INTESTINAL AND FECAL BIOMARKERS FOR INTESTINAL HEALTH OF POULTRY

Abstract

Growth performance, health and welfare of domesticated birds such as broilers heavily depends on a well-functioning intestinal tract. Consequently, there is a high need to find biomarkers that are specific for gut damage and that are easily applicable in the field. The present disclosure describes a set of 20 specific proteins that can be quantified in fresh fecal droppings and/or intestinal content of the birds and that each specifically correlate with a damaged gut.

Claims

1. A method to determine the intestinal health status of a domesticated bird, the method comprising: providing a fecal sample or an intestinal content sample obtained from the domesticated bird, and quantifying a protein, or a fragment thereof, in the sample, wherein the protein is selected from the group consisting of myeloid protein 1, fibronectin, annexin A5, nucleophosmin, carbonic anhydrase 2, aminopeptidase Ey, transthyretin, ovoinhibitor, apolipoprotein A-1, hemoglobin subunit beta, superoxide dismutase [Cu—Zn], alpha-actinin-4, angiotensin-converting enzyme, WD repeat-containing protein 1, mitochondrial aspartate aminotransferase, histone H2A-IV, immunoglobulin lambda chain C region, immunoglobulin lambda chain V-1 region, cathepsin D, and retinol-binding protein 4.

2. The method according to claim 1, wherein the protein is selected from the group consisting of myeloid protein 1, fibronectin, annexin A5, nucleophosmin, carbonic anhydrase 2, aminopeptidase Ey, transthyretin, ovoinhibitor, and apolipoprotein A-1.

3. The method according to claim 1, wherein an increased level of the selected protein present in the fecal or intestinal content sample, when compared to the level found in fecal or intestinal content samples of healthy control animals, is an indicator of poor intestinal health.

4. The method according to claim 1, wherein a decreased level of the protein aminopeptidase Ey, superoxide dismutase [Cu—Zn], angiotensin-converting enzyme, WD repeat-containing protein 1, mitochondrial aspartate aminotransferase, immunoglobulin lambda chain C region, immunoglobulin lambda chain V-1 region and cathepsin D present in the fecal or intestinal content sample, when compared to the level found in fecal or intestinal content samples of healthy control animals, is an indicator of poor intestinal health.

5. The method according to claim 2, wherein the level of protein correlates with the intestinal health as determined by measuring villus length in the duodenum of the birds, and/or by measuring villus-to-crypt ratio in the duodenum of the birds, and/or by measuring T-lymphocyte infiltration in the villi, and/or by scoring the macroscopic gut appearance of the birds.

6. The method according to claim 1, wherein the intestinal content sample is a colonic content sample, and wherein the protein is selected from the group consisting of myeloid protein 1, fibronectin, annexin A5, nucleophosmin, carbonic anhydrase 2, aminopeptidase Ey, transthyretin, ovoinhibitor, apolipoprotein A-1, hemoglobin subunit beta, superoxide dismutase [Cu—Zn], and alpha-actinin-4.

7. The method according to claim 1, wherein the intestinal content sample is an ileal content sample, and wherein the protein is selected from the group consisting of aminopeptidase Ey, transthyretin, apolipoprotein A-1, superoxide dismutase [Cu—Zn], angiotensin-converting enzyme, WD repeat-containing protein 1, mitochondrial aspartate aminotransferase, histone H2A-IV, immunoglobulin lambda chain C region, immunoglobulin lambda chain V-1 region, cathepsin D and retinol-binding protein 4.

