IL7-IL 15 TxM compositions and methods
12350316 ยท 2025-07-08
Assignee
Inventors
Cpc classification
A61K40/11
HUMAN NECESSITIES
International classification
A61K40/11
HUMAN NECESSITIES
Abstract
Contemplated compositions and methods are directed to in vivo stimulation of T.sub.N cells to differentiate to T.sub.SCM cells in the presence of tumor cells expressing tumor associated antigens or tumor and patient specific neoepitopes using a pharmaceutical composition that includes an IL-15 portion and an IL-7 portion. The T.sub.SCM cells are then isolated and expanded in vitro, preferably using a pharmaceutical composition that includes an IL-15 portion, an IL-7 portion, and an IL21 portion, and subsequently administered to the patient.
Claims
1. A method of generating a therapeutic cell composition, the method comprising: administering to an individual a chimeric molecule complex comprising a first fusion protein comprising an IL15 portion and an IL7 portion; wherein the first fusion protein has the amino acid sequence of SEQ ID NO: 1, and a second fusion protein comprising an IL15RaSuFc portion and an IL21 portion, wherein the second fusion protein has the amino acid sequence of SEQ ID NO: 2, and wherein the IL15 portion of the first fusion protein is non-covalently bound to the IL15RaSuFc portion of the second fusion protein to thereby stimulate differentiation of nave T (T.sub.N) cells to stem cell memory T (T.sub.SCM) cells; wherein the individual has a tumor with tumor cells that express a tumor associated antigen or a tumor and patient specific neoepitope; isolating the T.sub.SCM cells from the individual; in vitro expanding the isolated T.sub.SCM cells; and generating the therapeutic cell composition by formulating the expanded T.sub.SCM cells for injection into the individual.
2. The method of claim 1 further comprising a step of lymphodepletion before the step of administering the chimeric molecule complex, wherein lymphodepletion comprises administration to the patient of an effective amount of a chemotherapy or radiation.
3. The method of claim 1 wherein the T.sub.SCM cells are isolated from the individual using leukapheresis and FACS sorting, wherein the T.sub.SCM cells are sorted by expression of CD62L or CCR7.
4. The method of claim 1 further comprising a step of selecting from the isolated T.sub.SCM cells a population of cells that have a T cell receptor that binds the tumor associated antigen or the tumor and patient specific neoepitope.
5. The method of claim 1 wherein the step of in vitro expanding the isolated T.sub.SCM cells is performed using the chimeric molecule complex of claim 1.
6. The method of claim 1 wherein the step of in vitro expanding the isolated T.sub.SCM cells is performed in the presence of the tumor associated antigen or the tumor and patient specific neoepitope.
7. The method of claim 1 wherein the step of in vitro expanding the isolated T.sub.SCM cells is performed in the presence of dendritic cells of the individual.
Description
BRIEF DESCRIPTION OF THE DRAWING
(1)
(2)
(3)
(4)
(5)
(6)
(7)
DETAILED DESCRIPTION
(8) The inventors have now discovered that tumor specific T.sub.SCM cells can be prepared in sufficient quantities for immune therapy in a process that uses in vivo stimulation to trigger differentiation of nave T.sub.N cells to T.sub.SCM using tumor cell epitopes as relevant antigens and ex vivo expansion of T.sub.SCM cells. Advantageously, expansion is performed under conditions that avoid differentiation of the isolated cells into T.sub.EFF cells. In most preferred aspects, IL-7/IL-15 signaling or IL-15 signaling is used in vivo to superselect early memory stem cells, with IL15 inducing their proliferation while IL-7/IL-15/IL-21 signaling is used to expand the T.sub.SCM cells without triggering T.sub.EFF cell formation.
