-L1, expand populations of IDO- or PD-L1 specific T cells among human PBMCs without additional stimulation.
[0112] Expression of Arginase 1 in the tumor microenvironment by immune suppressive myeloid cells inhibits anti-tumor T cell responses through L-arginine depletion. In an Arginase 1 positive environment T cells cannot proliferate, and a promising therapeutic strategy is thus to reconstitute the adaptive immune responses by the activation of pro-inflammatory Arginase 1-specific T cells. Activation of Arginase 1-specific anti-Tregs by peptide vaccination offers a novel approach at targeting of a specific immune inhibitory mechanism in cancer.
Developing new immune-therapeutic approaches in cancer treatment is likely to be most efficient and versatile when common suppressive mechanisms are targeted. As shown in these experiments. Arginase 1-specific anti-Tregs exist as a natural part of the immune system and can be readily employed to tilt the balance away from immune suppression in cancer.
[0113] The peptide ArgLong2, which covers the majority of the previously described Arginase 1 hotspot region, has been shown to be particularly efficient at stimulating arginase-specific CD4+ and CD8+ T cell responses as compared to similar peptides of different lengths. ArgLong2 therefore has particularly high likelihood for success in a vaccination setting, given its potential to stimulate Arginase 1-specific anti-Tregs which may exert both effector and helper functions in the tumor microenvironment.
Example 2Design of Additional Peptides
[0114] In order to design peptides suitable for use in vaccination experiments in mice, and which may also be functional in humans, the sequence of murine Arginase 1 (SEQ ID NO: 11) was compared to the human Arginase 1 sequence of SEQ ID NO: 10. The level of similarity is particularly high in the hotspot region of human Arginase 1 corresponding to positions 161-210 of SEQ ID NO: 1. An alignment of this region and the corresponding region in murine Arginase 1 is also shown below:
TABLE-US-00005 hArg1: (SEQIDNO:12) GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGK mArg1: (SEQIDNO:13) GFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGK
[0115] Only 2 residues of the 50 differ, shown as bold and underlined. A leucine in the human sequence is substituted for the highly similar aliphatic amino acid isoleucine in the mouse, and an arginine in the human sequence is substituted for the similarly basic lysine in the mouse. Both changes are conservative. Accordingly the hotspot region is highly conserved between humans and mice. Polypeptides of the invention therefore include polypeptides which consist of a particular human sequence from the hotspot region, but in which the substitutions for the corresponding mouse sequence are made. For example, SEQ ID NO: 2 corresponds to SEQ ID NO:1 but with both the above-mentioned leucine-isoleucine and arginine-lysine substitutions. The polypeptide consists of SEQ ID NO: 2 may be referred to herein as mArgLong2. Similarly, SEQ ID NO: 4 corresponds to SEQ ID NO: 3 but with the above-mentioned leucine-isoleucine substitution. The polypeptide consisting of SEQ ID NO: 2 may be referred to herein as mArgLong3. Similarly, SEQ ID NO: 6 corresponds to SEQ ID NO: 5 but with both the above-mentioned leucine-isoleucine and arginine-lysine substitutions. The polypeptide consisting of SEQ ID NO: 6 may be referred to herein as mArgLong. The murine peptides are expected to have similar potential as vaccines to their human counterparts.
Example 3in vi, Experiments with Human ArgLong2 Peptide in Murine Tumor Models
[0116] In order to demonstrate the therapeutic potential of vaccination using the ArgLong2 peptide, mouse models were developed. Since the corresponding ArgLong2 sequence in mice differ by only two amino acids, the human ArgLong2 sequence was employed in the subsequent experiments. A comparison of the human and mouse ArgLong2 sequences is shown below:
TABLE-US-00006 HumanArgLong2 (SEQIDNO:1) ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL MouseArgLong2 (SEQIDNO:2) ISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKL
Materials and Methods
Peptide Vaccination of C57BL/6 Mice
[0117] Animals were vaccinated subcutaneously with 100 g peptide in DMSO/H.sub.2O in a 1:1 emulsion with incomplete Montanide ISA 51 VG. Montanide ISA 51 VG+DMSO/H.sub.2O served as a control vaccine. For subsequent analysis of the immune response to the ArgLong2 peptide, mice were sacrificed on day 7 and spleen and draining lymph nodes (dLNs) were harvested for ELISPOT setup.
