Antibody compositions targeting non-phosphorylated alpha-synuclein aggregates
12351623 ยท 2025-07-08
Assignee
Inventors
Cpc classification
G01N2800/2835
PHYSICS
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/32
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/14
CHEMISTRY; METALLURGY
C12N5/163
CHEMISTRY; METALLURGY
International classification
Abstract
The present specification provides a monoclonal antibody that specifically binds aggregated, non-phosphorylated -synuclein and a hybridoma producing it. Also disclosed are methods of generating antibodies that specifically binds aggregated, non-phosphorylated -synuclein and uses thereof. Uses of anti--synuclein antibody in detection and diagnostic assays, and for prophylaxis or therapy of -synuclein-associated neurodegenerative diseases, are also disclosed.
Claims
1. A monoclonal antibody that specifically binds aggregated, non-phosphorylated -synuclein comprising a heavy chain variable region (VH) and a light chain variable region (VL), wherein: i. the VH comprises heavy chain complementarity determining regions (HCDRs) 1-3 having the amino acid sequences of SEQ ID NOs:7-9, respectively; and ii. the VL comprises light chain complementarity determining regions (LCDRs) 1-3 having the amino acid sequences of SEQ ID NOs:13-15, respectively.
2. The monoclonal antibody of claim 1, wherein the antibody is an intact antibody.
3. The monoclonal antibody of claim 1, wherein VH comprises the amino acid sequence of SEQ ID NO:6 and VL comprises the amino acid sequence of SEQ ID NO:12.
4. The monoclonal antibody of claim 3, wherein the antibody is an intact antibody.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
DESCRIPTION
(15) Parkinson's disease (PD) and dementia with Lewy bodies (DLB) are commonly called -synucleinopathies and idiopathic and familial forms of these diseases have been linked to abnormal expression of -synuclein (-syn). Nevertheless, neuropathological studies utilizing pan--syn antibodies, recognizing both physiological and pathological forms of the protein, do not consistently report a relationship between the load of Lewy body pathology and clinical disease severity. However, multiple forms or -syn arising from post-translational modifications exist. These include acetylation, nitration, ubiquitination, glycosylation, and phosphorylation. Notably, phosphorylation at serine 129 (pS129) increases from approximately 4% under normal physiology to 90% in Lewy body disease, indicating that this form of -syn may be important in the disease process.
(16) Some studies have associated the pS129 modification with intracellular aggregate formation leading to cell death mediated by the unfolded protein response. Rodent models have suggested that the pS129 modification exacerbates the rate of pathological protein aggregation and deposition, with subsequent negative effects on neuronal functioning. Yet other studies in animal and cellular model systems report a potentially neuroprotective function of phosphorylation. Still other studies have found the pS129 modification neither increases nor diminishes cellular toxicity and/or -syn aggregation. Nonetheless, antibodies specific for pS129 are widely used as a putative disease relevant marker. Such studies often employ pS129--syn as a marker of the abundance of protein inclusions to stage disease severity and evaluate the relationship between its abundance and important clinical or pathological variables, such as disease duration, phenotypic severity or cell loss, and correlate the abundance of pS129 throughout the brain with disease severity. However, it has remained uncertain whether phosphorylation precedes protein aggregation or occurs secondarily to deposition of non-phosphorylated -syn, or whether pS129 is a driver of pathogenicity or merely a useful marker of the neurodegenerative process. We disclose herein a monoclonal antibody specific for WT--syn (that is, the form that remains unphosphorylated at serine 129), useful in addressing these and other questions related to the generation of -syn aggregates and the role of the phosphorylated and unphosphorylated forms of -syn in aggregation propensity and cytotoxicity.
(17) As used herein non-phosphorylated -synuclein means -synuclein in which the serine residue at position 129 is not phosphorylated.
(18) The term antibody is herein used in the broadest sense and encompasses various antibody structures including, but not limited to, monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity. An antibody broadly refers to any immunoglobulin (Ig) molecule comprised of heavy (H) chains and light (L) chains, or any functional fragment, mutant, variant, or derivation thereof, which retains the essential epitope-binding features of an Ig molecule. Such mutant, variant, or derivative antibody formats are known in the art, non-limiting embodiments of which are discussed below. An antibody is said to be capable of binding a molecule if it is capable of specifically reacting with the molecule. As used herein, the term fragment, when referring to an antibody should be read to mean an antigen-binding fragment. Various embodiments encompass both whole antibodies and antibody fragments, while other embodiments are limited to only whole antibodies or only antibody fragments or only one or more particular types of antibody fragment.
(19) The term monoclonal antibody, as used herein, refers to an antibody obtained from identical immune cells that are clones of a unique parent cell and expressed from a particular, single encoding sequence (neglecting such variation as may arise in the expression system or cell). Typically, monoclonal antibodies are monospecific in that all of the antigen binding sites contain the same complementarity determining regions (CDRs) and thus bind to the same epitope. The modifier monoclonal indicates the character of the antibody as being obtained from a clonal source and is not to be construed as requiring production of the antibody by any particular method. Thus the term encompasses antibodies obtained through traditional hybridoma technology, but also those obtained by phage display and other molecular cloning technologies.
(20) The term variable region or variable domain refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen, such as that of the monoclonal antibody produced by the 4B1 hybridoma (ATCC Patent Deposit Number PTA-127017). The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions termed complementarity determining regions (CDRs). (See, e.g., Kindt et al. Kuby Immunology, 6th ed., W. H. Freeman and Co., page 91 (2007)). A single VH or VL domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively.
(21) An antigen-binding portion or antigen-binding fragment of an antibody (or simply antibody portion or antibody fragment) refers to a molecule other than an intact or whole antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds (e.g., one or more fragments of an antibody that retain the ability to specifically bind to an antigen). Examples of antibody fragments include, but are not limited to, Fv, Fab, Fab, Fab-SH, F(ab).sub.2, diabodies, linear antibodies, single-chain antibody molecules (e.g. scFv), heavy chain only antibodies (HCAb), and multispecific antibodies formed from antibody fragments. Papain digestion of intact antibodies produces two identical antigen-binding fragments, called Fab fragments, each with a single antigen-binding site, and a residual Fc fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab).sub.2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen. However these terms may also be applied to genetically encoded fragments of the same or similar nature, in addition to those fragments produced by proteolytic digestion. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Such antibody embodiments may also be bispecific, dual specific, or multi-specific formats; specifically binding to two or more different antigens. Examples of binding fragments encompassed within the term antigen-binding portion of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab).sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (WO 90/05144 A1 herein incorporated by reference), which comprises a single variable domain; and (vi) an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv). Such single chain antibodies are also intended to be encompassed within the term antigen-binding portion of an antibody. Other forms of single chain antibodies, such as diabodies are also encompassed.
(22) The term diabodies refers to antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. Diabodies may be bivalent and/or bispecific. Diabodies are described more fully in, for example, EP 404,097; WO 1993/01161; Hudson et al., Nat. Med. 9: 129-134 (2003); and Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Triabodies and tetrabodies are also described in Hudson et al., Nat. Med. 9: 129-134 (2003).
(23) The Fab fragment contains the heavy- and light-chain variable domains and also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain, such as those of the monoclonal antibody produced by the 4B1 hybridoma (ATCC Patent Deposit Number PTA-127017). Fab fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab-SH is the designation herein for Fab in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab).sub.2 antibody fragments originally were produced as pairs of Fab fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
(24) The term Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions.
(25) Framework or FR refers to variable domain residues other than complementarity determining region (CDR) residues, such as those of the monoclonal antibody produced by the 4B1 hybridoma (ATCC Patent Deposit Number PTA-127017). The FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the CDR and FR sequences generally appear in the following sequence in either VH or VL sequences: FR1-CD1-FR2-CDR2-FR3-CDR3-FR4.
(26) The terms full length antibody, intact antibody, and whole antibody are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
(27) Fv refers to the minimum antibody fragment which contains a complete antigen-binding site, such as that of the monoclonal antibody produced by the 4B1 hybridoma (ATCC Patent Deposit Number PTA-127017). In one embodiment, a two-chain Fv species consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. In a single-chain Fv (scFv) species, one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a dimeric structure analogous to that in a two-chain Fv species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
(28) The class of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies in humans: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called , , , , and , respectively. In some embodiments, recombinant technology can be used to change the isotype of an antibody.
(29) The term epitope or antigenic determinant includes any protein or polypeptide determinant capable of specific binding to an immunoglobulin or T-cell receptor. In certain embodiments, epitope determinants include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three-dimensional structural characteristics, and/or specific charge characteristics. An epitope is a region of an antigen that is bound by an antibody. In certain embodiments, an antibody is said to specifically bind an antigen when it preferentially recognizes its target antigen in a complex mixture of proteins and/or macromolecules. Different epitopes may occupy the same or topological region of an antigen. With respect to -syn, antibodies that bind WT--syn (unphosphoylated at S129), pS129--syn, or that bind both forms of -syn, each bind distinct epitopes.
(30) The present disclosure also encompasses functional equivalents of the antibodies described in this specification. Functional equivalents have binding characteristics that are comparable to those of the antibodies, and include, for example, chimerized, humanized and single chain antibodies as well as fragments thereof. Methods of producing such functional equivalents are disclosed in PCT Application WO 93/21319, European Patent Application No. 239,400; PCT Application WO 89/09622; European Patent Application 338,745; and European Patent Application EP 332,424, which are incorporated in their respective entireties by reference. Functional equivalents include polypeptides with amino acid sequences substantially the same as the amino acid sequence of the variable or hypervariable regions of the antibodies disclosed herein, such as the monoclonal antibody produced by the 4B1 hybridoma (ATCC Patent Deposit Number PTA-127017). Substantially the same as applied to an amino acid sequence is defined herein as a sequence with at least about 90%, and more preferably at least about 95% sequence identity to another amino acid sequence, as determined by the FASTA search method in accordance with Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85, 2444-2448 (1988) and retaining binding specificity to the target antigen. Thus some embodiments are functionally equivalent to, or substantially similar to, the amino acid sequence of the monoclonal antibody produced by the 4B1 hybridoma (ATCC Patent Deposit Number PTA-127017).
(31) Some embodiments are antibodies comprising an antigen binding portion that is a functional equivalent of the antigen binding portion of the herein disclosed antibodies. Such antibodies are encompassed by the term antibody means for binding WT--syn or simply means for binding WT--syn.
(32) One aspect is a monoclonal antibody that specifically binds aggregated, non-phosphorylated -synuclein (an anti-WT--syn antibody). In some embodiments, the antibody does not bind to phosphorylated -synuclein. In some embodiments, the antibody does not bind to non-phosphorylated -synuclein monomers. In some embodiments, the epitope recognized includes the serine residue at position 129 of -synuclein, a site at which -synuclein becomes phosphorylated. In some embodiments, the antibody recognizes, and can be induced by, a peptide comprising or consisting of amino acid residues 125-133 of -synuclein (SEQ ID NO:1), namely YEMPSEEGY (SEQ ID NO: 2), for example, the peptide CYEMPSEEGY (SEQ ID NO: 3). Such antibodies can be referred to as means for specifically binding to aggregated, non-phosphorylated -synuclein. Some embodiments are compositions comprising a monoclonal antibody that binds aggregated, non-phosphorylated -synuclein and a carrier, solvent, buffer, or other excipient. In some embodiments, the antibody is the monoclonal antibody produced by the hybridoma 4B1, ATCC Patent Deposit Number PTA-127017.