8. The method according to claim 1, wherein the protein is a fragment of myeloid protein 1 comprising at least one of the following peptides: APFSGELSGPVK (SEQ ID NO:10), APFSGQLSGPIR (SEQ ID NO:11), FSGELSGPVK (SEQ ID NO:12), HGQIQK (SEQ ID NO:13), SDPTSNLER (SEQ ID NO:14), SGELSGPVK (SEQ ID NO:15), SGQLSGPIR (SEQ ID NO:16), VFPGIISHI (SEQ ID NO:17), VFPGIVSH (SEQ ID NO:18), and VFPGIVSHI (SEQ ID NO:19); wherein the protein is a fragment of fibronectin comprising at least one of the following peptides: ATITGYK (SEQ ID NO:20), DDQESIPISK (SEQ ID NO:21); wherein the protein is a fragment of annexin A5 comprising at least one of the following peptides: KAMKGMGTDEETILK (SEQ ID NO:22), LLLAVVK (SEQ ID NO:23), and VDEALVEK (SEQ ID NO:24); wherein the protein is a fragment of nucleophosmin comprising at least one of the following peptides: IGNASKTK (SEQ ID NO:25), TPDSK (SEQ ID NO:26), TVTLGAGAK (SEQ ID NO:27), and VVLASLK (SEQ ID NO:28); wherein the protein is a fragment of carbonic anhydrase 2 comprising at least one of the following peptides: VGNAKPEIQK (SEQ ID NO:29), and VVDALNSIQTK (SEQ ID NO:30); wherein the protein is a fragment of aminopeptidase Ey comprising at least one of the following peptides: ADNQDIGFGSGTR (SEQ ID NO:31), AIAEGQGEYALEK (SEQ ID NO:32), APVVSEADK (SEQ ID NO:33), AQIIDDAFNLAR (SEQ ID NO:34), AVFTVTMIHPS (SEQ ID NO:35), AWDFIR (SEQ ID NO:36), DFIWER (SEQ ID NO:37), DFLTEDVFK (SEQ ID NO:38), DHLQEAVNK (SEQ ID NO:39), DLWDHLQEAVNK (SEQ ID NO:40), DNAYSSIGNK (SEQ ID NO:41), EAPVVSEADK (SEQ ID NO:42), EGQGEYALEK (SEQ ID NO:43), ENSLLYDNAYSSIGNK (SEQ ID NO:44), EQALER (SEQ ID NO:45), FLEAPVVSEADK (SEQ ID NO:46), FLEAPVVSEADKLR (SEQ ID NO:47), FNTEFELK (SEQ ID NO:48), GADSAEPTWDIK (SEQ ID NO:49), HYNTAYPLPK (SEQ ID NO:50), IAEGQGEYALEK (SEQ ID NO:51), ILSFFER (SEQ ID NO:52), IWGRPAAIAE (SEQ ID NO:53), IWGRPAAIAEGQGEY (SEQ ID NO:54), IWGRPAAIAEGQGEYALEK (SEQ ID NO:55), KQDATSTIN (SEQ ID NO:56), KQDATSTINSIASNVVGQPL (SEQ ID NO:57), KQDATSTINSIASNVVGQPLA (SEQ ID NO:58), LAGPLQQGQHYR (SEQ ID NO:59), LEAPVVSEADK (SEQ ID NO:60), LPTALKPESYEVTLQPF (SEQ ID NO:61), MLSDFLTEDVFK (SEQ ID NO:62), NSVPLPDSIGAIMDR (SEQ ID NO:63), PAAIAEGQGEYALEK (SEQ ID NO:64), QAIPVINR (SEQ ID NO:65), QDATSTINSIASNVVGQPL (SEQ ID NO:66), QNVSNNPIAPNLR (SEQ ID NO:67), SDFLTEDVFK (SEQ ID NO:68), SDQVGLPDFNAGAMENWG (SEQ ID NO:69), SEVFDSIAYSK (SEQ ID NO:70), SLLYDNAYSSIGNK (SEQ ID NO:71), SNNHQAIPVINR (SEQ ID NO:72), SVPLPDSIGAIMDR (SEQ ID NO:73), TDLWDHLQEAVNK (SEQ ID NO:74), TGELADDLAGFYR (SEQ ID NO:75), TGPILSFFER (SEQ ID NO:76), TIDPTK (SEQ ID NO:77), TLFGQYGGGSFSFSR (SEQ ID NO:78), TNINWVK (SEQ ID NO:79), VNYNQENWDQLL (SEQ ID NO:80), VNYNQENWDQLLQ (SEQ ID NO:81), VNYNQENWDQLLQQ (SEQ ID NO:82), VVATTQMQAPDAR (SEQ ID NO:83), WRLPTAL (SEQ ID NO:84), WRLPTALKPES (SEQ ID NO:85), WRLPTALKPESYEVTLQPF (SEQ ID NO:86), YDNAYSSIGNK (SEQ ID NO:87), YLQYTIDPTK (SEQ ID NO:88), and YPLPK (SEQ ID NO: 89); wherein the protein is a fragment of transthyretin comprising at least one of the following peptides: AADGTWQDFATGK (SEQ ID NO:90), CPLMVK (SEQ ID NO:91), DGTWQDFATGK (SEQ ID NO:92), DVVFTANDSGHR (SEQ ID NO:93), GLGLSPFH (SEQ ID NO:94), GLGLSPFHEY (SEQ ID NO:95), GLGLSPFHEYA (SEQ ID NO:96), GLGLSPFHEYADVVF (SEQ ID NO:97), GLGLSPFHEYADVVFTANDSGHR (SEQ ID NO:98), GSPAANVAVK (SEQ ID NO:99), GSPAANVAVKV (SEQ ID NO:100), GTWQDFATGK (SEQ ID NO:101), HYTIAALL (SEQ ID NO:102), HYTIAALLSPF (SEQ ID NO:103), HYTIAALLSPFS (SEQ ID NO:104), TTEEQFVEGVYR (SEQ ID NO:105), TTEFGEIHEL (SEQ ID NO:106), TTEFGEIHELTTEEQ (SEQ ID NO:107), TTEFGEIHELTTEEQFVEGV (SEQ ID NO:108), TTEFGEIHELTTEEQFVEGVYR (SEQ ID NO:109), TTEFGEIHELTTEEQFVEGVYRVEFDTSSYWK (SEQ ID NO:110), VEFDTSSYWK (SEQ ID NO:111), and VLDAVR (SEQ ID NO:112); wherein the protein is a fragment of ovoinhibitor comprising at least one of the following peptides: EHGANVEK (SEQ ID NO:113), TLNLVSMAAC (SEQ ID NO:114), and TLVACPR (SEQ ID NO:115); wherein the protein is a fragment of apolipoprotein A-1 comprising at least one of the following peptides: DLEEVKEK (SEQ ID NO:116), EMWLK (SEQ ID NO:117), IRDMVDV (SEQ ID NO:118), IRPFLDQF (SEQ ID NO:119), IRPFLDQFSAK (SEQ ID NO:120), LADNLDTLSAAAAK (SEQ ID NO:121), LISFLDELQK (SEQ ID NO:122), LSQKLEEI (SEQ ID NO:123), LTPVAEEAR (SEQ ID NO:124), LTPVAQELK (SEQ ID NO:125), LTPYAENLK (SEQ ID NO:126), MTPLVQEFR (SEQ ID NO:127), QKLSQK (SEQ ID NO:128), QLDLK (SEQ ID NO:129), and YKEVR (SEQ ID NO:130); wherein the protein is a fragment of hemoglobin subunit beta comprising at least one of the following peptides: KVLTSFGDAV (SEQ ID NO:142), LHVDPENF (SEQ ID NO:143), LLIVYPWTQR (SEQ ID NO:144), NLDNIK (SEQ ID NO:145), and VLTSFGDAVK (SEQ ID NO:146); and wherein the protein is a fragment of superoxide dismutase comprising at least one of the following peptides: AVCVMK (SEQ ID NO:147), FQQQGSGPVK (SEQ ID NO:148), GDAPVEGVIHFQQQGSGPVK (SEQ ID NO:149), GGVAEVEI (SEQ ID NO:150), GGVAEVEIEDSVISLTGPH (SEQ ID NO:151), GVIGIAK (SEQ ID NO:152), HVGDLGNVTA (SEQ ID NO:153), HVGDLGNVTAK (SEQ ID NO:154), ITGLSDGDHGFHVH (SEQ ID NO:155), LACGVIGIAK (SEQ ID NO:156), LTGNAGPR (SEQ ID NO:157), SDDLGR (SEQ ID NO:158), SDDLGRGGDNESK (SEQ ID NO:159), and TMVVHA (SEQ ID NO:160); or wherein the protein is a fragment of alpha-actinin-4 comprising at least one of the following peptides: DAEDIVNTARDPEK (SEQ ID NO:161); and TIPWLEDR (SEQ ID NO:162).