ELISPOT Analysis of Peptide-Specific Response
[0118] Murine immune cells were subjected to ELISPOT analysis. Single cell suspension was prepared from spleen or dLNs by passage through a cell strainer. After lysis of red blood cells, 0.6-0.810.sup.6 cells/well were seeded into ELISPOT plates coated with anti-IFN antibody. Peptide of interest was added to designated wells and cells were incubated overnight with peptide. The next day, cells were removed, plates washed and incubated with biotinylated detection antibody. Finally, after addition of Streptavidin-ALP and substrate visible spots appear. Each spot corresponds to an individual IFN producing cell. Plates were analysed in an Immunospot analyser and plotted.
Tumour Vaccination of Female C57BL/6 Mice, Age 15-16/17-20 Weeks, 15 Animals Per Group
[0119] Each animal was inoculated subcutaneously into the right flank with 0.510.sup.6 syngeneic tumour cells in 100 l media. Both the syngeneic B16 F10 melanoma cells line and the syngeneic MC38 colon adenocarcinoma cell line were used. Vaccinations were initiated on day 0 and repeated once a week (day 7 and day 14). Peptide and control vaccinations were performed as described above.
[0120] Tumour growth was monitored and tumours were measured approximately every second day. Tumour volume was calculated at V[mm.sup.3]=LW.sup.2/2 (where L is the longest diameter and W perpendicular to L). Maximum tumor size before mice were euthanized was 864 mm.sup.3 (L=12 mm, W=12 mm).
Results
[0121] ArgLong2 was found to be strongly immunogenic in C57BL/6 mice, shown by high frequency of vaccine-specific T cell responses detected after just one vaccination (
[0122] In the tumour studies, vaccinations with ArgLong2 significantly delay tumour growth as compared to control vaccination. The delay in tumor growth was observed in both the MC38 model for colon adenocarcinoma (
Example 4ArgLong2-Specific T Cell Clones Recognize Arginase 1-Expressing THP-1 Cells
Materials and Methods
Generation of ArgLong2-Specific T Cell Clones
[0123] ArgLong2 clone cultures were generated from a T cell culture enriched for ArgLong2 specific cells following a standard rapid expansion protocol (REP): ArgLong2 specific cells were separated by magnetic bead sorting of TNF producing T cells and used for limited dilution cloning in 96-well plates with 1 cell/well. Each well contained 200 l of REP mix (irradiated feeder cells from 3 different buffy coats, CD3 antibody and 6000 U/ml IL-2) to promote the growth of ArgLong2-specific T cells.
Quantification of Arginase 1 mRNA in THP-1 Cells by qPCR
[0124] THP-1 cells were stimulated with 20 ng/ml IL-13 (TriChem) for 48 hrs. Cells were harvested, washed in PBS and pelleted by centrifugation at 300 g for 5 minutes. The pellets were kept on ice, resuspended in 350 l RLT Plus-Buffer (Qiagen). RNA was purified using the RNAeasy Kit (Qiagen) according to manufacturer's instruction with final elution in 30 l of RNA-free water. The RNA concentration was measured on the NanoDrop 2000 Spectrophotometer (Thermo Scientific). RNA was stored at 80 C.
[0125] Total RNA was reverse transcribed using the High Capacity cDNA Reverse Transcription Kit (Applied Biosystems). For each reaction, 1000 ng RNA was reverse transcribed. For RT-qPCR, the cDNA was diluted 1:5 and subjected to RT-qPCR analysis using the TaqMan Gene Expression Assay on the Roche Lightcycler 480 Instrument. RT-qPCRs were run in quadruplicates and data was analysed using the ddCT-method with normalization to expression level of the house keeping gene RPLPO and control sample. For low concentration samples that were not amplified, Ct was set to 40. No-reverse transcriptase controls (cDNA reactions setup without reverse transcriptase) served as controls of specific amplification. Arg1 human primer was purchased from Thermofisher (undisclosed sequence, product number Hs00163660_m1).