(9) For example, in one especially preferred aspect of the inventive subject matter, ALT-803 or an IL-7/IL-15 TxM are used to stimulate in a patient having a tumor the differentiation and in vivo growth of stem cell memory CD8 T.sub.SCM cells, effector memory T.sub.EM cells, and central memory CD8 T.sub.CM cells. These cells and especially T.sub.SCM cells are then harvested from blood (e.g., by leukophoresis or FACS), typically using markers such as CD62L, CCR7, and/or CD45RA. If desired, the so harvested cells may be further selected for those cells that express a T cell receptor (TCR) that binds to a tumor associated antigen or patient and tumor specific neoepitope. The isolated cells are then grown in vitro with IL-7, IL-15, and IL-21 (e.g., in the form of a IL-7/IL-15/IL-21 TxM) in the presence or absence of tumor related antigens, which may be presented on dendritic or other antigen presenting cells. Upon generation of sufficient numbers of T.sub.SCM cells, the T.sub.SCM cells are re-infused to the patient to enhance tumor clearance. Similarly, T.sub.SCM cells from the patient could also be grown ex vivo as described above and then transfected with a nucleic acid that encodes a suitable TCR (e.g., from single cell sequencing or T cells exposed to known antigens presented on APCs) that binds to the a tumor associated antigen or patient and tumor specific neoepitope.
(10) In still further contemplated aspects, to increase T.sub.SCM recovery from the patient even more, the patient may be subjected to an at least partial lymphodepletion prior to the administration of the ALT-803 or an IL-7/IL-15 TxM (or administration of L-7 and IL-15) using modalities well known in the art, such cyclophosphamide (cytoxan) and fludarabine (Fludara), and/or radiation. Advantageously, lymphodepletion will not only depress the numbers of regulatory T cells (Tregs) and myeloid-derived suppressor cells (MDSC), and as such reduce an immune suppressive environment, but will also stimulate endogenous processes that favor formation of T.sub.SCM cells. Notably, as the patient tumor cells provide various tumor associated antigens and/or patient and tumor specific antigens, the population of T.sub.SCM cells that have a TCR that binds to the a tumor associated antigen or patient and tumor specific neoepitope is significantly increased. Moreover, to even further stimulate such tumor specific T.sub.SCM cell population, the ALT-803 or an IL-7/IL-15 TxM can be modified to include a binding portion that is specific to the tumor associated antigen or patient and tumor specific neoepitope.
(11) Therefore, it should be appreciated that relatively large quantities of T.sub.SCM cells can be obtained from a patient where the tumor cells in the patient serves as an antigen sink and as such assists in generation of a larger fraction of tumor specific T.sub.SCM cells. In addition, at least partial lymphodepletion can be added to a protocol to even further increase the number of (tumor specific) T.sub.SCM cells. As will be readily appreciated, T.sub.SCM cells can be isolated from whole blood using a variety of processes, including leukapheresis and FACs sorting. Most typically, such separation will employ markers of T.sub.SCM cells such as CD62L, CCR7, and/or CD45RA.
(12) In vitro expansion of the isolated T.sub.SCM cells can then be performed using cell culture conditions well known in the art. However, the culture medium will also be supplemented with IL7, IL-15, and IL-21 (or chimeric molecules comprising one or more of IL7, IL-15, and IL-21). Most preferably, but not necessarily, the IL7, IL-15, and IL-21 portions will be in a single chimeric molecule complex, a IL-7/IL-15/IL-21 TxM as is described in more detail below. It should be particularly appreciated that IL-17 will stimulate T.sub.SCM cell development while IL-15 will stimulate proliferation of such cells. Most advantageously, IL-21 will reduce or even prevent further differentiation of T.sub.SCM cells towards T.sub.EFF cells such as Tregs and MDSCs. A developmental schematic of stimulated T.sub.N cells is shown in
(13) In general, it should be noted that the cytokines used herein can be administered as individual isolated and purified cytokines. For example, the cytokines may be administered to the patient individually as IL-7 and IL-15 in any route and dosage commonly given. In the same ways, cytokines may be used in the in vitro expansion individually as IL-7, IL-15, and IL-21. However, it is generally preferred that the cytokines will be administered as part of a chimeric molecule or chimeric molecule complex, and most preferably as an ALT-803 and/or a TxM as is shown in more detail below. Such TxM molecules may include one or more cytokine portions, and most preferably a IL-15/IL-15 receptor alpha portion as is also shown in more detail below. Furthermore, it is contemplated that the TxM constructs or ALT-803 may also include a binding portion (preferably a scFv portion) that binds to a TAA (tumor associated antigen) or neoepitope on the tumor cell to so exhibit specific activity at the tumor cell.