(33) In various embodiments, the monoclonal antibody that specifically binds aggregated, non-phosphorylated -synuclein does not bind one or more of pS129--syn, S129A--syn (in which serine is replaced with alanine), -synuclein, or -synuclein. In various embodiments binding specificity is determined by western blot, ELISA, slot blot, or any combination thereof. In some embodiments, the antibody has high affinity to an epitope comprising amino acids 125-133 of -synuclein with non-phosphorylated Ser at position 129 of -synuclein. In some embodiments, the epitope is linear. In some embodiments, the antibody has high affinity for -synuclein aggregates but low affinity for -synuclein monomers. In a facet of these embodiments, the -synuclein aggregates are protofibrils or soluble oligomers of -synuclein and the antibody can have high affinity for the protofibrils, the soluble oligomers, or both. In other facets of these embodiments, the -synuclein aggregates are -synuclein fibrils.
(34) One aspect is a method of generating an antibody that binds, or antiserum specific for, aggregated, non-phosphorylated -synuclein comprising immunizing a mouse or other laboratory animal (for example, a rat, a hamster, or a rabbit) or an agricultural animal (for example, a goat, a sheep, or a horse) with a peptide comprising of amino acid residues 125-133 of -synuclein (SEQ ID NO:1), namely YEMPSEEGY (SEQ ID NO: 2), for example, the peptide CYEMPSEEGY (SEQ ID NO: 3) may be referred to as means for inducing antibodies recognizing aggregated, non-phosphorylated -synuclein. In some embodiments, the immunizing peptide is conjugated to a carrier protein, for example, keyhole limpet hemocyanin, Concho/epas concholepas hemocyanin, bovine serum albumin, ovalbumin, or diphtheria or tetanus toxoid. In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the method further comprises standard procedures for generating and selecting hybridomas, as are known to those of skill in the art. Some embodiments are a monoclonal antibody generated by any of these methods.
(35) One aspect is an antibody that binds, or antiserum specific for, aggregated, non-phosphorylated -synuclein made by a process comprising immunizing a mouse with a peptide comprising or consisting of amino acid residues 125-133 of -synuclein (SEQ ID NO: 1), namely YEMPSEEGY (SEQ ID NO: 2), for example, the peptide CYEMPSEEGY (SEQ ID NO: 3). Some embodiments further comprise applying hybridoma technology or molecular cloning technology to obtain a monoclonal antibody.
(36) Some embodiments are a monoclonal antibody generated by (or made by a process comprising) immunizing a laboratory animal with means for inducing antibodies recognizing aggregated, non-phosphorylated -synuclein. In some embodiments, the laboratory animal is a mouse. In some embodiments, the means for inducing antibodies recognizing aggregated, non-phosphorylated -synuclein are conjugated to a carrier protein. In some embodiments, the carrier protein is keyhole limpet hemocyanin. In some embodiments, the means for inducing antibodies recognizing aggregated, non-phosphorylated -synuclein is the peptide CYEMPSEEGY (SEQ ID NO:3). Some embodiments further comprise screening hybridomas for reactivity of the antibody against recombinant WT--syn. Some embodiments further comprise a counter-screens for a lack of reactivity of the antibody against one or more of pS129--syn, S129A--syn (in which serine is replaced with alanine), -synuclein, or -synuclein. In some embodiments, the screening (or counter-screening) comprises an ELISA. In some embodiments, the screening (or counter-screening) comprises filter retardation assay analysis.
(37) With respect to any of the antibody aspects, some embodiments are pharmaceutical compositions comprising the antibody. A pharmaceutical composition is one intended and suitable for the treatment of disease in humans. That is, it provides overall beneficial effect and does not contain amounts of ingredients or contaminants that cause toxic or other undesirable effects unrelated to the provision of the beneficial effect. A pharmaceutical composition will contain one or more active agents and may further contain solvents, buffers, diluents, carriers, and other excipients to aid the administration, solubility, absorption or bioavailability, and or stability, etc. of the active agent(s) or overall composition. A pharmaceutically acceptable carrier, diluent, or excipient is a medium generally accepted in the art for the delivery of biologically active agents to mammals, e.g., humans. The compounds of the present invention can be formulated as pharmaceutical compositions using a pharmaceutically acceptable carrier, diluent, or excipient and administered by a variety of routes. In particular embodiments, such compositions are for oral or intravenous administration. Such pharmaceutical compositions and processes for preparing them are well known in the art. See, e.g., REMINGTON: THE SCIENCE AND PRACTICE OF PHARMACY (A. Gennaro, et al., eds., 19.sup.th ed., Mack Publishing Co., 1995).
(38) Aspects of the present specification provide, in part, administering a therapeutically or prophylactically effective amount of an anti--synuclein antibody or a pharmaceutical composition thereof. As used herein, the term therapeutically effective amount is synonymous with therapeutically effective dose and when used in reference to treating a neurodegenerative disorder associated with -synuclein, such as Parkinson's disease, dementia with Lewy bodies, Alzheimer's disease, or multiple system atrophy, means at least the minimum dose of a compound or composition disclosed herein necessary to achieve the desired therapeutic or prophylactic effect. In some embodiments, it refers to an amount sufficient to prevent, slow, or halt the neurodegenerative process. In some embodiments, it includes a dose sufficient to reduce a symptom associated with the neurodegenerative disease. An effective dosage or amount of an anti--synuclein antibody or a composition thereof can readily be determined by the person of ordinary skill in the art considering all criteria (for example, the rate of excretion of the compound or composition used, the pharmacodynamics of the compound or composition used, the nature of the other compounds to be included in the composition, the particular route of administration, the particular characteristics, history and risk factors of the individual, such as, e.g., age, weight, general health and the like, the response of the individual to the treatment, or any combination thereof) and utilizing his best judgment on the individual's behalf.
(39) The terms treatment, treating, etc., refer to the medical management of a patient with the intent to cure, ameliorate, stabilize, or prevent a disease, pathological condition, or disorder. This term includes active treatment, that is, treatment directed specifically toward the improvement of a disease, pathological condition, or disorder, and also includes causal treatment, that is, treatment directed toward removal of the cause of the associated disease, pathological condition, or disorder. In addition, this term includes palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder. Various embodiments may specifically include or exclude one or more of these modes of treatment. The herein disclosed anti--synuclein antibodies may be used as medicaments for the treatment of -synuclein-associated neurodegenerative disorders. Further embodiments are methods of treating -synuclein-associated neurodegenerative disorders comprising administering an anti--synuclein antibody to a subject in need thereof. In some embodiments, the -synuclein-associated neurodegenerative disorder is Parkinson's disease, dementia with Lewy bodies, Alzheimer's disease, or multiple system atrophy. In some embodiments, the subject in need thereof is a human. In some embodiments, the antibody may be administered directly to the site of -synuclein aggregate deposit, e.g. a Lewy body, such as by injection into a blood vessel supplying the brain or into the brain itself.
(40) As formation of aggregates of unphosphorylated -synuclein appear to precede the inclusion of phosphorylated -synuclein in the aggregates, use of an antibody with specificity for the unphosphorylated form can allow earlier or more effective intervention to slow, halt, or reverse progression of the neurodegenerative disease. Thus, some methods of treating -synuclein-associated neurodegenerative disorder comprise managing or delaying the onset of the condition, or reducing the risk of developing or worsening of the condition. In various instances, the -synuclein-associated neurodegenerative disorder is Parkinson's disease, dementia with Lewy bodies, Alzheimer's disease, or multiple system atrophy.
(41) Further embodiments, comprise altering the treatment regime of the individual based on the comparison of the detected levels of antibody--synuclein complexes with the reference level, as described below. The treatment regime can be altered by changing the drugs administered to treat the disease and/or changing the frequency and/or dose of the drug administered, depending on the progression of the disease. An increased level of the complex compared to a base line level will typically indicate that the individual has or is in the process of developing an -synuclein pathology. The base line level will typically be calculated from a sample from an individual known not to have an -synuclein pathology (a normal individual) or from an earlier test of a sample taken from the same individual being tested.
(42) One aspect is a method of making a monoclonal antibody that binds aggregated, non-phosphorylated -synuclein comprising culturing a hybridoma that secretes the antibody and collecting the culture supernatant. Some embodiments further comprise purifying the antibody from the culture supernatant. The antibodies are suitably separated from the culture medium by conventional immunoglobulin purification procedures such as, for example, proteins G-Sepharose, protein A-Sepharose, hydroxyapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography. Following any preliminary purification step(s), the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations (e.g., from about 0-0.25 M salt). In some embodiments, the hybridoma is 4B1, ATCC Patent Deposit Number PTA-127017. Further embodiments are a monoclonal antibody that binds aggregated, non-phosphorylated -synuclein made by any of these method of making embodiments.
(43) One aspect comprises nucleic acid molecules encoding a monoclonal antibody, whole or fragment thereof, that specifically binds aggregated, non-phosphorylated -synuclein. In some embodiments, the nucleic acids encode a heavy chain variable domain with HCDR1-HCDR3 having the amino acid sequences of SEQ ID NOs: 7-9, respectively, and light chain variable domain with LCDR1-LCDR3 having the amino acid sequences of SEQ ID NOS: 13-15, respectively. In some embodiments, the nucleic acids encode a heavy chain variable domain having the amino acid sequence of SEQ ID NO; 6 and a light chain variable domain having the amino acid sequence of SEQ ID NO: 12. In some embodiments, the nucleic acid molecules encode a heavy chain having the amino acid sequence of SEQ ID NO; 5 and a light chain having the amino acid sequence of SEQ ID NO: 11. In some embodiments, the encoding nucleic acid molecules are isolated, that is, not associated with any sort of organism or cell. In some embodiments, the nucleic acid molecules are contained within a host cell capable of replicating the nucleic acids, for example, by being integrated into a plasmid in a bacterial cell. In some embodiments, the nucleic acid molecules are contained within a host cell capable of expressing the antibody from the nucleic acid molecules. In some embodiments, a nucleic acid molecule encoding the monoclonal antibody is cDNA. In some instances, the encoding cDNA is integrated into the genome of a host cell. In some instances, the encoding cDNA is episomal. In some embodiments, the nucleic acid molecules encoding the monoclonal antibody is mRNA. In some instances, the uridine residues in the mRNA are substituted with a modified nucleoside, for example, pseudouridine. In some instances, an isolated mRNA is formulated in a lipid nanoparticle. In some embodiments, the nucleic acid sequence encoding the light chain and the heavy chain are contained within a single nucleic acid molecule. In some embodiments, the nucleic acid sequence encoding the light chain and the heavy chain are contained within a separate nucleic acid molecules.
(44) With respect to the above aspects, in some embodiments, the monoclonal antibody that specifically binds aggregated, non-phosphorylated -synuclein comprises a heavy chain variable domain with HCDR1-HCDR3 having the amino acid sequences of SEQ ID NOs: 7-9, respectively, and a light chain variable domain with LCDR1-LCDR3 having the amino acid sequences of SEQ ID NOS: 13-15, respectively. In some embodiments, the monoclonal antibody that specifically binds aggregated, non-phosphorylated -synuclein comprises a heavy chain variable domain having the amino acid sequence of SEQ ID NO; 6 and a light chain variable domain having the amino acid sequence of SEQ ID NO: 12. In some embodiments, the monoclonal antibody that specifically binds aggregated, non-phosphorylated -synuclein comprises a heavy chain having the amino acid sequence of SEQ ID NO; 5 and a light chain having the amino acid sequence of SEQ ID NO: 11. These embodiments constitute means for binding WT--syn.