9. The method according to claim 1, wherein the protein is a fragment of angiotensin-converting enzyme comprising at least one of the following peptides: AALPEDELKEYNTLLSDMETTYSVAK (SEQ ID NO:163), ALYNK (SEQ ID NO:164), DGANPGFHEAIGDV (SEQ ID NO:165), DGANPGFHEAIGDVMA (SEQ ID NO:166), DGANPGFHEAIGDVMAL (SEQ ID NO:167), DYNELLFAWK (SEQ ID NO:168), ETPTFEEDLER (SEQ ID NO:169), EVMLEK (SEQ ID NO:170), FEESDR (SEQ ID NO:171), FFTSLGLIPMPQEFWDK (SEQ ID NO:172), GGANPGFHEAIGDVLS (SEQ ID NO:173), GLIPMPQEFWDK (SEQ ID NO:174), GLLEMPPEFWEK (SEQ ID NO:175), GPIPAHL (SEQ ID NO:176), GPIPAHLLGNMW (SEQ ID NO:177), GPIPAHLLGNMWAQQ (SEQ ID NO:178), GPIPAHLLGNMWAQS (SEQ ID NO:179), GYLIDQWR (SEQ ID NO:180), IIGSIQTLGPSNLPLDK (SEQ ID NO:181), IIGSIQTLGPSNLPLDKR (SEQ ID NO:182), IKEDEYNQQWWNL (SEQ ID NO:183), IYSTAK (SEQ ID NO:184), KIIGSIQTLGPSNLPLDK (SEQ ID NO:185), LLGDAMK (SEQ ID NO:186), LLYAWEGWHNAAGNPLR (SEQ ID NO:187), LSVLER (SEQ ID NO:188), MSIALDK (SEQ ID NO:189), NTILSDMDK (SEQ ID NO:190), QCTVVNMDDLITVH (SEQ ID NO:191), QFDPSDFQDETVTR (SEQ ID NO:192), QQGWTPK (SEQ ID NO:193), QQYNTILSDMDK (SEQ ID NO:194), RYVELSNK (SEQ ID NO:195), SLGLIPMPQEFWDK (SEQ ID NO:196), SLSVSTPSHLQK (SEQ ID NO:197), SLYETPTFEEDLER (SEQ ID NO:198), SMIEKPADGR (SEQ ID NO:199), SNIFDLVMPFPDATK (SEQ ID NO:200), SVSTPK (SEQ ID NO:201), SVSTPSHLQK (SEQ ID NO:202), TLGPSNLPLDK (SEQ ID NO:203), TNEVLGWPEFDWRSPIPEGYPEGIDK (SEQ ID NO:204), TSLGLIPMPQEFWDK (SEQ ID NO:205), TSLGLLEMPPEFWEK (SEQ ID NO:206, VDATPAMK (SEQ ID NO:207), VELSNK (SEQ ID NO:208), YGAEHISLK (SEQ ID NO:209), YHIPGNTPY (SEQ ID NO:210), YINLK (SEQ ID NO:211), YNELLFAWK (SEQ ID NO:212), YQGLCPPVPR (SEQ ID NO:213), and YVELSNK (SEQ ID NO:214); wherein the protein is a fragment of WD repeat-containing protein 1 comprising at least one of the following peptides: IIGGDPK (SEQ ID NO:215), KVFASLPQVERGVSK (SEQ ID NO:216), and VINSVDIK (SEQ ID NO:217); wherein the protein is a fragment of mitochondrial aspartate aminotransferase comprising at least one of the following peptides: GPPDPILGVTEAFK (SEQ ID NO:218), LLLSAPR (SEQ ID NO:219), MDKEYLPI (SEQ ID NO:220), MGLYGER (SEQ ID NO:221), NPTGVDPR (SEQ ID NO:222), and TQLVSNLK (SEQ ID NO:223); wherein the protein is a fragment of histone H2A-IV comprising at least one of the following peptides: NDEELNK (SEQ ID NO:224) and VTIAQGGVLPNIQAAVLLPK (SEQ ID NO:225); wherein the protein is a fragment of immunoglobulin lambda chain C region comprising at least one of the following peptides: DFYPSPVTVDWVIDGSTR (SEQ ID NO:226), ITLFPPSK (SEQ ID NO:227), NDFYPSPVTVDWVIDGSTR (SEQ ID NO:228), SGETTAPQR (SEQ ID NO:229), THNGTSITK (SEQ ID NO:230), TVDWVIDGSTR (SEQ ID NO:231), VAPTITLFPPSK (SEQ ID NO:232), VAPTITLFPPSKEELN (SEQ ID NO:233), VAPTITLFPPSKEELNEAT (SEQ ID NO:234), VAPTITLFPPSKEELNEATK (SEQ ID NO:235), and VTHNGTSITK (SEQ ID NO:236); wherein the protein is a fragment of immunoglobulin lambda chain VI region comprising at least one of the following peptides: ALTQPSSVSANPGETVK (SEQ ID NO:237), APGSAPVTLIYDNTNRPSNIPSR (SEQ ID NO:238), GSAPVTLIYDNTNRPSNIPSR (SEQ ID NO:239), ITCSGDR (SEQ ID NO:240), NPGETVK (SEQ ID NO:241), PSNIPSR (SEQ ID NO:242), RPSNIPSR (SEQ ID NO:243), SANPGETVK (SEQ ID NO:244), SVSANPGETVK (SEQ ID NO:245), and YGWYQQK SEQ ID NO:246); wherein the protein is a fragment of cathepsin D comprising at least one of the following peptides: DPTAQPGGELLLGGTDPK (SEQ ID NO:247), ELQTAIGAKPL (SEQ ID NO:248), ELQTAIGAKPLI (SEQ ID NO:249), FDGILGMAFPR (SEQ ID NO:250), IPLTK (SEQ ID NO:251), QPGGELLLGGTDPK (SEQ ID NO:252), and VTPFFDNVMQQK (SEQ ID NO:253); or wherein the protein is a fragment of retinol-binding protein 4 comprising at least one of the following peptides: QIDLCLDR (SEQ ID NO:254) and TVDENGQMSATAK (SEQ ID NO:255).