(14) Regardless of the particular arrangement, it should be appreciated that the so formed chimeric molecule complexes will allow for a combination of specific biological effects that provide activity in an enhanced manner over a prolonged period of time. Moreover, where the chimeric complexes include an affinity portion (e.g., scFv), such effects can be further targeted to specific locations. For example, the affinity portions may target tissue (and especially tumor) specific markers to so direct and maintain the effects at a desired location. Among other biological effects, particularly preferred biological effects are those that trigger development and/or proliferation of various memory T cells and especially T.sub.SCM cells as is shown in more detail below. In addition, it should be appreciated that the differentiation and proliferation of nave T cells to various T memory cells can be further enhanced by ligands to TNF superfamily receptors, and especially single and multimeric forms of 4-1BBL (which may form higher order multimers) and/or an agonistic mAb against 4-1BB. Advantageously, IL15 activates T cells and promotes expression of 4-1BB, whereas IL7 and IL21 promote differentiation of T cells to selected memory T cells, and particularly T.sub.SCM. In the presence of 4-1BBL or agonistic mAb against 4-1BB, proliferation of such memory T cells is further stimulated.
(15) Furthermore, it should be recognized that contemplated chimeric molecule complexes have significantly increased persistence (i.e., extended serum half life time), which allows the molecule to perform its functions while delaying degradation in the blood stream. Indeed, it was observed that the Fc portion significantly increased the lifespan of IL15 in circulation as compared to IL15 per se. This provides the chimeric molecule complex with persistence, thus prolonging the activity of the molecule in circulation. Another contemplated benefit, as is discussed in more detail below, is that the Fc portion greatly simplifies purification processes during the preparation of purified chimeric molecule complexes. As already noted above, the Fc portion may include at least an Fc portion of an IgG, IgM, IgA, IgD, or IgE antibody.
(16) It is contemplated that a preferred arrangement of the first fusion protein, from N- to C-terminus, is as follows: first affinity portion, IL15 receptor, Fc portion. However, the first fusion protein may also be arraigned as follows: IL15 receptor, Fc portion, first affinity portion. Ideally, the second affinity portion is arranged, from N- to C-terminus as follows: second affinity portion, IL15 portion.
(17) With respect to the production of contemplated chimeric molecule complexes and dimers/multimers, various methods of synthesis are contemplated. For example, and in general, it is contemplated that chimeric molecule complexes can be expressed from one or more nucleic acid in patient cells in vivo, in patient or mammalian production cells (e.g., CHO cells) in vitro, or where desired in other cells such as bacteria, yeast, or non-mammalian cells. Most preferably, the individual components of the fusion proteins (e.g., IL15 or IL15R, Fc portion, affinity portions, etc.) are expressed from a recombinant nucleic acid as a single polypeptide, typically with short and flexible linker sequences in between the individual components. However, in less preferred aspects, the individual components can be expressed individually and are then coupled together after expression. Such coupling will typically include use of high-affinity binding pairs such as biotin/avidin, protein A/G, short nucleic acids with sequence complementarity, etc. Most preferably, the fusion protein (components) of the chimeric molecule complex will be co-expressed within the same cell.
(18) For example, contemplated chimeric molecule complexes can be prepared as an IL7 (or IL18)/huIL15N72D fusion protein in complex with (i.e., non-covalently bound to) an IL21 (or IL12)/huIL15RaSu/huIgG1 Fc fusion protein using sequences known in the art. For example, with respect to IL15 it is contemplated that all known IL15 sequences are deemed suitable for use herein, and particularly human or humanized IL15. Thus, the term IL15 as used herein refers to all IL15 forms (including isoforms, prepro, and pro forms), preferably mammalian, and most preferably human or humanized forms. Moreover, contemplated IL15 proteins also include mutant forms, and particularly mutants with higher biological activity such as N72D mutant form (see e.g., Zhu et al., J Immunol, 183:3598-3607, 2009). For example, suitable IL15 sequences can be found under Genbank accession numbers X91233 (Genomic DNA), CH471056 (Genomic DNA), or X94223 (mRNA), AK290619 (mRNA), BC100961 (mRNA), and the protein sequence is known under UniProtKB identifier P40933.