(45) With respect to the above aspects, in some embodiments, an antibody that specifically binds aggregated, non-phosphorylated -synuclein has a heavy chain and/or a light chain in which one or more of the CDRs have a variant amino acid sequence, wherein the variant CDR sequence(s) are at least 80, 85, 90, or 95% identical to SEQ ID NOs: 7-9 and 13-15, respectively, for HCDR1-2 and LCDR1-3. Amino acid sequence variants of the antibodies are prepared by introducing appropriate nucleotide changes into encoding nucleic acids, or by peptide synthesis. Such variants include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibodies of the examples herein. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct specifically binds aggregated, non-phosphorylated -synuclein. The amino acid changes also may alter post-translational processes of the variant antibodies, such as changing the number or position of glycosylation sites.
(46) A useful method for identification of certain residues or regions of the antibodies that are preferred locations for mutagenesis is called alanine scanning mutagenesis. A residue or group of target residues are identified (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with antigen. Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution. Thus, while the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined. For example, to analyze the performance of a mutation at a given site, alanine scanning or random mutagenesis is conducted at the target codon or region and the expressed antibody variants are screened for the desired activity.
(47) Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to an epitope tag. Other insertional variants of the antibody molecules include the fusion to the N- or C-terminus of the antibody of an enzyme or a polypeptide which increases the serum half-life of the antibody.
(48) Another type of variant is an amino acid substitution variant. These variants have at least one amino acid residue in the antibody molecule removed and a different residue inserted in its place. The sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated. Conservative substitutions are shown in Table 1 under the heading of preferred substitutions. If such substitutions result in a change in biological activity, then more substantial changes, denominated exemplary substitutions in Table 1, or as further described below in reference to amino acid classes, may be introduced and the products screened.
(49) TABLE-US-00001 TABLE 1 Original Exemplary Preferred Residue Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Asp; Lys; Arg Gln Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gln (Q) Asn; Glu Asn Glu (E) Asp; Gln Asp Gly (G) Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; Leu Norleucine Leu (L) Norleucine; Ile; Val; Met; Ile Ala; Phe Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala; Leu Norleucine
(50) Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues are divided into groups based on common side-chain properties: (1) Hydrophobic: Norleucine, Met, Ala, Val, Leu, lie; (2) Neutral hydrophilic: Cys, Ser, Thr; (3) Acidic: Asp, Glu; (4) Basic: Asn, Gin, His, Lys, Arg; (5) Residues that influence chain orientation: Gly, Pro; and (6) Aromatic: Trp, Tyr, Phe.
(51) Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
(52) Any cysteine residue not involved in maintaining the proper conformation of the antibodies also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking. Conversely, cysteine bond(s) may be added to the antibody to improve its stability (particularly where the antibody is an antibody fragment such as an Fv fragment).
(53) Another type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized or human antibody). Generally, the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated. A convenient way for generating such substitutional variants is affinity maturation using phage display. Briefly, several hypervariable region sites (e.g., 6-7 sites) are mutated to generate all possible amino substitutions at each site. The antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of M13 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g., binding affinity) as herein disclosed. In order to identify candidate hypervariable region sites for modification, alanine scanning mutagenesis can be performed to identified hypervariable region residues contributing significantly to antigen binding. Alternatively, or in addition, it may be beneficial to analyze a crystal structure of the antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues are candidates for substitution according to the techniques elaborated herein. Once such variants are generated, the panel of variants is subjected to screening as described herein and antibodies with superior properties in one or more relevant assays may be selected for further development.
(54) Another type of amino acid variant of the antibody alters the original glycosylation pattern of the antibody. By altering is meant deleting one or more carbohydrate moieties found in the antibody, and/or adding one or more glycosylation sites that are not present in the antibody.
(55) Glycosylation of antibodies is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
(56) Addition of glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
(57) Nucleic acid molecules encoding amino acid sequence variants of the antibodies are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non-variant version of an antibody that specifically binds aggregated, non-phosphorylated -synuclein.
(58) It has been observed that not all CDRs, or the original light chain, are necessarily required to maintain antibody binding specificity. In some embodiments, the antibody that binds aggregated, non-phosphorylated -synuclein has a heavy chain comprising one or two, but not all three, of SEQ ID NOs: 7-9 and/or a light chain comprising one or two, but not all three, of SEQ ID NOs:13-15. In other embodiments, the antibody that binds aggregated, non-phosphorylated -synuclein comprises only the heavy chain of the herein disclosed antibodies, or comprises the heavy chain paired with a light chain not previously associated with specificity for aggregated, non-phosphorylated -synuclein. In some instances, such an alternative light chain is a kappa light chain. In some instances, such an alternative light chain variable region is derived from germline V-gene IGKV1-110*01, IGKV1-110*02, or IGKV1-117*01.
(59) The antibodies disclosed herein may be produced by recombinant means. Thus, disclosed herein are nucleic acids encoding the antibodies, expression vectors containing nucleic acids encoding the antibodies, and cells comprising the nucleic acid encoding the antibodies. Methods for recombinant production are widely known in the state of the art and comprise protein expression in prokaryotic and eukaryotic cells with subsequent isolation of the antibody and usually purification to a pharmaceutically acceptable purity. For the expression of the antibodies as aforementioned in a host cell, nucleic acids encoding the antibody sequences are inserted into expression vectors by standard methods. Expression is performed in appropriate prokaryotic or eukaryotic host cells like CHO cells, NSO cells, SP2/0 cells, HEK293 cells, COS cells, PER.C6 cells, yeast, or E. coli cells, and the antibody is recovered from the cells (supernatant or cells after lysis). More recently, the use of mRNA to transform cells in vitro and in vivo to produce a protein of interest has become more widespread. Methods of making and using mRNA for such purposes is described, for example, in US20110143397A1, US20090286852A1, and WO2013102203A1, each of which is incorporated by reference for all that they teach in regard to such purposes.
(60) Accordingly, certain embodiments disclosed herein include a method for the preparation of an an antibody that specifically binds aggregated, non-phosphorylated -synuclein, comprising the steps of a) transforming a host cell with at least one expression vector comprising nucleic acid molecules encoding the antibody; b) culturing the host cell under conditions that allow synthesis of the antibody molecule; and c) recovering said antibody molecule from the culture.
(61) As used herein, the expressions cell, cell line, and cell culture are used interchangeably and all such designations include progeny. Thus, the words transformants and transformed cells include the primary subject cell and cultures derived therefrom without regard for the number of passages. It is also understood that all progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Variant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
(62) The term transformation as used herein refers to process of transfer of a vectors/nucleic acid into a host cell. If cells without formidable cell wall barriers are used as host cells, transfection can be carried out e.g. by the calcium phosphate precipitation method. However, other methods for introducing DNA into cells such as by nuclear injection or by protoplast fusion may also be used. If prokaryotic cells or cells which contain substantial cell wall constructions are used, e.g. one method of transfection is calcium treatment using calcium chloride.
(63) As used herein, expression refers to the process by which a nucleic acid is transcribed into mRNA and/or to the process by which the transcribed mRNA (also referred to as transcript) is subsequently being translated into peptides, polypeptides, or proteins. The transcripts and the encoded polypeptides are collectively referred to as gene product. If the polynucleotide is derived from genomic DNA, expression in a eukaryotic cell may include splicing of the mRNA.
(64) A vector is a nucleic acid molecule, in particular self-replicating, which transfers an inserted nucleic acid molecule into and/or between host cells. The term includes vectors that function primarily for insertion of DNA or RNA into a cell (e.g., chromosomal integration), replication of vectors that function primarily for the replication of DNA or RNA, and expression vectors that function for transcription and/or translation of the DNA or RNA. Also included are vectors that provide more than one of the functions as described.
(65) An expression vector is a polynucleotide which, when introduced into an appropriate host cell, can be transcribed and translated into a polypeptide. An expression system usually refers to a suitable host cell comprised of an expression vector that can function to yield a desired expression product.
(66) The term host cell as used herein denotes any kind of cellular system which can be engineered to generate the antibodies disclosed herein. In one embodiment HEK293 cells and CHO cells are used as host cells.
(67) The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, enhancers and polyadenylation signals.
(68) A nucleic acid is operably linked when it is placed in a functional relationship with another nucleic acid sequence. For example, DNA for a pre-sequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a pre-protein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, operably linked means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading frame. However, enhancers do not have to be contiguous. Similarly, in some instances an intron may be present between nucleic acid sequences that are operably linked. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, then synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
(69) For recombinant production of the antibodies, the nucleic acid encoding it may be isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression. In some embodiments, the antibody may be produced by homologous recombination, e.g. as described in U.S. Pat. No. 5,204,244, specifically incorporated herein by reference for all it discloses regarding antibody production. DNA encoding the antibody is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody). Many vectors are available. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence, e.g., as described in U.S. Pat. No. 5,534,615, specifically incorporated herein by reference for all it discloses regarding protein expression.
(70) Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, or higher eukaryote cells described above. Suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., S. typhimurium, Serratia, e.g., S. marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis, Pseudomonas such as P. aeruginosa, and Streptomyces. One exemplary E. coli cloning host is E. coli 294 (ATCC 31,446), although other strains such as E. coli B, E. coli X1776 (ATCC 31,537), and E. coli W3110 (ATCC 27,325) are suitable. These examples are illustrative rather than limiting.
(71) In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms. However, a number of other genera, species, and strains are commonly available and useful herein, such as Schizosaccharomyces pombe; Kluyveromyces hosts such as, e.g., K. lactis, K. fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K. waltii (ATCC 56,500), K. drosophilarum (ATCC 36,906), K. thermotolerans, and K. marxianus; Yarrowia (EP 402,226); Pichia pastoris (EP 183,070); Candida; Trichoderma reesia (EP 244,234); Neurospora crassa; Schwanniomyces such as S. occidentalis; and filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium, and Aspergillus hosts such as A. nidulans and A. niger.
(72) Suitable host cells for the expression of glycosylated antibodies are derived from multicellular organisms, including invertebrate cells such as plant and insect cells. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar), Aedes aegypti (mosquito), Aedes albopictus (mosquito), Drosophila melanogaster (fruitfly), and Bombyx mori have been identified. A variety of viral strains for transfection are publicly available, e.g., the L-1 variant of Autographa californica NPV and the Bm-5 strain of B. mori NPV, and such viruses may be used as the virus herein according to the present invention, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, and tobacco can also be utilized as hosts.
(73) However, interest has been greatest in vertebrate cells, and propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR (CHO); mouse sertoli cells (TM4); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells; MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
(74) Host cells are transformed with the above-described expression vectors for antibody production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
(75) The host cells used to produce the antibodies may be cultured in a variety of media. Commercially available media such as Ham's F10, Minimal Essential Medium (MEM), RPMI-1640, and Dulbecco's Modified Eagle's Medium (DMEM) are suitable for culturing the host cells. In addition, U.S. Pat. Nos. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or U.S. Pat. No. 5,122,469; WO 90/03430; WO 87/00195; or US Re. 30,985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as GENTAMYCIN), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art. The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
(76) When using recombinant techniques, the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration.