10. The method according to claim 1, wherein the domesticated bird is a broiler.

11. The method according to claim 1, wherein the proteins or fragments thereof are quantified by using antibodies that specifically bind to the proteins or fragments thereof.

12. The method according to claim 11, wherein the antibodies are part of an Enzyme-Linked Immunosorbent Assay.

13. The method according to claim 3, further comprising: administering an antibiotic to the domesticated bird so as to treat the domesticated bird.

14. The method according to claim 4, further comprising: administering an antibiotic to the domesticated bird so as to treat the domesticated bird.

15. The method according to claim 5, further comprising: administering an antibiotic to the domesticated bird so as to treat the domesticated bird.

16. An assay for determining the intestinal health status of a domesticated bird, the assay comprising: a fecal sample or an intestinal content sample obtained from the domesticated bird, together with antibodies that specifically bind to at least one protein, wherein the at least one protein is selected from the group consisting of myeloid protein 1, fibronectin, annexin A5, nucleophosmin, carbonic anhydrase 2, aminopeptidase Ey, transthyretin, ovoinhibitor, apolipoprotein A-1, hemoglobin subunit beta, superoxide dismutase [Cu—Zn], alpha-actinin-4, angiotensin-converting enzyme, WD repeat-containing protein 1, mitochondrial aspartate aminotransferase, histone H2A-IV, immunoglobulin lambda chain C region, immunoglobulin lambda chain V-1 region, cathepsin D, and retinol-binding protein 4; and wherein the antibodies are part of an enzyme-linked immunosorbent assay for quantifying the protein.

17. The assay of claim 16, wherein the at least one protein is selected from the group consisting of myeloid protein 1, fibronectin, annexin A5, nucleophosmin, carbonic anhydrase 2, aminopeptidase Ey, transthyretin, ovoinhibitor, and apolipoprotein A-1.

Description

BRIEF DESCRIPTION OF FIGURES

[0008] FIGS. 1A-1C: Mean body weight (g) (FIG. 1A), macroscopic gut appearance score (FIG. 1), and coccidiosis score (FIG. 1C) per pen for control and challenge on day 26. * denotes statistical significance at p<0.05 between control and challenged treatment.

[0009] FIGS. 1A-1D: Mean villus length (FIG. 2A), crypt depth (FIG. 2B), villus-to-crypt ratio (FIG. 2C), and T-lymphocyte infiltration (CD.sub.3 area %) per pen for control and challenge (FIG. 2D) on day 26. *** denotes statistical significance at p<0.0001 between control and challenge group.

DETAILED DESCRIPTION

[0010] The disclosure relates to a reliable, rapid and non-invasive biomarker test to diagnose gut health of poultry. With the term “poultry” is meant domesticated birds kept by humans for their eggs, their meat or their feathers. These birds are most typically members of the superorder Galloanserae, especially the order Galliformes, which includes chickens, quails and turkeys. The disclosure describes the identification of biomarkers that are indicative of intestinal pathology. The disclosure further describes a gut damage model in poultry wherein a set of intestinal and/or fecal biomarkers correlate with, for example, shortening of villi and CD.sub.3 infiltration, the latter being markers for intestinal inflammation.