(19) Similarly, with respect to the IL15 receptor it is contemplated that all known IL15 receptor sequences are deemed suitable for use herein. However, especially preferred receptor sequences are high-affinity IL15R alpha chain (IL15R) receptors, and particularly human or humanized IL15R. Thus, the term IL15 receptor as used herein refers to all IL15R forms (including all isoforms), preferably mammalian, and most preferably human or humanized forms. For example, suitable IL15R sequences can be found under Genbank accession number AY316538 (Genomic DNA), CH471072 (Genomic DNA), or CR457064 (mRNA), AK304211 (mRNA), BC121140 mRNA, and the protein sequence is known under UniProtKB identifier Q13261.
(20) As discussed above, the fusion proteins may also comprise an Fc domain of an antibody. Most typically, Fc domains will ultimately be present as a dimer as exemplarily shown in
(21) In a particularly preferred example, a first fusion protein containing IL15R (or portion thereof) comprises a first cytokine portion coupled via a linker to a hu-IL15RSu portion coupled via a linker to a hu-IgG1 Fc portion. Such first fusion protein forms a complex (via IL15/IL15R binding) with a second fusion protein containing IL15 (or portion thereof) that comprises a second cytokine portion coupled via a linker (as discussed below) to a hu-IL15N72D portion. Such complex may then form an antibody-like dimer via interaction and disulfide bond formation of the two Fc portions.
(22) Most typically, the IL-15:IL-15R complex is a complex having IL-15 non-covalently bound to the soluble IL-15R domain of the native IL-15R. In some cases, the soluble IL-15R is covalently linked to a biologically active polypeptide and/or to an IgG Fc domain. The IL-15 can be either IL-15 or IL-15 covalently linked to a second biologically active polypeptide. The crystal structure of the IL-15:IL-15R complex is known (see e.g., 2007 Nat Immunol 8, 1001-1007).
(23) In various embodiments of the above aspects or any other aspect of the invention presented herein, the IL-15R fusion protein comprises soluble IL-15R, e.g., IL-15R covalently linked to a biologically active polypeptide (e.g., the heavy chain constant domain of IgG, an Fc domain of the heavy chain constant domain of IgG, or a cytokine). In other embodiments of the invention of the above aspects, IL-15 comprises IL-15, e.g., IL-15 covalently linked to a second biologically active polypeptide, e.g., a cytokine or a binding portion (e.g., scFv). In other embodiments, purifying the IL-15:IL-15R complex from the host cell or media involves capturing the IL-15:IL-15R complex on an affinity reagent that specifically binds the IL-15:IL-15R fusion protein complex. In other embodiments, the IL-15R fusion protein contains an IL-15R/Fc fusion protein and the affinity reagent specifically binds the Fc domain. In other embodiments, the affinity reagent is Protein A or Protein G. In other embodiments, the affinity reagent is an antibody. In other embodiments, purifying the IL-15:IL-15R complex from the host cell or media comprises ion exchange chromatography. In other embodiments, purifying the IL-15:IL-15R complex from the host cell or media comprises size exclusion chromatography.
(24) In other embodiments, the IL-15R comprises IL-15RaSushi (IL-15RSu). In other embodiments, the IL-15 is a variant IL-15 (e.g., IL-15N72D). In other embodiments, the IL-15 binding sites of the IL-15:IL-15R complex are fully occupied. In other embodiments, both IL-15 binding sites of the IL-15:IL-15RSu/Fc complex are fully occupied. In other embodiments, the IL-15:IL-15R complex is purified based on the complex charge or size properties. In other embodiments, the fully occupied IL-15N72D:IL-15RSu/Fc fusion protein complex is purified by anion exchange chromatography based on the complex charge properties. In other embodiments, the fully occupied IL-15N72D:IL-15RSu/Fc fusion protein complex is purified using a quaternary amine-based resin with binding conditions employing low ionic strength neutral pH buffers and elution conditions employing buffers of increasing ionic strength.