(77) The antibody composition prepared from the cells can be purified using, for example, hydroxyapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being the preferred purification technique. The suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody. Protein A can be used to purify antibodies that are based on human yl, 2, or 4 heavy chains. Protein G is recommended for all mouse isotypes and for human 3. The matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the antibody comprises a CH3 domain, the Bakerbond ABX resin is useful for purification. Other techniques for protein purification such as fractionation on an ion-exchange column, ethanol precipitation, Reverse Phase HPLC, chromatography on silica, chromatography on heparin SEPHAROSE chromatography on an anion or cation exchange resin (such as a polyaspartic acid column), chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available depending on the antibody to be recovered.
(78) Following any preliminary purification step(s), the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations (e.g., from about 0-0.25 M salt).
(79) Various aspects are a hybridoma that produces an antibody that specifically binds aggregated, non-phosphorylated -synuclein. In some embodiments, the hybridoma is 4B1, ATCC Patent Deposit Number PTA-127017. One aspect is a hybridoma generated by a method comprising immunizing a mouse with a peptide comprising or consisting of amino acid residues 125-133 of -synuclein (SEQ ID NO: 1), namely YEMPSEEGY (SEQ ID NO: 2), for example, the peptide CYEMPSEEGY (SEQ ID NO: 3). One aspect is a hybridoma that produces an antibody that binds aggregated, non-phosphorylated -synuclein comprising immunizing a mouse with a peptide comprising or consisting of amino acid residues 125-133 of -synuclein, namely YEMPSEEGY (SEQ ID NO: 2), for example, the peptide CYEMPSEEGY (SEQ ID NO: 3).
(80) One aspect is an immunoassay utilizing an anti-WT--syn antibody to detect or quantitate WT--syn. An exemplary, non-limiting immunoassay is an enzyme-linked immunosorbent assay (ELISA). In other embodiments, the immunoassay is an immunohistochemical assay. Immunoassays measure substances, such as analytes, proteins, etc., using the specificity of an antibody to the substance. In some embodiments, the anti-WT--syn antibody is the antibody produced by the hybridoma is 4B1, ATCC Patent Deposit Number PTA-127017. In some embodiments, the immunoassay may further utilize an antibody specific for pS129--syn.
(81) One aspect is a sandwich ELISA. In such an assay, a capture antibody specific for the substance is associated with a solid support, such as a microtiter plate. A liquid containing the substance (or suspected of containing the substance, or a sample in need of determining not to include the substance) is allowed to bind to the capture antibody. Then a detection antibody, also specific for the substance, is added to allow detection of substance bound to the capture antibody. In some embodiments, the anti-WT--syn antibody is coated on the surface of a microtiter well or bead and used as the capture reagent and a pan--syn antibody is used as the detection reagent. In other embodiments, a pan--syn antibody is used as the capture reagent and the anti-WT--syn antibody is used as the detection reagent. In some embodiments, the pan--syn antibody is 11D12 (Majbour et al., Mol Neurodegener. 11, 7, 2016)
(82) Another aspect is an immunohistochemical assay. Immunohistochemistry involves the process of selectively imaging antigens (proteins) in a tissue section by exploiting the principle of antibodies binding specifically to antigens in biological tissues. Visualizing an antibody-antigen interaction can be accomplished in a number of ways. In the most common instance, a detection antibody is used which allows the detection of the anti--synuclein antibody and thus the substance to which the antibody is bound.
(83) In some embodiments, the detection antibody is a labeled antibody. In other embodiments, the anti--synuclein antibody is labeled. The label can include a radioactive label, an enzyme label, a colorimetric label, a fluorescent label, a chemiluminescent label, or other labels known to persons of skill in the art. In some such embodiments, the detection antibody is biotinylated so that it can bind an enzyme-linked avidin molecule, such as streptavidin conjugated with horseradish peroxidase or alkaline phosphatase. In alternative embodiments, avidin molecule is conjugated with another detectable label, for example, a fluorescent dye or quantum dot. In some embodiments, the detection antibody is directly labeled. Still further alternatives are familiar to one of skill in the art.
(84) In further embodiments in which the anti--synuclein antibody is labeled, the anti--synuclein antibody is used for in vivo imaging by administering the labeled anti--synuclein antibody to a subject and detecting the label.
(85) In some embodiments, the label is an enzymatic label such as a peroxidase (e.g., horseradish peroxidase), a galactosidase (e.g., -D-galactosidase), or a phosphatase (e.g., alkaline phosphatase). For enzymatic labels, a substrate is needed which is cleaved by the enzyme to produce a color, fluorescence, or luminescence, which is measured spectrophotometrically. Exemplary colorimetric substrates for peroxidase include, but are not limited to, 3,3,5,5-tetramethylbenzidine (TMB), 3,3,4,4 diaminobenzidine (DAB), 4-chloro-1-naphthol (4CN), 2,2-azino-di [3-ethylbenzthiazoline]sulfonate (ABTS), and o-phenylenediamine (OPD). In some embodiments, when the assay is an ELISA, the substrate is TMB which produces a blue color which is measured at a wavelength of 650 nm. The reaction can be halted by addition of acid or another stop reagent. Using a sulfuric acid stop solution turns TMB yellow and the color can then be read at 450 nm. Exemplary colorimetric substrates for phosphatase include, but are not limited to, 5-bromo-4-chloro-3-indolyl-phosphate/nitroblue tetrazolium (BCIP/NBT) and p-nitrophenylphosphate (p-NPP). Exemplary colorimetric substrates for galactosidase include, but are not limited to, 5-dodecanoylaminofluorescein di-3-D-galactopyranoside (C12FDG), 9H-(1,3-dichloro-9,9-dimethylacridin-2-one-7-yl), and -D-galactopyranoside (DDAO galactoside). Exemplary fluorescent substrates include, but are not limited to, 4-methylumbelliferyl phosphate (4-MUP; for phosphatase), and 4-methylumbelliferyl galactoside (MUG; for galactosidase), fluorescein di--D-galactopyranoside (FDG; for galactosidase), hydroxyphenylacetic acid (HPA; for peroxidase), and 3-p-hydroxyphenylproprionic acid (HPPA; for peroxidase). Exemplary luminescent substrates include, but are not limited to, luminol, polyphenols (e.g., pyrogallol, pupurogallin, gallic acid, and umbelliferone) and acridine esters, and luciferin for peroxidase; 3-(2-spiroadamantane)-4-methyl-4-(3-phosphoryloxyphenyl-1, 2-dioxetane, disodium salt) (AMPPD) for phosphatase; and (3-(2-spiroadamantane)-4-methoxy-4-(3--D-galactopyranosyloxyphenyl-1,2-dioxetane (AMPGD) for galactosidase.
(86) In some embodiments, the label is horseradish peroxidase and the substrate is TMB.
(87) In some embodiments, the label is a colorimetric label, a fluorescent label, or a luminescent label. An exemplary colorimetric label includes, but is not limited to, nanoparticulate gold. Exemplary fluorescent labels include, but are not limited to, ethidium bromide, fluorescein and its derivatives, rhodamine and its derivatives, green fluorescent protein, Texas Red, Cascade Blue, Oregon Green, Marina Blue, an atto label, a CF dye, an Alexa Fluor, and a cyanine dye. Exemplary luminescent labels include, but are not limited to, luciferin and firefly luciferase.
(88) With respect to the assay aspects, some embodiments the assay is used as a diagnostic assay to determine whether or not an individual has a neurodegenerative disease associated with -synuclein, for example, Parkinson's disease, dementia with Lewy bodies, Alzheimer's disease, or multiple system atrophy. In some embodiments, the diagnostic assay comprises adding the antibody to a biological sample from a subject, and detecting the presence or absence of a complex formed between -synuclein aggregates and the antibody or fragment.
(89) In some embodiments, the method of diagnosing a neurodegenerative disease associated with -synuclein comprises administering an antibody that specifically binds aggregated, non-phosphorylated -synuclein to an individual and detecting the presence or absence of -synuclein aggregates. In alternative embodiments, the method of diagnosing a neurodegenerative disease associated with -synuclein comprises mixing the antibody with a sample from the patient (for example, biopsied tissue or cerebrospinal fluid (CSF). The presence of -synuclein aggregates indicates that the individual has a neurodegenerative disease and the absence of -synuclein aggregates indicates that the subject does not have the neurodegenerative disease.
(90) In one embodiment the method of diagnosing a neurodegenerative disease associated with -synuclein comprises: adding an antibody that specifically binds aggregated, non-phosphorylated -synuclein to a sample from an individual; detecting the presence of a complex formed between the -synuclein aggregates and the antibody; and determining whether or not the individual has a neurodegenerative disease associated with -synuclein.
(91) Determining whether or not the individual has a neurodegenerative disease can comprise comparing the levels of the antibody--synuclein complex formed in a sample with a reference level and determining whether the levels of complexes formed in the sample is greater than a reference level associated with the non-diseased state or less than a reference level associated with a diseased state.
(92) In some embodiments, the antibody that specifically binds aggregated, non-phosphorylated -synuclein is used to diagnose whether an individual has Parkinson's disease. A CSF sample is taken from the patient, antibody is contacted with the sample in conditions effective to allow complexes to form between the antibodies and aggregated -synuclein present in the sample, and the presence of the antibody--synuclein complexes are then detected. The amount of complexes formed can be measured and compared to a reference level.
(93) A correlation has been shown to exist between CSF -synuclein oligomers levels and disease severity. Detecting the presence and/or amount of the oligomers or fibrils in the sample can be used to follow the progression and or severity of a neurodegenerative disease, in particular for using the antibodies as a biomarker in Parkinson diseases and other diseases associated with -synuclein pathologies.
(94) Further embodiments comprise monitoring the progress of a neurodegenerative disease associated with -synuclein by: adding an antibody that specifically binds aggregated, non-phosphorylated -synuclein to a sample from an individual and detecting the presence of a complex formed between the -synuclein aggregates and the antibody The progression or improvement of disease over time can be assessed by determining if levels of the antibody--synuclein complexes are increasing or decreasing in comparison to one or more earlier patient samples or to a reference level.
(95) As formation of aggregates of unphosphorylated -synuclein appear to precede the inclusion of phosphorylated -synuclein in the aggregates, use of an antibody with specificity for the unphosphorylated form can allow earlier detection of aggregates and earlier diagnosis.
(96) In some embodiments, the antibody that specifically binds aggregated, non-phosphorylated -synuclein can be used in an ELISA to measure aggregated -synuclein in CFS. The antibody can be used to measure aggregated -synuclein in a sample with high sensitivity and specificity compared to ELISA using other antibodies. In particular, an ELISA using the antibody that specifically binds aggregated, non-phosphorylated -synuclein has a higher sensitivity and specificity to detect unphosphorylated -synuclein oligomers and protofibrils in CSF as compared to an ELISA using monoclonal antibodies without this specificity as a capture antibody and/or detection antibody.
(97) The methods can be used to monitor the effectiveness of a therapeutic agent, by using the results of the analysis undertaken. An effective therapeutic agent can be determined as one that causes a decrease in the amount of -synuclein aggregates present in a sample taken from the patient, as compared to a reference value. The reference value may reflect the amount of -synuclein in the patient before treatment, or may represent a typical amount of -synuclein to be found in untreated patients.
(98) With respect to the assay aspects, some embodiments comprise a test kit comprising an anti--synuclein antibody and other reagents or equipment needed to carry out the assay.