[0011] Hence, the disclosure relates, in the first instance, to a method to determine the intestinal health status of a domesticated bird comprising: [0012] Providing a fecal sample or an intestinal content sample obtained from the domesticated bird, and [0013] quantifying a protein, or a fragment thereof, in the fecal sample or intestinal content sample, [0014] wherein the protein is chosen from the group consisting of: myeloid protein 1, fibronectin, annexin A5, nucleophosmin, carbonic anhydrase 2, aminopeptidase Ey, transthyretin, ovoinhibitor, apolipoprotein A-1, hemoglobin subunit beta, superoxide dismutase [Cu—Zn], alpha-actinin-4, angiotensin-converting enzyme, WD repeat-containing protein 1, mitochondrial aspartate aminotransferase, histone H2A-IV, immunoglobulin lambda chain C region, immunoglobulin lambda chain V-1 region, cathepsin D and retinol-binding protein 4.

[0015] More specifically, the disclosure relates, in the first instance, to a method to determine the intestinal health status of a domesticated bird comprising: [0016] obtaining a fecal sample or an intestinal content sample of the domesticated bird, and [0017] quantifying a protein, or a fragment thereof, in the fecal or intestinal content sample, [0018] wherein the protein is chosen from the group consisting of: myeloid protein 1, fibronectin, annexin A5, nucleophosmin, carbonic anhydrase 2, aminopeptidase Ey, transthyretin, ovoinhibitor and apolipoprotein A-1.

[0019] The term “intestinal health status” relates, in the first instance, to the status of the gut wall structure and morphology that can be affected by, for example, infectious agents or a non-infectious cause such as a suboptimal formulated diet. The latter term thus mainly relates to epithelial damage and epithelial permeability, which is characterized by a shortening of villi, a lengthening of crypts and an infiltration of inflammatory cells. The latter damage and inflammation markers can also be associated with a “severe” macroscopic appearance of the gut, compared to a “normal” appearance, when evaluated using a scoring system such as the one described by Teirlynck et al. (2011).

[0020] The term “obtaining a fecal or intestinal content sample” refers to any means to collect of a fresh fecal dropping from the birds or intestinal content at necropsy of the birds. The term “intestinal content at necropsy of birds” means a sample taken from the content present in ileum or colon after the bird is euthanized.

[0021] The terms “quantifying a protein, or a fragment thereof, in the fecal or intestinal content sample” refers to any method known to a skilled person to quantify the proteins or fragments of in the sample. Non-limiting examples of the latter means are mass spectrometric methods (e.g., discovery and targeted proteomics, multiple reaction monitoring (MRM) assay, sequential window acquisition of all theoretical spectra assay (SWATH), . . . ), which require prior isolation of the proteins or fragments thereof from the sample. The latter isolation can be undertaken via protein extractions with different lysis buffers such as Sodium dodecyl sulfate (SDS)-based protein lysis buffer, Bacterial Protein extraction reagent (B-Per) or Urea-based lysis buffer with or without bead beating or other commonly used methods. Other non-limiting examples of means to quantify proteins or fragments thereof are ELISA and Western Blotting, which can be performed without prior protein isolation from the sample. Instead, the fecal or intestinal content sample can be diluted (10% m/v) in phosphate-buffered saline (PBS) or a 50 mM Tris, 150 mM NaCl (pH 7.2) buffer with or without bead beating prior to quantification.

[0022] It should be clear that the quantification of a single protein might be sufficient to determine the intestinal health status but that also a combination of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more proteins can be used to determine the intestinal health status of the poultry.

[0023] The protein biomarkers of the disclosure, which are indicative of intestinal pathology in poultry, are the following:

[0024] 1. Myeloid Protein 1

[0025] This protein has accession number P09840 in the UniProt database (see uniprot.org/uniprot/P08940). The protein is a granule protein present in secretory granules of heterophilic granulocytes.

[0026] This protein has the following amino acid sequence (i.e., SEQ IDNO:1; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00001 MPALSLIALLSLVSTAFARQWEVHPPQQQGRHWAQ ICSGNPFNRIRGCDRYGCGNYGASRQGKGEKHKGV DVICTDGSIVYAPFSGQLSGPIRFFHNGNAIDDGV QISGSGYCVKLVCIHPIRYHGQIQKGQQLGRMLPM QKVFPGIVSHIHVENCDQSDPTHLLRPIPDISPPF PQQDAHWAVVCAGNPTNEIRGCDKYGCGYFGAPRR NGKGEKHKGVDVICADGATVYAPFSGELSGPVKFF HNGNAIDDGVQIRGSGFCVKLLCIHPIRYNGRISK GQVLGRMLPMQRVFPGIISHIHVENCDRSDPTSNL ERGKGESEMEV

[0027] 2. Fibronectin

[0028] This protein has accession number P11722 in the UniProt database (see uniprot.org/uniprot/P11722). Fibronectin (Fn) is a high molecular weight glycoprotein that consists in a soluble form in plasma and in an insoluble form as extracellular matrix (ECM) component (Pankov and Yamada, 2002). It contributes to a variety of cellular activities including wound healing. Production of fibronectin is influenced by pro-inflammatory cytokines such as IL-1-alpha, TL-6 and TNF-alpha.