(25) In certain embodiments of the soluble fusion protein complexes of the invention, the IL-15 polypeptide is an IL-15 variant having a different amino acid sequence than native IL-15 polypeptide. The human IL-15 polypeptide is referred to herein as huIL-15, hIL-15, huIL15, hIL15, IL-15 wild type (wt) and variants thereof are referred to using the native amino acid, its position in the mature sequence and the variant amino acid. For example, huIL15N72D refers to human IL-15 comprising a substitution of N to D at position 72. In certain embodiments, the IL-15 variant functions as an IL-15 agonist as demonstrated, e.g., by increased binding activity for the IL-15RI37C receptors compared to the native IL-15 polypeptide. In certain embodiments, the IL-15 variant functions as an IL-15 antagonist as demonstrated by e.g., decreased binding activity for the IL-15RI3yC receptors compared to the native IL-15 polypeptide. In certain embodiments, the IL-15 variant has increased binding affinity or a decreased binding activity for the IL-15Rf3yC receptors compared to the native IL-15 polypeptide. In certain embodiments, the sequence of the IL-15 variant has at least one (i.e., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) amino acid change compared to the native IL-15 sequence. The amino acid change can include one or more of an amino acid substitution or deletion in the domain of IL-15 that interacts with IL-15R13 and/or IL-15RyC. In certain embodiments, the amino acid change is one or more amino acid substitutions or deletions at position 8, 61, 65, 72, 92, 101, 108, or 111 of the mature human IL-15 sequence. For example, the amino acid change is the substitution of D to N or A at position 8, D to A at position 61, N to A at position 65, N to R at position 72 or Q to A at position 108 of the mature human IL-15 sequence, or any combination of these substitutions. In certain embodiments, the amino acid change is the substitution of N to D at position 72 of the mature human IL-15 sequence.
(26)
(27) In TxM constructs where IL-7 is used, a typical sequence arrangement has a leader peptide (underlined) followed by the IL-7 sequence, which is followed by the IL-15N72D domain (italics).
(28) TABLE-US-00001 [SEQIDNO:1] MKWVTFISLLFLFSSAYSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIG SNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLEIL LKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDL CFLKRLLQEIKTCWNKILMGTKEHNWVNVISDLKKIEDLIQSMHIDATL YTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSL SSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS.
(29) In TxM constructs where IL-21 is used, a typical sequence arrangement has a leader peptide (underlined) followed by the IL-21 sequence, which is followed by the IL-15R sushi domain (italics), which in turn is followed by a human IgG1 Fc domain (bold):
(30) TABLE-US-00002 [SEQIDNO:2] MKWVTFISLLFLFSSAYSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEF LPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPS TNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHG SEDSITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTEC VLNKATNVAHWTTPSLKCIREPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK.
(31) Notably, contemplated Fc fusion proteins will have an in vivo pharmacokinetic profile comparable to that of human IgG with a similar isotype, and as such substantially increase the halflife time (up to 21 days) as compared to IL15 alone. For example, the pharmacokinetics and biological activity of a IL15 super-agonist (IL15N72D) was dramatically increased by binding the IL15N72D to a IL15R/Fc fusion protein (ALT-803), such that the super agonist complex has at least 25-times the activity of the native cytokine in vivo (see e.g., Cytokine, 56:804-810, 2011). Such advantage is expected to persist where such or similar scaffolds are used to carry one or more affinity portions.