EXAMPLES
(99) The following non-limiting examples are provided for illustrative purposes only in order to facilitate a more complete understanding of representative embodiments now contemplated. These examples should not be construed to limit any of the embodiments described in the present specification,
Example 1
Generation of Monoclonal Antibody Recognizing Non-Phosphorylated S129--Synuclein (WT--Syn) Aggregates
(100) A short synthetic peptide, CYEMPSEEGY (SEQ ID NO:3), designed over the region of interest (amino acids 125-133 of -syn; YEMPSEEGY (SEQ ID NO:2)), was used as the immunogen. This peptide was solubilized in phosphate-buffered saline (PBS) and conjugated to keyhole limpet hemocyanin (KLH) as carrier protein. Experimental procedures using mice were carried out in accordance with Laboratory Animal Research Center (LARC), Qatar University (QU), Qatar, according to the QU institutional ethical rules and regulations and approved by QUIACUC & IBC. Specifically, female BALB/c mice (6-8 weeks old) were injected subcutaneously with the immunogen conjugate. Ten days post booster immunization, blood was collected from the tail vain and titer response was evaluated using indirect ELISA. Mice exhibiting a strong immune response were subjected to a final immunization before euthanization. Following hybridoma generation, monoclonal antibodies specific for WT--syn were obtained. Culture supernatants were tested for secreted anti--syn antibodies using indirect ELISA.
(101) For the indirect ELISA, a 96-well clear plate was coated with recombinant WT--syn and incubated overnight at 4 C. The following day, the plate was blocked with blocking buffer (PBST containing 2.25% gelatin) for 1 hour at RT. The plate was then washed three times with PBST, and antisera from the mice, or culture supernatants, were added in serial dilutions. Next, the plate was washed and goat anti-mouse IgG-HRP (1:20 K, Jackson ImmunoResearch) was added. The plate was washed again and detected with TMB substrate (Abcam). Following color development, the reaction was stopped by addition of 0.6 N H.sub.2SO.sub.4 and the absorbance was measured at 450 nm.
(102) To generate hybridoma, splenocytes were fused with mouse myeloma cells (Sp2OAg14; American Type Culture Collection) at a ratio of 5:1 and fusion was induced using 50% polyethylene glycol. Fused cells were seeded in 96-well plate in IMDM media (Gibco) containing HAT (Sigma). Positive clones were transferred to 24-well plates and screened multiple times to ensure stability.
(103) For isotyping, culture supernatant was screened against anti-mouse heavy chain antibodies (Isotyping Kit, Sigma-Aldrich) in ELISA and only IgG-positive clones were selected. Those were subjected to single-cell cloning. Wells with single clones were grown to confluency and screened at least three times for further selection of stable clones. Selected clones were grown in CDM4mAb media (Hyclone) to confluency. Culture supernatant was then collected and purified using protein-G agarose affinity chromatography (Sigma-Aldrich). Several monoclonal antibodies were produced, purified and thoroughly characterized. An IgG1 monoclonal antibody designated 4E1 was selected for further characterization.
(104) The purity of 4E1 antibody was assessed using SDS-PAGE under reducing conditions. The specificity of 4E1 for recombinant WT-, pS129-, or mutated S129A--syn (with a substitution of serine 129 to alanine) proteins was assessed by western blot. The data showed that 4E1 is specific for WT--syn and did not recognize pS129--syn (
(105) Hybridoma 4B1 was deposited with the American Type Culture Collection, 10801 University Boulevard, Manassas VA, 20110-2209 on Jun. 24, 2021 and given the Patent Deposit Number (accession number) PTA-127017.
Example 2
Specificity of 4B1 Towards WT--Syn Aggregates
(106) Using filter retardation assay, an assay that preserves the protein conformation, surprisingly we found that 4B1 only recognized WT--syn aggregates, and did not recognize the monomeric form of -syn protein (
(107) Given that -syn undergoes different conformational changes forming oligomers and amyloid fibrils, we further assessed the specificity of 4B1 antibody against different conformations of the protein. -Syn oligomers were prepared in vitro either through spontaneous formation during -syn fibrillization, or in the presence of a cross-linking reagent such as the lipid peroxidation products 4-oxo-2-nonenal (ONE) or 4-hydroxy-2-nonenal(HNE). Both oligomers hold distinct compositions and conformations (Uversky, Cell Mol Life Sci. 60(9):1852-1871, 2003; Pieri et al., Sci Rep. 6(24526), 2016). 4B1 showed higher affinity towards beta-sheet rich aggregates (fibrils, ONE-, or HNE-oligomers) (
Example 3
PS129 -Syn Inhibits -Syn Aggregation
(108) Knowing that under physiological conditions only 4% of -syn is phosphorylated at S129, we investigated the effect of pS129--syn on -syn aggregation. Pure monomeric -syn was mixed with different concentrations of pS129--syn (0-100%). Samples were incubated up to 20 days, and ThS binding assay showed the aggregation at various time points. As expected, the non-phosphorylated monomeric -syn aggregated gradually reaching approximately 35,000 ThS counts after 20 days of incubation (
Example 4
PS129 -Syn has Reduced Ability to Seed the Aggregation of -Syn
(109) We further assessed whether pS129--syn had an effect on seeding -syn aggregation. For this purpose, in vitro phosphorylated monomeric and aggregated recombinant -syn (characterized by immunoblotting and ThS binding (
Example 5
Inhibitory Seeding Effect of PS129--Syn on RT-QulC Assay
(110) Next, we evaluated the impact of phosphorylation at S129 on the seeded nucleation-dependent polymerization assay (RT-QuIC) for -syn (Fairfoul et al., Ann Clin Trans/Neurol. 3(10):812-818, 2016). This assay was carried out in the temporal and frontal cortex samples extracted from four PD and four DLB cases. We performed the assay using WT- and pS129--syn monomers. Interestingly, as shown in
(111) TABLE-US-00002 TABLE 1 RT-QuIC kinetic parameters of the relative seeding activity for monomeric -syn/pS129--syn in frontal and temporal regions extracted from PD and DLB cases. Amyloid formation F.sub.MAX lag-phase rate st dev (RFU 10.sup.3) Seed Substrate stdev (1/hours) stdev PD -syn 26 3.4 0.04 0.005 180 57 Frontal pS129-- 94 45 0.013 0.008 69.8 58.7 syn PD -syn 19.8 2.5 0.05 0.006 199 34.8 Temporal pS129-- 104 34 0.01 0.003 32.2 5 syn DLB -syn 37.8 6 0.027 0.005 131 93 Frontal pS129-- 132 31 0.007 0.0019 27.7 4 syn DLB -syn 22.5 4 0.045 0.008 259 0.571 Temporal pS129-- 88 45 0.013 0.006 118 99 syn
Example 6
Addition of PS129--Syn Monomers to Preformed Aggregates in Cells Did not Promote Seeding-Mediated Toxicity
(112) The cytotoxicity effect of pure seeds and fibrils (2, 5 and 10 M) on BE(2)-M17 and SH-SY5Y WT cells in the presence or absence of WT--syn monomers was evaluated. Both -syn species affected cell viability (both BE(2)-M17 and SH-SY5Y) at all tested concentrations as shown in
(113) To further emphasize the role of monomeric -syn in inducing the nucleation polymerization process of -syn, the effect of pure seeds and fibrils on the viability of BE(2)-M17 WT cells with siRNA silenced endogenous -syn was also examined. Immunoblotting and its corresponding quantification of -syn expression are shown in
(114) Our findings prompted us to study the effect of monomeric pS129--syn alone compared to WT--syn on the toxicity of both BE(2)-M17 and SH-SY5Y WT cells. Monomeric pS129--syn employed at a range of concentrations (0.31-20 M) did not show toxicity in BE(2)-M17 cells (
Example 7 pS129--syn seeds is less potent in seeding -syn aqqregation in cells
(115) To further investigate the seeding efficiency of -syn seeds in vitro, we used a stable cell line over-expressing -syn fused to EGFP (HEK293-aSyn-EGFP) undertheCMV promoter, to examine whether the exogenous addition of the different -syn seeds affected the seeding of endogenous -syn. We treated cells with either WT--syn seeds or pS129--syn seeds at a final concentration of 100 nM and incubated for four days. Control cells were exposed to vehicle only (PBS). Cells were then processed for microscopy and the percentage of cells with intracellular accumulation of -syn-EGFP was counted. Interestingly, we found that the internalized WT--syn seeds resulted in a significant increase of the -syn-EGFP inclusions, compared to control cells (
Example 8
WT--syn is predominant at early stages in a seeding dependent aggregation in vitro model of HEK cells
(116) Given the central role of seeding in inducing -syn fibril formation, seeding-dependent aggregation by mutant S129A--syn seeds, and the formation ofinsoluble pS129--syn was studied in an in-vitro cell model consisting of -syn expressing HEK cells. Insoluble pS129--syn was induced after a consecutive transfection of WT--syn and mutant S129A--syn seeds. These results indicate that pS129--syn is generated at later stages especially at 24 and 48 hours post seed treatment (
Example 9
Slice Culture Model Displays a Maturation of Aggregates with Increasing Phosphorylation at S129 Over Time
(117) In order to investigate any temporal developments in the structural composition of -syn aggregates, we employed a recently described organotypic slice culture model where -syn aggregation is induced by injection of S129A--syn PFF (Elfarash et al., Acta Neuropathol Commun. 7(213), 2019). Evaluating slices at both early and later time points after induction of aggregation and stained by 4B1 revealed a continuous decrease in both the WT--synstained proportion of aggregates and in the relative mean fluorescence intensity (MFI) of the WT--syn aggregate staining compared with the pS129--syn staining (
(118) To further investigate this maturation, analysis was stratified against morphology of aggregates, dividing them into four groups. At early time points (3-5 days post injection (dpi)), the predominant aggregate types are small and intermediate sized Lewy-neurite-like aggregates (LNs), while at later time points (7-14 dpi) large LNs and cell body inclusions start appearing. Thus, the changes in WT--syn area proportion and relative MFI might reflect differences between the various types of aggregates. Examining the individual aggregate types showed that all aggregate types possessed a core of WT--syn, which was surrounded by pS129--syn (
Example 10
PS129--syn occurs at a late stage in mice iniected with -syn preformed fibrils
(119) Immunohistochemical analysis of striatal sections from mice injected with PFFs showed accumulation of WT--syn at the early stages, mainly at one and two weeks post injection of PFFs (
Example 11
WT--Syn is Found in the Center of Most Lewy Pathological Lesions, and its Load Correlates Inversely with Disease Duration
(120) Immunohistochemical staining on PDD and DLB post-mortem human brain tissue demonstrated that WT--syn is found in Lewy neurites and Lewy bodies, though its load is approximately four-fold lower than total -syn labelled by a pan--syn antibody (
Example 12
Experimental Methods
(121) Expression and Purification of Recombinant Human -Syn
(122) Full-length recombinant human -syn was expressed in Escherichia coli BL21 (DE3) using the bacterial expression vector pRK172 (Vaikath et al., Neuropathol Appl Neurobiol. 45(6):597-608, 2019). Following expression and sedimentation, the bacterial pellets from 1 liter of Terrific broth (TB) were homogenized and sonicated in 50 ml of high-salt buffer (0.75 M NaCl, 10 mM Tris, pH 7.6, 1 mM EDTA) containing a cocktail of protease inhibitors (Thermo Scientific), heated to 100 C. for 10 min, and centrifuged at 5300 g for 20 min. The solution was dialyzed overnight against the buffer used for gel filtration chromatography (50 mM NaCl, 10 mM Tris, pH 7.6, 1 mM EDTA), following which, the volume was reduced to 5 ml using a Pierce protein concentrator (10K MWCO; ThermoFisher Scientific) according to the manufacturer's instructions. All proteins were purified by size exclusion using a Superdex 200 gel filtration column (GE Healthcare). The clean fractions were pooled, exchanged with a buffer (10 mM Tris pH 7.6, 25 mM NaCl, 1 mM EDTA, 1 mM PMSF) for ion exchange chromatography by dialysis overnight, and were applied onto a HiTrap Q column (GE Healthcare) and eluted in 10 mM Tris pH 7.6 using a linear gradient of 0.025-1.0 M NaCl. For preparation of -syn monomers, the protein went through 100 KDa filters to remove any high molecular weight proteins. Purified fractions were pooled, and protein concentrations were determined using the Pierce BCA protein assay kit (ThermoFisher Scientific).