[0029] This protein has the following amino acid sequence (i.e., SEQ IDNO:2; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00002 PLDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYG RGIGEWHCQPLQAYAPLSPPTNLRLEPNPDTGILI VSWDRSTTPGISGYRVTTAPTNGQQGSTLEEVVGA DQTSCTFENLNPGVEYNVSVYAVKDDQESIPISKT ITQEVPQLTDLSFVDITDSSIGLRWTPLNASTIIG YRITVVAAGESVPIFEDFVDSSVGYYTVTGLEPGI DYDISVITLINGGESAPTTLTQQTAVPPPTDLRFT NVGPDTMRVTWTAPTSIVLSSFLVRYSPVKKEEDV AELTISPSDNVVVLTNLLPGTEYLVRVYSVAEQHE SAPLSGIQKTGLDSPTGLDFSDITANSFTVHWIAP RATITGYKIRHHPEHGVGRPKEDRVPPSRNSITLT NLLPGTEYVVSIIAVNGREESVPLVGQQTTVSDVP RDLEVNPTSPTSLE1SWDAPAVTVRYYRITYGETG GSSPVQEFTVPGTMSRATITGLKPGVDYTITVYAV TGRGDSPASSKPVTVTYKTEIDTPSQMQVTDVQDN SISIRWLPSSSPVTGYRVTAVPKKGHGPTKTKNVP PDQTQVTIEGLQPTVEYMVSVYAQNQNGESLPLVE TAVTNIDRPKGLTFTEVDVDSIKIAWESPQGQVTR YRVTYSSPEDGIHELLPAPGGEEDTAELHGLRPGS EYTINIVAIYDDMESLPLTGTQSTAIPPPTNLKFT QVTPTSLTVNWNAPNVRLTGYRVRVNPKEKTGPMK EINLSPDSTSAVVSGLMVATKYEVSVYALKDSLTS RPAQGVVTTLENVSPPRRARVTDATETTITITWRT KTETITGFQIDAIPAASGQNPIQRTISPDVRTYTI TGLQPGNDYKIYLYTLNENARSSPVVIDASTAIDA PSNLRFLTTTTNSLLASWQPPRAKITGYIIRYDKP GSPAKELLPRPRPGTTEATITGLEPGTEYTIYIIA VKNNQKSEPLVGRKRTDDLPTLITGPHPNQPDMLD VPSVDEGTPYLTNNRYDNGNGIQLPGTSGHPQTIG HQGQQVFFEEHGYRRPVPTTATPLRPGSRRQPPNV DEAIEIPGYQVPIIVVPSYPHSREPRRNDTTGQEA LSQTTISWRPLLESTEYIISCQPVSQDEDTLQFRV PGTSSSATLTGLTRGATYNIIVEALKDHRRQKVLE EVVTVGNTVSEGLNQPADDTCYDTYTGSFYSIGEE WERLSETGFKLWCQCLGFGSGHFRCDSSKWCHDNG VNYKIGEKWDRQGENGQMIDCTCLGNGKGEF

[0030] 3. Annexin A5

[0031] This protein has accession number P17153 in the UniProt database (see uniprot.org/uniprot/P17153). This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

[0032] This protein has the following amino acid sequence (i.e., SEQ IDNO:3; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00003 MAKYTRGTVTAFSPFDARADAEALRKAMKGMGTDE ETILKILTSRNNAQRQEIASAFKTLFGRDLVDDLK SELTGKFETLMVSLMRPARIFDAHALKHAIKGAGT NEKVLTEILASRTPAEVQNIKQVYMQEYEANLEDK ITGETSGHFQRLLVVLLQANRDPDGRVDEALVEKD AQVLFRAGELKWGTDEETFITILGTRSVSHLRRVF DKYMTISGFQIEETIDRETSGDLEKLLLAVVKCIR SVPAYFAETLYYSMKGAGTDDDTLIRVMVSRSEID LLDIRHEFRKNFAKSLYQMIQKDTSGDYRKALLLL CGGDDE

[0033] 4. Nucleophosmin

[0034] This protein has accession number P16039 in the UniProt database (see uniprot.org/uniprot/P16039). Nucleophosmin is a DNA binding nuclear protein that has been described as a wound-associated protein (Mellgren, 2010).

[0035] This protein has the following amino acid sequence (i.e., SEQ IDNO:4; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00004 MEDSAMDMESMGPLRPQTFLFGCELKAEKEYQFKV DDEENEHQLSLRTVTLGAGAKDELHVVEAEALDYE GNPTKVVLASLKMSVQPTVSLGGFEITPPFVLRLK CGSGPVYVSGQHLVALEEEPESEDEEEDTKIGNAS TKRPASGGGAKTPQKKPKLSEDDEDDDEDEDDDED DEDDLDDDEEEIKTPMKKPAREPAGKNMQKAKQNG KDSKPSTPASKTKTPDSKKDKSLTPKTPKVPLSLE EIKAKMQASVDKGCSLPKLEPKFANYVKNCFRTED QKVIQALWQWRQTL

[0036] 5. Carbonic Anhydrase 2

[0037] This protein has accession number P07630 in the UniProt database (see uniprot.org/uniprot/P07630). This enzyme causes the rapid interconversion of carbon dioxide and water to bicarbonate and protons (or vice versa), a reaction that is important for acid/base equilibrium. The enzyme is a marker for differentiation in epithelial cells.