(32) As noted above, contemplated fusion proteins will preferably include a (preferably flexible) peptide linker between each of the individual components complexes. Most typically, suitable linker sequences will include between about 7 to 20 amino acids, and preferably between about 10 to 20 amino acids. In further preferred aspects, suitable linker sequences are preferably flexible to reduce steric hindrance and/or facilitate proper folding/tertiary structure. Thus, linkers may include amino acids with small side chains, such as glycine, alanine, and serine, to provide for flexibility (G4S linker). Where desired, such mini-sequences may be repeated to achieve a desired length. However, numerous alternative linker sequences are also deemed suitable and appropriate linkers are known in the art (e.g., Whitlow, M. et al., (1991) Methods: A Companion to Methods in Enzymology, 2:97-105). Therefore, most typically a linker sequence is between the affinity portion and the IL15 or IL15R, and between the IL15R and the Fc portion.
(33) Suitable cytokine sequences include all known cytokine sequences, and especially those for IL7, IL12, IL15, IL18, and IL21. Preferably, the cytokine sequences are mammalian cytokines, and especially human cytokine sequences. For example, suitable mammalian and human IL7 protein sequences and isoforms are known from UniProtKB record P13232, and suitable mammalian and human IL12 protein sequences and isoforms for alpha and beta subunits are known from UniProtKB records E7ENE1 and E9PGR3, while suitable mammalian and human IL18 protein sequences and isoforms are known from UniProtKB record Q14116, and suitable mammalian and human IL21 protein sequences and isoforms are known from UniProtKB record Q9HBE4. As will be readily appreciated, all amino acid sequences can be back-translated into corresponding DNA sequences using appropriate codon usage or codon optimization in the respective production cell where the chimeric molecules are recombinantly produced. Moreover, it should be appreciated that all mutant forms are also expressly deemed suitable for use herein, particularly where the mutant protein has increased biological activity as compared with the wildtype form.
(34) Most preferably, contemplated fusion proteins are encoded on a recombinant nucleic acid, typically with codon usage adapted to the host cell that is used to express the fusion proteins. Moreover, it should be appreciated that the chimeric fusion protein complexes may be produced in vivo or in vitro. Therefore, the recombinant nucleic acid may be part of a viral nucleic acid (e.g., recombinant adenovirus that also encodes one or more neoepitopes or polytopes, optionally with co-stimulatory molecules) or part of a DNA vaccine. Alternatively, the recombinant nucleic acid may be a RNA or DNA that is transfected into a production cell to generate recombinant protein. Preferably, the recombinant nucleic acid is part of a vector for extrachromosomal replication such as a phage, virus, plasmid, phagemid, cosmid, or YAC. In particularly preferred aspects, a DNA plasmid is constructed to encode the fusion proteins contemplated herein and is used to prepare the complexes in clinically meaningful quantities. To that end, the recombinant nucleic acid can be inserted into an appropriate expression vector (i.e., a vector that contains the necessary elements for the transcription and translation of the inserted protein-coding sequence). A variety of host-vector systems may be utilized to express the protein-coding sequence, including mammalian cell systems infected with a virus (e.g., vaccinia virus, adenovirus, etc.), insect cell systems infected with virus (e.g., baculovirus), microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage DNA, plasmid DNA or cosmid DNA. Depending on the host-vector system utilized, any one of a number of suitable transcription and translation elements may be used. The fusion proteins described herein are preferably produced by standard recombinant DNA techniques. Further suitable expression vectors and systems are described is U.S. Pat. No. 8,507,222. As will be readily appreciated, the two components of the chimeric molecule complex can be co-expressed to obtain the suitable chimeric molecule complex.
(35) Another advantage of contemplated compositions and methods is that the step of purification is greatly simplified because the entire chimeric molecule complex can be pulled out of solution by the binding of the Fc portion to a corresponding affinity protein. Therefore, in preferred embodiments, the Fc portion is ideally long enough to (a) facilitate the isolation of the chimeric molecule complex with any affinity protein that binds to the Fc portion (e.g. Protein A or G), and/or (b) facilitate the binding to the Sudlow II domain in albumin. Thus it is contemplated that in at least some embodiments the chimeric molecule complex can be administered as protein complexes with albumin. It is also contemplated that IL15 can be further coupled to alpha-CD3, cellulose binding protein, and/or oligohistidine for the purpose of easier affinity purification. Alternatively, IL15 could be bound to IL2 or another cytokine portion to further enhance activation capability.