(123) In Vitro Phosphorylation of -Syn
(124) Purified -syn was phosphorylated at S129 as described previously (Landeck et al., Mol Neurodegener. 11(61), 2016). Briefly, 1 g of Polo-like kinase 2 (PLK2) protein was added to 1.44 mg/ml (100 M) -syn in kinase reaction buffer (20 mM HEPES, 1.09 mM ATP, 2 mM DTT, 10 mM MgCl.sub.2, pH 7.4). The reaction mixture was incubated at 30 C. for 24 h.
(125) Aggregation of -Syn In Vitro
(126) The purity of -syn was >95% as estimated by SDS gels. The -syn samples were placed in 1.5 ml sterile polypropylene tubes and sealed with parafilm, followed by incubation at 37 C. for several days with continuous shaking at 800 rpm in a Thermomixer (Eppendorf). The samples were collected at the indicated time points, while the aggregation of -syn was monitored by ThS binding assay. The samples were stored at 80 C. for future analyses. Recombinant monomeric -syn was mixed with various percentages of in vitro prepared monomeric pS129--syn (100, 50, 20, 5 or 0%) in 1.5 ml sterile polypropylene tubes, followed by incubation for up to twenty days.
(127) Thioflavin-S(ThS) Assay
(128) A ThS binding assay was used to study -syn fibril formation. Being a fluorescent dye, ThS interacts with fibrils containing -sheet structures. The sample (10 l) was diluted in 40 l of ThS(20 M) in PBS and the mixture was dispensed in a 384-well, untreated black microplate (Nunc). Fluorescence was measured in a microplate reader (Perkin Elmer Envision) with the excitation and emission wavelengths at 450 and 510 nm, respectively.
Preparation of -syn pure fibrils and pure seeds
(129) Monomeric -syn (100 M) was aggregated as described above for 7 days. For preparation of pure fibrils, the crude -syn fibril sample was spun at 10,000g for 10 min at 4 C. in a refrigerated microfuge (Eppendorf). The supernatant was then discarded, and the pellet was washed twice and finally resuspended in1XPBS. For preparation of pure seeds, the pure fibrils were fragmented by ultrasonication while kept on ice using a Sonic ruptor 250, equipped with a fine tip (2 second pulses, output.of 40 watts for 5 min). For measurement of -syn concentration of both fibrils and seeds, the samples were denatured with equal volume of 6 M Guanidine-HCl and quantified using Pierce BCA protein assay kit (ThermoFisher Scientific).
(130) Seeded Polymerization Assay
(131) The aggregation of monomeric WT- or pS129--syn with or without addition of seeds was conducted as previously described (Di Giovanni et al., J Biol Chem. 285(20):14941-14954, 2010). The seeds (WT or pS129) were prepared by fragmenting mature -syn fibrils via sonication. Monomeric -syn (100 M) was seeded with different seed concentrations under incubation at 37 C. with continuous shaking. The fibril formation was assessed by the ThS binding assay.
(132) Isolation of TBS-Soluble Fraction from Brain Tissues
(133) Brain tissues derived from the temporal and frontal cortex were homogenized on ice with a glass tissue homogenizer at 10% (w/v) in TBS (20 mM Tris-HCl pH 7.4, 150 mM NaCl) and 5 mM EDTA with protease and phosphatase inhibitors (ThermoFisher Scientific). Samples were centrifuged at 3000g, at 4 C. for 30 min. The collected supernatant represents the TBS-soluble fraction. The total protein concentration was measured by BCA assay (ThermoFisher Scientific). Aliquots of 0.1 mg/mLwere prepared and stored at 80 C.
(134) Real Time Quaking-Induced Conversion (RT-QuIC) Assay
(135) The RT-QulC reaction buffer was composed of 0.1 M PIPES (pH 6.9), 0.1 mg/ml recombinant -syn and 10 M thioflavin-T (Th-T). Reactions were performed in triplicates in a black 96-well microplate with a clear bottom (Nunc) with 85 l of the reaction mix loaded into each well together with 15 l of 0.1 mg/ml TBS-soluble fractions. The plate was then sealed with a sealing tape (ThermoFisher) and incubated at 37 C. for 120 h in a BMG FLUOstar OMEGA plate reader with intermittent cyclesof 1 min shaking (500 rpm, double orbital) and 15 min rest throughout the indicated incubation time. Th-T fluorescence measurement, expressed as arbitrary relative fluorescence units (RFU), was taken with a bottom read every 15 min using 45010 nm (excitation) and 48010 nm (emission) wavelengths. A positive RT-QulC signal was defined as RFU more than 5 standard deviation units (RFU>5 SD) above the mean of initial fluorescence at 120 h. The sample was considered positive if two or more of the replicates were positive, otherwise the sample was classified as negative.
(136) RT-QulC Data Analysis
(137) The relative seeding activities of the assayed samples were presented by graphing fluorescence readouts against assay time. For each sample, we calculated three quantitative measures that can be used to analyze the RT-QulC data: (1) the lag-phase (RFU>5 SD); (2) the amyloid formation rate, expressed as the inverse (1/time to threshold) of the lag-phase (Kang et al., Biomed Res Int. 2017(5413936), 2017), (3) and the maximum fluorescence value (FMAX) measured at the end of the RT-QulC reaction. For the RT-QulC negative samples, the lag-phase was assigned as 150 hours.
(138) Tissue Culture of WT BE(2)-M17 Human Neuroblastoma Cells
(139) Human neuroblastoma cells (WT BE(2)-M17) were cultured in Dulbecco's MEM/Nutrient Mix F-12 (1:1) (Hyclone) containing 10% FBS (Hyclone) and 1% penicillin-streptomycin (P/S; 10,000 U/ml penicillin, 10 mg/ml streptomycin, Sigma). The cells were maintained at 37 C. in a humidified incubator with 5% CO.sub.2/95% air.
(140) Tissue Culture of WT SH-SY5Y Human Dopaminergic Neuroblastoma Cells
(141) Human dopaminergic neuroblastoma cells (WT SH-SY5Y) were cultured in Dulbecco's MEM/Nutrient Mix F-12 (1:1) containing 15% FBS, 1% penicillin-streptomycin (P/S; 10,000 U/ml penicillin, 10 mg/ml streptomycin), and supplemented with 1% non-essential MEM amino acid supplement (Gibco) and 2 mM freshly prepared glutamine. The cells were maintained at 37 C. in a humidified incubator with 5% CO.sub.2/95% air.
(142) Measurement of Cell Viability
(143) To assess the cytotoxic effect of different -syn species, cells were plated at a density of 15,000 cells (100 l/well) in a 96-well plate. After 24 hours, the medium was replaced with 100 l of MEM-RS (Hyclone) serum-free medium containing different solutions of -syn species and treated for 48 hours. A total of 20 l of 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide MTT) (Sigma-Aldrich) (6 mg/ml) was dispensed into each well, and incubated for 4.5 h. This was replaced with 100 l/well of lysis buffer (15% SDS, 50% N, N-dimethylformamide, pH 4.7) overnight. The absorbance values at 590 nm were measured in a microplate reader (Perkin Elmer). For experiments assessing the toxic effect of seeded polymerization, cells were treated in serum-free medium containing different solutions of -syn species (pure fibrils and pure seeds) for 1 hour and monomeric -syn was then added, followed by 48 hours incubation. Seeds (short fibrils) used in this experiment, were obtained upon sonication of -syn fibrils.
(144) HEK293--Syn-EGFP Cell Line Generation
(145) Human embryonic kidney cells 293 (HEK293) were transfected with a plasmid encoding human WT--syn fused to EGFP, at the C-terminus, driven by the cytomegalovirus (CMV) promoter. The plasmid contained a selection marker for the antibiotic geneticin (G418) which was used for the selection of the stable transformants. Protein expression was confirmed by western blot analysis and fluorescence microscopy. A clonal HEK293--syn-EGFP cell line was selected and used for subsequent experiments. Cells were maintained in DMEM media supplemented with 10% Fetal Bovine Serum Gold (FBS) (PAA) and 1% Penicillin-Streptomycin (PAN). The cells were grown at 37 C. in an atmosphere of 5% CO2. For the seeding experiments, cells were plated on 13 mm glass coverslips in 24-well plates and incubated in 5% FBS-media. The following day, -syn seeds were prepared in reactions of 150 l per tube diluted in PBS, fragmented by sonication (Volpicelli-Daley et al., Nat Protoc. 9(9):2135-2146, 2014) and then added to cells at final concentration of 100 nM. Control cells were exposed to vehicle only (PBS). Cells were further incubated for 4 days, washed with PBS and fixed with 4% PFA for 20 min at room temperature (RT), followed by nuclei staining with 46-diamidino-2-phenylindol (DAPI, Sigma-Aldrich, D8417) (1:5000 in DPBS) for 10 min. After a final wash, coverslips were mounted using Mowiol (Sigma-Aldrich) and subjected to fluorescence microscopy. The proportion of cells with -syn inclusions within the population was then determined by counting. For quantification of aggregation, at least 200 cells were counted per variant and per experiment. Images were acquired using a 63 objective, and analyzed using LAS AF v.2.2.1 (Leica Microsystems) software.
(146) Generation of 4-Oxo-2-Nonenal (ONE)-, 4-Hydroxy-2-Nonenal (HNE)--Syn Oligomers
(147) HNE-/ONE--syn oligomers were prepared as previously described (Duffy et al., Free Radic Biol Med. 50(3):428-437, 2011). For generation of HNE-/ONE--syn oligomers, -syn was dialysed against 50 mM disodium hydrogen phosphate, pH 8.5 followed by filtration using 100-kDa MWCO micron spin filter (Millipore) to get rid of high molecular weight aggregates. HNE or ONE (Abcam) was then added to -syn monomers (140 M) to get a final molar ratio of 30:1 (HNE/ONE: -syn) followed by incubation of the samples at 37 C. for 18 hours without shaking. The samples were then centrifuged at 16,900g for 5 min to remove any high molecular aggregated species. The supernatant containing theoligomeric species was then purified by size exclusion chromatography on a Superdex 200 gel filtration column (GE healthcare) equilibrated with 20 mM Tris pH 7.4, 0.15 M NaCl buffer. The eluted peaks fractions corresponding to the oligomeric fraction were pooled and quantified using BCA protein assay kit after solubilizing the oligomers in equal volume on 6 M GnHCl.