[0038] This protein has the following amino acid sequence (i.e., SEQ IDNO:5; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00005 MSHHWGYDSHNGPAHWHEHFPIANGERQSPIAIST KAARYDPALKPLSFSYDAGTAKAIVNNGHSFNVEF DDSSDKSVLQGGALDGVYRLVQFHIHWGSCEGQGS EHTVDGVKYDAELHIVHWNVKYGKFAEALKHPDGL AVVGIFMKVGNAKPEIQKVVDALNSIQTKGKQASF TNFDPTGLLPPCRDYWTYPGSLTTPPLHECVIWHV LKEPITVSSEQMCKLRGLCFSAENEPVCRMVDNWR PCQPLKSREVRASFQ

[0039] 6. Aminopeptidase Ey

[0040] This protein has accession number 057579 in the UniProt database (see uniprot.org/uniprot/057579). Aminopeptidase Ey (EC 3.4.11.20) from chicken (Gallus gallus domesticus) egg yolk is a homodimeric exopeptidase with a broad specificity for N-terminal amino acid residues at P1 position of the substrate (Midorikawa et al. 1998). Aminopeptidases are members of a membrane-bound metallopeptidase family that are expressed at a high level on the brush-border membrane of enterocytes (Gal-Garber and Uni, 2000).

[0041] This protein has the following amino acid sequence (i.e. SEQ IDNO:6; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00006 MAAGFFISKSVGIVGIVLALGAVATIIALSVVYAQ EKNKSSGGSGGSDTTSTTTASTTTTSTTTASTTAA PNNPWNRWRLPTALKPESYEVTLQPFLTPDDNNMY IFKGNSSVVFLCEEATDLILIHSNKLNYTLQGGFH ASLHAVNGSTPPTISNTWLETNTQYLVLQLAGPLQ QGQHYRLFSIFTGELADDLAGFYRSEYTEGNVTKV VATTQMQAPDARKAFPCFDEPAMKAVFTVTMIHPS DHTAISNMPVHSTYQLQMDGQSWNVTQFDPTPRMS TYLLAFIVSQFDYVENNTGKVQIRIWGRPAAIAEG QGEYALEKTGPILSFFERHYNTAYPLPKSDQVGLP DFNAGAMENWGLVTYRENSLLYDNAYSSIGNKERV VTVIAHELAHQWFGNLVTLRWWNDLWLNEGFASYV EYLGADSAEPTWDIKDLMVLNELYTVMATDALTTS HPLTFREDEINTPAQISEVFDSIAYSKGASVLRML SDFLTEDVFKEGLQSYLHDFSYNNTVYTDLWDHLQ EAVNKNSVPLPDSIGAIMDRWTLQMGFPVVTVNTL TGSVQQSHFLLDSNSTVERPSVFNYTWIVPITWMT PSRTGDRYWLVDVSATNSDFSVGSSTWLLLNLNVS GYFRVNYNQENWDQLLQQLSNNHQAIPVINRAQII DDAFNLARAQQVSVTLALNTTRFLSGETAYMPWQA ALNNLQYFQLMFDRSEVFGAMTKYIQKQVTPLFEY YRTATNNWTAIPSALMDQYNEINAISTACSYGIAE CQQLATALYQQWRQNVSNNPIAPNLRSAIYCSAVA TGGEEVWDFIWERFLEAPVVSEADKLRTALTCSTE TWILQRYLQYTIDPTKIRKQDATSTINSIASNVVG QPLAWDFIRSNWRTLFGQYGGGSFSFSRLISAVTQ RFNTEFELKQLEQFKADNQDIGFGSGTRALEQALE RTRTNINWVKENKEVVHAWFRAETASS

[0042] 7. Transthyretin

[0043] This protein has accession number P27731 in the UniProt database (see uniprot.org/uniprot/P27731). Plasma transthyretin (TTR) is a plasma protein secreted by the liver that circulates bound to retinol-binding protein 4 (RBP4) and its retinol ligand. TTR is a highly conserved protein in animal species.

[0044] This protein has the following amino acid sequence (i.e., SEQ IDNO:7; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00007 MAFHSTLLVFLAGLVFLSEAAPLVSHGSVDSKCPL MVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATG KTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGL GLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYS TTAVVSDPQE

[0045] The following gray boxes indicate peptides obtained via a trypsin digest of ileal samples of SEQ IDNO:7 as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample:

TABLE-US-00008 MAFHSTLLVFLAGLVFLSEAAPLVSHGSVDSKCPL MVKVLDAVRGSPAANVAVKFKKAADGTWQDFATGK TTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLG LSPFHEYADVVFTANDSGHRHYTIAALLSPFSYST TAVVSDPQE

[0046] 8. Ovoinhibitor

[0047] This protein has accession number P10184 in the UniProt database (see uniprot.org/uniprot/P10184). Ovoinhibitor is found in egg white and is a serine proteinase inhibitor that can reduce enzymatic digestion by trypsin and chymotrypsin.

[0048] This protein has the following amino acid sequence (i.e., SEQ IDNO:8; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00009 MRTARQFVQVALALCCFADIAFGIEVNCSLYASGI GKDGTSWVACPRNLKPVCGTDGSTYSNECGICLYN REHGANVEKEYDGECRPKHVMIDCSPYLQVVRDGN TMVACPRILKPVCGSDSFTYDNECGICAYNAEHHT NISKLHDGECKLEIGSVDCSKYPSTVSKDGRTLVA CPRILSPVCGTDGFTYDNECGICAHNAEQRTHVSK KHDGKCRQEIPEIDCDQYPTRKTTGGKLLVRCPRI LLPVCGTDGFTYDNECGICAHNAQHGTEVKKSHDG RCKERSTPLDCTQYLSNTQNGEAITACPFILQEVC GTDGVTYSNDCSLCAHNIELGTSVAKKHDGRCREE VPELDCSKYKTSTLKDGRQVVACTMIYDPVCATNG VTYASECTLCAHNLEQRTNLGKRKNGRCEEDITKE HCREFQKVSPICTMEYVPHCGSDGVTYSNRCFFCN AYVQSNRTLNLVSMAAC

[0049] 9. Apolipoprotein A-1

[0050] This protein has accession number P08250 in the UniProt database (see uniprot.org/uniprot/P08250). Apolipoprotein (apo) A-1 is a 28 kDa exchangeable apolipoprotein that plays a key role in lipoprotein metabolism.