(36) When forming dimers, it is contemplated that first and second chimeric molecule complexes can be made in separate batches as homodimers. The batches can then be combined and a reducing agent can then be added to split the bonds between homodimers so the chimeric molecule complexes dissociate. The reducing agent can then be pulled out (e.g. via dialysis), which will cause chimeric molecule complexes to re-associate, but this time in 1st-1st, 2nd-2nd, and 1st-2nd combinations. Further details and methods of producing fusion proteins based on IL15/IL15R are described in WO 2017/205726, which is incorporated by reference herein.
(37) It should further be appreciated that the fusion proteins of the inventive subject matter can be combined with any appropriate pharmaceutically acceptable amount in any quantities, and will generally present in an amount of 1-95% by weight of the total weight of the composition. Contemplated compositions may be provided in a dosage form that is suitable for parenteral (e.g., subcutaneous, intravenous, intramuscular, intravesicular, intratumoral or intraperitoneal) administration route. As will be appreciated, pharmaceutical compositions contemplated herein may be formulated according to conventional pharmaceutical practice (see, e.g., Remington: The Science and Practice of Pharmacy (20th ed.), ed. A. R. Gennaro, Lippincott Williams & Wilkins, 2000 and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York). In addition, the formulations may further include appropriate excipients that, upon administration, release the therapeutic agent in a controlled manner. Examples include single or multiple unit tablet or capsule compositions, oil solutions, suspensions, emulsions, microcapsules, microspheres, molecular complexes, nanoparticles, patches, and liposomes.
(38) Most preferably, however, the pharmaceutical compositions comprising a fusion protein complex of the invention may be in a form suitable for sterile injection. To prepare such a composition, the suitable active therapeutic(s) are dissolved or suspended in a parenterally acceptable liquid vehicle. Among acceptable vehicles and solvents that may be employed are water, water adjusted to a suitable pH by addition of an appropriate amount of hydrochloric acid, sodium hydroxide or a suitable buffer, 1,3-butanediol, Ringer's solution, and isotonic sodium chloride solution and dextrose solution. The aqueous formulation may also contain one or more preservatives (e.g., methyl, ethyl or n-propyl p-hydroxybenzoate). In cases where one of the compounds is only sparingly or slightly soluble in water, a dissolution enhancing or solubilizing agent can be added, or the solvent may include one or more co-solvents, e.g. 10-60% w/w of propylene glycol.
(39) Human dosage amounts are initially determined by extrapolating from the amount of compound used in mice or non-human primates, as a skilled artisan recognizes it is routine in the art to modify the dosage for humans compared to animal models. For example, the dosage may vary from between about 1 g compound/kg body weight to about 50 mg compound/kg body weight; or from about 5 mg/kg body weight to about 40 mg/kg body weight or from about 10 mg/kg body weight to about 30 mg/kg body weight; or from about 50 mg/kg body weight to about 20 mg/kg body weight; or from about 100 mg/kg body weight to about 10 mg/kg body weight; or from about 150 mg/kg body weight to about 500 mg/kg body weight. For example, the dose is about 0.01, 0.05, 0.1, 1, 5, 10, 25, 50, 75, 100, 150, 200,250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, or 1,000 mg/kg body weight. Alternatively, doses are in the range of about 5 mg compound/Kg body weight to about 20 mg compound/kg body weight. In another example, the doses are about 0.01, 0.05, 0.1, 1, 5, 8, 10, 12, 14, 16 or 18 mg/kg body weight.
(40) It is contemplated that in preferred embodiments, chimeric molecule complexes will be administered in formulations suitable for injection in therapeutically effective amounts. Therapeutically effective amounts can range from 1 ng to 1,000 mg, from 1 g to 500 mg, from 100 g to 100 mg. Solubility co-solvents or detergents can be used to increase the storage stability. Additionally, or alternatively, mixed-phase or two-phase liquid systems can be used. Most preferably, chimeric molecule complexes will be formulated in a liquid carrier ready to use. However, it is contemplated that the chimeric molecule complexes can also be formulated in a dried form for reconstitution, by lyophilization or freeze drying.