(148) Filter Retardation Assay
(149) Filter retardation assay was performed using a Minifold 48 slots (GE Healthcare Life Sciences). Each protein (50 l) at a final concentration of 1 g/ml was loaded into each slot on a nitrocellulose membrane that has been pre-soaked in PBS. Samples were allowed to absorb onto the nitrocellulose membrane and then slots were washedwith 1 ml of PBS. Membranes were then probed with relevant antibodies, and developed with SuperSignal West Pico Chemiluminescent Substrate Kit.
(150) Inhibition ELISA
(151) A 384-well black MaxiSorb microplate (Nunc) was coated with 1 g/ml of -syn monomers in 0.2 M NaHCO.sub.3 pH 9.6 with overnight incubation at 4 C. 4B1 antibodyat 50 ng/ml was pre-incubated with serial dilutions of -syn monomers or aggregates with continuous rolling for 2 hours. The antibody-protein mixture was then loaded to the antigen-coated plate and incubated for 10 min at RT. After washing step, goat anti-mouse IgG-RP (1:20,000, Jackson ImmunoResearch) was added for 1 hour to be later detected using SuperSignal ELISA Femto Chemiluminescent Substrate Kit.
(152) Sandwich ELISA
(153) A 384-well ELISA microplate was coated with 4B1 antibody at 0.5 g/ml overnight at 4 C. in 0.2 M NaHCO.sub.3 pH 9.6. After incubating the plate with 100 l/well of blocking buffer for 2 hours at 37 C., serial dilutions of -syn monomers, pS129--syn monomers, or different -syn oligomers were added to corresponding wells, and incubated overnight at 4 C. Biotinylated 11D12 (mouse mAb for total -syn) (Majbour et al., Mol Neurodegener. 11(7), 2016) was added as detection antibody and incubated at 37 C. for 2 hours followed by a washing step and incubation for 1 hour at 37 C. with streptavidin-HRP (Sigma). The plate was then washed and 50 l/well of an enhanced chemiluminescent substrate (SuperSignal ELISA Femto, Pierce Biotechnology) was added to corresponding wells. The chemiluminescence, expressed in relative light units, was immediately measured using Envision plate reader (PerkinElmer Envision).
(154) Tissue Culture of HEK 293 Human Embryonic Kidney Cells
(155) WT HEK293cells were grown in Dulbecco's MEM-high glucose (Gibco) supplemented by 15% FBS (Gibco) and 1% penicillin-streptomycin (Gibco) and incubated at 37 C. in a 5% CO.sub.2/95% air humidified incubator. After plating HEK cells overnight in 6-well plates, cells were transfected with 2 g of WT--syn plasmid DNA by lipofectamine 3000 reagent (Invitrogen) (Stoppini et al., J Neurosci Methods. 37(2):173-182, 1991). One group of -syn expressing HEK cells was similarly transfected again with 4 g of mutant serine 129 to alanine (S129A) seeds the following day.
(156) HEK cells were lysed, at 6, 12, 24, and 48 hours post seed transfection, initially with 1% Trition X-100 in 50 mM Tris, 150 mM NaCl (pH 7.6) containing protease and phosphatase inhibitors to obtain soluble fractions. The pellet was further lysed with 1% SDS in 50 mM Tris, 150 mM NaCl (pH 7.6) with complete inhibitors to attain insoluble fractions. Protein concentration was determined by BCA protein assay (Pierce) prior to analysis on 12% SDS-PAGE and immunoprobing with appropriate antibodies. These include monoclonal antibodies against rabbit pS129--syn (AB51253, Abcam), mouse -syn Syn1 (610786) (BD Biosciences), and non-pS129--syn (4B1) in addition to antibody C4 against -Actin (Sc-47778) (Santa Cruz Biotechnology) to normalize or the amount of proteins. Blots were subsequently incubated with horseradish peroxidase conjugated with anti-rabbit and anti-mouse IgG (Jackson ImmunoResearch), and proteins were detected with LiCOR system.
(157) Organotypic Hippocampal Culture Slices (OHCS)
(158) Organotypic hippocampal slice cultures were created from P7 C57B16/J mouse pups and injected with S129A-mutated human -syn pre-formed fibrils as previously described (Elfarash et al., Acta Neuropathol Commun. 7(213), 2019), and cultured according to Stoppini et al. (J Neurosci Methods. 37(2):173-182, 1991). At various time points, tissue was fixed according to Gogolla et al. (Nat Protoc. 1(5):2452-2456, 2006) and stored at 4 C. until all tissue had been collected. Slices were permeabilized in 0.5% triton X-100 in PBS and blocked in 10% BSA. Primary antibodies against pS129--syn (D1R1R, Cell Signaling, #23706, 1:1000) and non-pS129--syn (4B1, 200 ng/mL) were diluted in 5% BSA and applied overnight at 4 C. After washing 615 min in 1TBS+0.3% triton X-100, appropriate secondary Alexa-Fluor antibodies were diluted 1:2000, and DAPI 1:1000, in 5% BSA and applied for 3 hours at RT. Washing was repeated and slices were mounted using DAKO Fluorescent Mounting Medium (DAKO, S3023).
(159) Immunofluorescence was evaluated on a Zeiss AxioObserver 7 inverted microscope fitted with an ApoTome to increase Z-plane resolution. For quantification of the distribution of pS129--syn vs. WT--syn in aggregates, 63 images covering the aggregates were taken (5-20 images/slices depending on the amount of aggregation). Images were analyzed in ImageJ (NIH) in order to compute total phosphorylated and non-phosphorylated aggregate area proportions and mean fluorescence intensity of pS129 aggregates and WT--syn aggregates, as well as analyses stratified by aggregate morphology (small, intermediate and long Lewy-neurite-like plus cell body aggregates) and subregion localization.
(160) Wild-Type Mice Injected with Recombinant -Syn Preformed Fibrils (PFFs)
(161) Wild-type C57B16 mice 2-4 months old (Jackson Laboratory) were housed in the animal facility of the Biomedical Research Foundation at the Academy of Athens in a room with a controlled light-dark cycle (12 hour light-12 hour dark) and free access to food and water. Adult male wild-type C57B16 mice were subjected to unilateral striatal injections under general isoflurane anesthesia by an apparatus adjusted to the stereotaxic frame (Kopf Instruments). Right dorsal striatum was targeted using the following coordinates from bregma: anteriorposterior+0.5 mm, mediolateral 1.4 mm and dorsoventral in two depths 3.2 mm and 3.4 mm according to mouse brain atlas. A total of 2.6 g (2 l) of mouse recombinant -syn PFFs were injected at a constant flow rate of 0.3 l/min. Equal volume of dPBS1was used for control animals. An interval of 5 min was maintained between the two dorsoventral depths and the needle was slowly removed 5 min after the injection procedure was completed. For immunohistochemical analysis, mice were transcardially perfused under isoflurane anaesthesia, followed by ice-cold 4% paraformaldehyde (PFA), 2 weeks post stereotaxic injections. Following fixation, the brains were dehydrated by sequential incubation in 15% and 30% sucrose, snap frozen in isopentane at 50 C. and stored at 80 C. Free-floating cryostat-cut coronal sections (30 m) covering the whole nigrostriatal axis were stained with antibodies against pS129--syn, 4B1, and DAT. The sections were treated with antigen retrieval solution (citrate buffer, pH=6) at 80 C. for 20 min. To validate whether pS129-positive -syn accumulations were proteinase K (PK) resistant, sections were incubated with PK (Sigma-Aldrich) 2.5 g/ml in PBS for 10 min at 25 C. Fluorescent images were obtained in a Leica SP5-II confocal microscope. A protocol with sequential image acquisition was used.
(162) Immunohistochemistry and Immunofluorescence
(163) Formalin-fixed paraffin-embedded brain tissue from the amygdala was obtained post-mortem from patients with PD dementia and DLB. Sections (6 m) were cut and stained with 4B1, pS129 or pan--syn (KM51, Leica Novocastra) antibodies and detected using conventional immunohistochemistry. Regions of interest were imaged on a Zeiss A.1 microscope from five (amygdala) regions and percentage area immunoreactive was evaluated using ImagePro software. The same regions were evaluated on serial sections with different antibodies and compared between cases and across sections, and compared to clinical data obtained during life. 4B1 and pS129 antibodies were co-stained on sections for immunofluorescent analysis using a Leica SP8 confocal microscope. LasX software was used to generate three-dimensional images from z-stacked data to determine whether or not the core of aggregates was phosphorylated at serine 129.
(164) Statistical analyses
(165) Statistical analyses were done using the Student's t-test for independent variables. Using the GraphPad Prism software (version 8.3.0), statistical analysis was performed using one-way ANOVA, followed by Tukey's multiple comparison test for the MTT cell viability, ThS, and RT-QulC assays or followed by the Holm-Sidek test for the OHCS. The data are presented as meanstandard deviation and represents results from at least 3 independent experiments.
Example 13
Sequence of mAb 4B1
(166) Total RNA was isolated from mAb 4B1 hybridoma cells following the technical manual of the Monarch Total RNA Miniprep Kit (New England Biolabs, Ipswich, MA). Total RNA was then reverse-transcribed into cDNA using switching mechanism at 5 end of RNA transcript technology. The variable region of the antibody was amplified and cloned separately in a standard cloning vector, and then sequenced using Sanger sequencing technology.
(167) The cDNA sequence of the heavy chain was determined to be:
(168) TABLE-US-00003 (SEQIDNO:4) ATGAATTTCGGGCTCAGCTTGATTTTCCTTGTCCCTGTTTTAAAAGGTGT CCTGTGTGAAGTGAAACTGGTGGAGTCTGGGGGAGGTTTAGTGCAGCCTG GAGGGTCCCTGAAACTCTCCTGTGCAGCCTCTGGAATCACTTTCAGTAGC TATACCATGTCTTGGGTTCGCCAGACTCCAGAGAAGAGGCTGGAGTGGGT CGGATATATTAGTAATGGTGGTGGTAGGACCTACTATCCAGACACTGTAA AGGGCCGATTCACCATCTCCAGAGACAATGCCAAGAACACCCTGTACCTG CAAATGAGCAGTCTGAAGTCTGAGGACACGGCCATGTATTACTGTGCAAG ACAGATTACTACGGCTATGGGGTATTACTATGCTATGGACTACTGGGGTC AAGGAACCTCAGTCACCGTCTCCTCAGCCAAAACGACACCCCCATCTGTC TATCCACTGGCCCCTGGATCTGCTGCCCAAACTAACTCCATGGTGACCCT GGGATGCCTGGTCAAGGGCTATTTCCCTGAGCCAGTGACAGTGACCTGGA ACTCTGGATCCCtgtccagcggtgtgcacaccttcccagctgtcctggag tctgacctctacactctgagcagctcagtgactgtcccctccagccctcg gcccagcgagaccgtcacctgcaacgttgcccacccggccagcagcacca aggtggacaagaaaattgtgcccagggattgtggttgtaagccttgcata tgtacagtcccagaagtatcatctgtcttcatcttccccccaaagcccaa ggatgtgctcaccattactctgactcctaaggtcacgtgtgttgtggtag acatcagcaaggatgatcccgaggtccagttcagctggtttgtagatgat gtggaggtgcacacagctcagacgcaaccccgggaggagcagttcaacag cactttccgctcagtcagtgaacttcccatcatgcaccaggactggctca atggcaaggagttcaaatgcagggtcaacagtgcagctttccctgccccc atcgagaaaaccatctccaaaaccaaaggcagaccgaaggctccacaggt gtacaccattccacctcccaaggagcagatggccaaggataaagtcagtc tgacctgcatgataacagacttcttccctgaagacattactgtggagtgg cagtggaatgggcagccagcggagaactacaagaacactcagcccatcat gaacacgaatggctcttacttcgtctacagcaagctcaatgtgcagaaga gcaactgggaggcaggaaatactttcacctgctctgtgttacatgagggc ctgcacaaccaccatactgagaagagcctctcccactctcctggtaaatg a.