Determination of THP-1 Cell Recognition by ArgLong2-Specific T Cells
[0126] Untreated and IL-4/IL-13-treated THP-1 cells were washed and divided into two groups: HLA-DR/DQ/DP blocking antibody (clone T39) was added to the first group at a concentration of 10 g/ml for 20 min at 37 C. The second group of THP-1 cells was left untreated. After 20 min HLA-II blocking THP-1 cells were washed. THP-1 cells treated with IL-4/IL-13 (with or without HLA-II block) were then mixed with ArgLong2 peptide specific T cells at effector:target ratio of 2:1 and then processed according to the standard intracellular cytokine staining protocol.
Results
[0127] In order to further evaluate the functionality of ArgLong2-specific T cells, T cell clones have been generated from a healthy donor previously identified with a strong ArgLong2 response, and their ability to specifically recognise Arginase 1-expressing targets was examined.
[0128] Th2 cytokines, such as IL-4 or IL-13 are known to upregulate ARG1 expression in myeloid cells. To test whether ArgLong2-specific T cells would specifically recognise Th2 cytokine-treated myeloid cells, the ability of ArgLong2 T cell clones to recognise HLA-matched monocytic THP-1 cell line that was pre-stimulated 48 hours with either IL-4 (100 U/ml) or IL-13 (20 U/ml) was tested.
[0129] M2-cytokine treated THP-1 showed increased expression of Arginase 1. In this regard,
[0130] ArgLong2-specific CD4 T cell clones were shown to recognise IL-4 and IL-13 treated THP-1 cells, as indicated by the increased production of TNF and IFN against these cells compared to the untreated THP-1 (
[0131] In a separate experiment, PBMCs from a healthy donor (HD22, known to have a pre-existing ex vivo response against ArgLong2) were treated with IL-4 (100 U/ml) or IL-13 (20 U/ml) for 7 days in order to increase presentation of the Arginase 1-derived peptides in the PBMC culture and thus stimulate the intrinsic ArgLong2 specific T cells present in the PBMCs. After 7 days of stimulation with IL-4 or IL-13, the PBMCs were analysed in IFN ELISPOT assay to check the changes in the frequency of the ArgLong2-specific T cells.
[0132] Increased ArgLong2 responses were seen in IL-4 and IL-13 treated PBMC cultures as compared to untreated control. The magnitude of the IL-13 stimulated ArgLong2 response was comparable with the responses seen after in vitro ArgLong2 peptide stimulation, suggesting a strong activation of Arginase 1-specific cells in the Th2 cytokine conditions.
TABLE-US-00007 SEQUENCES SEQ Start End IDNO Sequence Name pos pos 1 ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL ArgLong2 169 206 2 ISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKL* mArgLong2 169 206 3 ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSM ArgLong3 169 200 4 ISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSM* m7rgLong3 169 200 5 ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGK ArgLong 169 210 6 ISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGK* mArgLong 169 210 7 AKDIVYIGLRDVDPGEHYIL Arg1-18 171 190 8 DVDPGEHYILKTLGIKYFSM Arg1-19 181 200 9 KTLGIKYFSMTEVDRLGIGK Arg1-20 191 210 *indicatesasequencefrommurineArginase1whichincludesatleastone differencerelativetothecorrespondingregionofhumanArginase1.Residues whicharenon-identicalwiththecorrespondinghumansequenceareboldand underlined.MurineandhumanArginase1arethesamelengthsostartandend positionsarethesame. FulllengthhumanArginase1(NP_000036.2) (SEQIDNO:10) MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT LACFGLAREGNHKPIDYLNPPK Regionidentifiedasahotspotforimmunogenicityshownboldandunderlined FulllengthmurineArginase1(NP_031508.1) (SEQIDNO:11) MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPN DSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCV IWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLR DVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAF TPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALT LACFGTQREGNHKPGTDYLKPPK Regionidentifiedasahotspotforimmunogenicityshownboldandunderlined Hotspotinhumanarginase1-positions161-210ofSEQIDNO:10 (SEQIDNO:12) GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGK Hotspotinmurinearginase1-positions161-210ofSEQIDNO:11 (SEQIDNO:13) GFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGK Residueswhicharenon-identicalwiththecorrespondinghumansequenceare boldandunderlined.