EXAMPLES
(41) The following examples provide exemplary guidance and are not intended to limit the scope of the inventive concept provided herein. Moreover, and unless otherwise indicated, all experiments were performed following standard protocols for cell culture and analysis well known in the art.
(42) Lymphodepletion: Patients with a tumor are subjected to lymphodepletion using one or more pharmaceuticals (e.g., cyclophosphamide (cytoxan) and/or fludarabine (Fludara)) following protocols well known in the art.
(43) Stimulation with ALT-803 or IL7/IL-15 TxM: Following lymphodepletion, patients are injected with ALT-803 or IL7/IL-15 TxM (typically subcutaneous) at dosages of about 10-50 mcg/kg. Stimulation can be performed between once daily and once weekly. Patients are then subjected to leukapheresis or blood draw and FACS isolation of TSCM cells. In most cases, the leukapheresis or blood draw and FACS isolation is performed 4-7 days after the stimulation.
(44) Isolation of TSCM cells: Peripheral blood mononuclear cells (PBMCs) are harvested from patients having a tumor and PBMCs are isolated by Ficoll-Hypaque gradient separation (Lymphoprep, Fresenius). Enrichment can be done for CD3+ or CD8+ cells with Pan T Cell Isolation Kit II or CD8 Isolation Kit respectively (Miltenyi Biotech). Cells are labeled with anti-CD3, anti-CD45RA (BD Biosciences) and anti-CD62L (Exbio) fluorescent antibodies and FACS-purified into desired fractions T.sub.N, T.sub.CM, T.sub.SCM, and T.sub.EM on a MoFlo MLS cell sorter (Dako). As desired, isolated T cells are further segregated into T.sub.SCM sub-population using T.sub.SCM specific markers (see
(45) In vitro cell culture: Isolated lymphocytes are cultured with: rhIL-2 at 300 IU/ml, rhIL-7 at 5 ng/ml (Peprotech) or rhIL-7, rhIL-15 at 5 ng/ml each (Peprotech), and IL-21 at 100 ng/ml. Cytokines and medium is replaced every 3-4 days. Alternatively, the cytokines are replaced by IL-7/IL-15/IL-21 TxM, typically at a concentration of between 15 and 200 ng/ml. Upon reaching a sufficient number of T.sub.SCM cells, growth medium is removed from the cells and replaced by ringer solution for infusion. Cells are promptly administered to the patient.
(46)
(47) In yet further experiments, the inventors demonstrated that enrichment of stem cell-memory like T (T.sub.SCM) cells could be facilitated by a IL-7/21 TxM. More specifically, peripheral blood mononuclear cells (PBMCs) were cultured in the presence of 0.8 nM N-803, 5 uM of the GSK-3 beta inhibitor TWS119, aCD3 (1 ng/mL), aCD28 (10 ng/ml), and increasing concentrations of IL-7/21 TxM from 0.1 nM to 10 nM. As can be seen from
(48) It should be apparent to those skilled in the art that many more modifications besides those already described are possible without departing from the inventive concepts herein. The inventive subject matter, therefore, is not to be restricted except in the scope of the appended claims. Moreover, in interpreting both the specification and the claims, all terms should be interpreted in the broadest possible manner consistent with the context. In particular, the terms comprises and comprising should be interpreted as referring to elements, components, or steps in a non-exclusive manner, indicating that the referenced elements, components, or steps may be present, or utilized, or combined with other elements, components, or steps that are not expressly referenced. As used in the description herein and throughout the claims that follow, the meaning of a, an, and the includes plural reference unless the context clearly dictates otherwise. Also, as used in the description herein, the meaning of in includes in and on unless the context clearly dictates otherwise. Where the specification claims refers to at least one of something selected from the group consisting of A, B, C . . . and N, the text should be interpreted as requiring only one element from the group, not A plus N, or B plus N, etc.