(169) The heavy chain cDNA sequence (SEQ ID NO: 4) is 1401 bases in length, including the termination codon. The beginning of sequence encodes the signal peptide. The underlined sequence encodes the variable region of the heavy chain, consisting of framework and CDRs, and the CDR-encoding portions are in boldface. The designation of framework and CDRs is according to the IMGT delineation system. The italicized text indicates the constant region-encoding segment of the cDNA; the portion in lower case was taken from published sequence rather than being re-determined. Sequence analysis using NCBI Ig-BLAST indicates that: the germline V-gene was IGVH5-12-2*01 or possibly IGVH5-12*01 or IGVH5-12*02; the germline D gene was IGHD1-2*01; and the germline J gene was IGHJ4*01. SEQ ID NO:4 and the regions identified therein constitute means for encoding the heavy chain, the heavy chain variable and constant regions, the heavy chain signal sequence, and the heavy chain CDRs of an antibody that specifically binds aggregated, non-phosphorylated -synuclein.
(170) The heavy chain cDNA encodes a 466 residue amino acid sequence:
(171) TABLE-US-00004 (SEQIDNO:5) MNFGLSLIFLVPVLKGVLCEVKLVESGGGLVQPGGSLKLSCAASGITFSS YTMSWVRQTPEKRLEWVGYISNGGGRTYYPDTVKGRFTISRDNAKNTLYL QMSSLKSEDTAMYYCARQITTAMGYYYAMDYWGQGTSVTVSSAKTTPPSV YPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSlssgvhtfpavlq sdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdcgckpci ctvpevssvfifppkpkdvltitltpkvtcvvvdiskddpevqfswfvdd vevhtaqtqpreeqfnstfrsyselpimhqdwlngkefkcrvnsaafpap iektisktkgrpkapqvytipppkeqmakdkvsltcmitdffpeditvew qwngqpaenykntqpimntngsyfvysklnvqksnweagntftcsvlheg lhnhhtekslshspgk.
(172) As above, the variable region, consisting of framework and CDRs, is underlined and the CDRs are in boldface. The italicized text indicates the constant region; the portion in lower case was based on published sequence.
(173) The heavy chain variable region sequence is:
(174) TABLE-US-00005 (SEQIDNO:6) EVKLVESGGGLVQPGGSLKLSCAASGITFSSYTMSWVRQTPEKRLEWVGY ISNGGGRTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARQI TTAMGYYYAMDYWGQGTSVTVSS
(175) The heavy chain CDRs are:
(176) TABLE-US-00006 (SEQIDNO:7) HCDR1:GITFSSYT, (SEQIDNO:8) HCDR2:ISNGGGRT,and (SEQIDNO:9) HCDR3:ARQITTAMGYYYAMDY.
(177) The light chain cDNA sequence of the light chain was determined to be:
(178) TABLE-US-00007 (SEQIDNO:10) ATGAAGTTGCCTGTTAGGCTGTTGGTGCTGATGTTCTGGATTCCTGCTTC CAGCAGTGATGTTGTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTC TTGGAGATCAAGCCTCCATCTCTTGCAGATCTAGTCAGAGCCTTGTACAC AGTAATGGAAACACCTATTTACATTGGTACCTGCAGAAGCCAGGCCAGTC TCCGAAGCTCCTGATCTCCAAAGTTTCCAACCGATTTTCTGGGGTCCCAG ACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGC AGAGTGGAGGCTGAGGATCTGGGAGTTTATTTCTGCTCTCAAAGTACACA TGTTCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAACGGGCTG ATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACA TCTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAAAGA CATCAATGTCAAGTGGAAGATTGATGGCAGTGAACGACAAAATGGCGTCC TGAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGC AGCACCCTCACGTTGACCAAGGACGAGTATGAACGACATAACAGCTATAC CTGTGAGGCCACTCACAAGACATCAACTTCACCCATTGTCAAGAGcttca acaggaatgagtgttag.
(179) The light chain cDNA sequence (SEQ ID NO: 10) is 717 bases in length, including the termination codon. The beginning of sequence encodes the signal peptide. The underlined sequence encodes the variable region of the light chain, consisting of framework and CDRs, and the CDR-encoding portions are in boldface. The designation of framework and CDRs is according to the IMGT delineation system. The italicized text indicates the constant region-encoding segment of the cDNA; the portion in lower case was taken from published sequence rather than being re-determined. Sequence analysis using NCBI Ig-BLAST indicates that this is a kappa light chain and the germline V-gene was IGKV1-110*01, IGKV1-110*02, or IGKV1-117*01, and the germline J gene was IGKJ5*01. SEQ ID NO:10 and the regions identified therein constitute means for encoding the light chain, the light chain variable and constant regions, the light chain signal sequence, and the light chain CDRs of an antibody that specifically binds aggregated, non-phosphorylated -synuclein.
(180) The light chain cDNA encodes a 238 residue amino acid sequence:
(181) TABLE-US-00008 (SEQIDNO:11) MKLPVRLLVLMFWIPASSSDVVMTQTPLSLPVSLGDQASISCRSSQSLVH SNGNTYLHWYLQKPGQSPKLLISKVSNRFSGVPDRFSGSGSGTDFTLKIS RVEAEDLGVYFCSQSTHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLT SGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKOSTYSMS STLTLTKDEYERHNSYTCEATHKTSTSPIVKsfnrnec
(182) The light chain variable region sequence is:
(183) TABLE-US-00009 (SEQIDNO:12) DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPK LLISKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVP LTFGAGTKLELK.
(184) The light chain CDRs are:
(185) TABLE-US-00010 (SEQIDNO:13) LCDR1:QSLVHSNGNTY, (SEQIDNO:14) LCDR2:KVS,and (SEQIDNO:15) LCDR3:SQSTHVPLT.
EXEMPLARY EMBODIMENTS
(186) Embodiment 1. A hybridoma cell line as deposited with the American Type Culture Collection under patent deposit accession number PTA-127017. Embodiment 2. A monoclonal antibody produced by the hybridoma of Embodiment 1. Embodiment 3. A hybridoma generated by a method comprising immunizing a mouse with a peptide comprising amino acid residues 125-133 of -synuclein (SEQ ID NO: 1). Embodiment 4. The hybridoma of claim 3, wherein the peptide comprising amino acid residues 125-133 of -synuclein is CYEMPSEEGY (SEQ ID NO: 3). Embodiment 5. A monoclonal antibody produced by the hybridoma of Embodiment 3. Embodiment 6. A monoclonal antibody made by a process comprising immunizing a laboratory animal with means for inducing antibodies recognizing aggregated, non-phosphorylated -synuclein. Embodiment 7. The monoclonal antibody of Embodiment 6, wherein the laboratory animal is a mouse. Embodiment 8. The monoclonal antibody of Embodiment 6, wherein the means for inducing antibodies recognizing aggregated, non-phosphorylated -synuclein are conjugated to a carrier protein. Embodiment 9. The monoclonal antibody of Embodiment 8, wherein the carrier protein is keyhole limpet hemocyanin. Embodiment 10. The monoclonal antibody of Embodiment 6, wherein he means for inducing antibodies recognizing aggregated, non-phosphorylated -synuclein is the peptide CYEMPSEEGY (SEQ ID NO:3). Embodiment 11. The monoclonal antibody of Embodiment 2 that is a fragment of a whole antibody. Embodiment 12. An immunoassay for the detection or quantitation of aggregated, non-phosphorylated -synuclein comprising a step for contacting a sample with means for binding WT--syn. Embodiment 13. The immunoassay of Embodiment 12, wherein the means for binding WT--syn is the monoclonal antibody produced by the hybridoma deposited with the American Type Culture Collection under patent deposit accession number PTA-127017.
(187) In closing, it is to be understood that although aspects of the present specification are highlighted by referring to specific embodiments, one skilled in the art will readily appreciate that these disclosed embodiments are only illustrative of the principles of the subject matter disclosed herein. Therefore, it should be understood that the disclosed subject matter is in no way limited to a particular methodology, protocol, and/or reagent, etc., described herein. As such, various modifications or changes to or alternative configurations of the disclosed subject matter can be made in accordance with the teachings herein without departing from the spirit of the present specification. Lastly, the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which is defined solely by the claims. Accordingly, the present invention is not limited to that precisely as shown and described.
(188) Certain embodiments of the present invention are described herein, including the best mode known to the inventors for carrying out the invention. Of course, variations on these described embodiments will become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventor expects skilled artisans to employ such variations as appropriate, and the inventors intend for the present invention to be practiced otherwise than specifically described herein. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described embodiments in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
(189) Groupings of alternative embodiments, elements, or steps of the present invention are not to be construed as limitations. Each group member may be referred to and claimed individually or in any combination with other group members disclosed herein. It is anticipated that one or more members of a group may be included in, or deleted from, a group for reasons of convenience and/or patentability. When any such inclusion or deletion occurs, the specification is deemed to contain the group as modified thus fulfilling the written description of all Markush groups used in the appended claims.
(190) Unless otherwise indicated, all numbers expressing a characteristic, item, quantity, parameter, property, term, and so forth used in the present specification and claims are to be understood as being modified in all instances by the term about. As used herein, the term about means that the characteristic, item, quantity, parameter, property, or term so qualified encompasses a range of plus or minus ten percent above and below the value of the stated characteristic, item, quantity, parameter, property, or term. Accordingly, unless indicated to the contrary, the numerical parameters set forth in the specification and attached claims are approximations that may vary. At the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, each numerical indication should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. Notwithstanding that the numerical ranges and values setting forth the broad scope of the invention are approximations, the numerical ranges and values set forth in the specific examples are reported as precisely as possible. Any numerical range or value, however, inherently contains certain errors necessarily resulting from the standard deviation found in their respective testing measurements. Recitation of numerical ranges of values herein is merely intended to serve as a shorthand method of referring individually to each separate numerical value falling within the range. Unless otherwise indicated herein, each individual value of a numerical range is incorporated into the present specification as if it were individually recited herein.
(191) The terms a, an, the and similar referents used in the context of describing the present invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., such as) provided herein is intended merely to better illuminate the present invention and does not pose a limitation on the scope of the invention otherwise claimed. No language in the present specification should be construed as indicating any non-claimed element essential to the practice of the invention.
(192) Specific embodiments disclosed herein may be further limited in the claims using consisting of or consisting essentially of language. When used in the claims, whether as filed or added per amendment, the transition term consisting of excludes any element, step, or ingredient not specified in the claims. The transition term consisting essentially of limits the scope of a claim to the specified materials or steps and those that do not materially affect the basic and novel characteristic(s). Embodiments of the present invention so claimed are inherently or expressly described and enabled herein.
(193) All patents, patent publications, and other publications referenced and identified in the present specification are individually and expressly incorporated herein by reference in their entirety for the purpose of describing and disclosing, for example, the compositions and methodologies described in such publications that might be used in connection with the present invention. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior invention or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.
(194) The 19 KB ASCII text file named 5600234-00619 Sequence Listing_ST25.txt created 10/14/2021 is incorporated herein by reference.