[0051] This protein has the following amino acid sequence (i.e., SEQ IDNO:9; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00010 MRGVLVTLAVLFLTGTQARSFWQHDEPQTPLDRIR DMVDVYLETVKASGKDAIAQFESSAVGKQLDLKLA DNLDTLSAAAAKLREDMAPYYKEVREMWLKDTEAL RAELTKDLEEVKEKIRPFLDQFSAKWTEELEQYRQ RLTPVAQELKELTKQKVELMQAKLTPVAEEARDRL RGHVEELRKNLAPYSDELRQKLSQKLEEIREKGIP QASEYQAKVMEQLSNLREKMTPLVQEFRERLTPYA ENLKNRLISFLDELQKSVA

[0052] The following gray boxes indicate peptides obtained via a trypsin digest of ileal samples of SEQ IDNO:9 as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample:

TABLE-US-00011 MRGVLVTLAVLFLTGTQARSFWQHDEPQTPLDRIR DMVDVYLETVKASGKDAIAQFESSAVGKQLDLKLA DNLDTLSAAAAKLREDMAPYYKEVREMWLKDTEAL RAELTKDLEEVKEKIRPFLDQFSAKWTEELEQYRQ RLTPVAQELKELTKQKVELMQAKLTPVAEEARDRL RGHVEELRKNLAPYSDELRQKLSQKLEEIREKGIP QASEYQAKVMEQLSNLREKMTPLVQEFRERLTPYA ENLKNRLISFLDELQKSVA

[0053] 10. Hemoglobin Subunit Beta

[0054] This protein has accession number P02112 in the UniProt database (see uniprot.org/uniprot/P02112). The detection of hemoglobin subunit beta (HBB) in intestinal content indicates that the administered challenges induce gut leakage and endothelial damage allowing red blood cell leakage from the blood to the lumen.

[0055] This protein has the following amino acid sequence (i.e., SEQ IDNO:131; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00012 MVHWTAEEKQLITGLWGKVNVAECGAEALARLLIV YPWTQRFFASFGNLSSPTAILGNPMVRAHGKKVLT SFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFR LLGDILIIVLAAHFSKDFTPECQAAWQKLVRVVAH ALARKYH

[0056] 11. Superoxide Dismutase

[0057] This protein has accession number P80566 in the UniProt database (see uniprot.org/uniprot/P80566). Superoxide dismutase (SOD) catalyzes the dismutation of superoxide radicals to hydrogen peroxide (H.sub.2O.sub.2) and oxygen and contributes to enhanced small intestinal preservation in feline (Sun et al., 1991).

[0058] This protein has the following amino acid sequence (i.e., SEQ IDNO:132; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00013 MATLKAVCVMKGDAPVEGVIHFQQQGSGPVKVTGK ITGLSDGDHGFHVHEFGDNTNGCTSAGAHFNPEGK QHGGPKDADRHVGDLGNVTAKGGVAEVEIEDSVIS LTGPHCIIGRTMVVHAKSDDLGRGGDNESKLTGNA GPRLACGVIGIAKC

[0059] The following gray boxes indicate peptides obtained via a trypsin digest of ileal samples of SEQ IDNO:132 as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample:

TABLE-US-00014 MATLKAVCVMKGDAPVEGVIHFQQQGSGPVKVTGK ITGLSDGDHGFHVHEFGDNTNGCTSAGAHFNPEGK QHGGPKDADRHVGDLGNVTAKGGVAEVEIEDSVIS LTGPHCIIGRTMVVHAKSDDLGRGGDNESKLTGNA GPRLACGVIGIAKC

[0060] 12. Alpha-Actinin-4

[0061] This protein has accession number Q90734 in the UniProt database (see uniprot.org/uniprot/Q90734). By indirect immunofluorescence, alpha-actinin-4 (ACTN4) was shown to be localized in the apical part of chicken intestinal epithelial cells (Craig and Pardo, 1979), more specifically as a component of the tight junction (zonula occludens) (Chen et al., 2006) and/or belt desmosome (zonula adherens) (Milanini et al., 2017).

[0062] This protein has the following amino acid sequence (i.e., SEQ IDNO:133; the gray boxes indicate peptides obtained via a trypsin digest of colon samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00015 MVDYHSAGQPYPYGGNGPGPNGDYMAQEDDWDRDL LLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDED FRDGLKLMLLLEVISGERLPKPERGKMRVHKINNV NKALDFIASKGVNVVSIGAEEIVDGNAKMTLGMIW TIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKN VNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRK DDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARP DEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAV NQENEHLMEDYEKLASDLLEWIRRTIPWLEDRSPQ KTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINF NTLQTKLRLSNRPAFMPSEGRMVSDINTGWQHLEQ AEKGYEEWLLNEIRRLEPLDHLAEKFRQKASIHEA WTEGKEAMLKQKDYETATLSDIKALIRKHEAFESD LAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQK ICDQWDVLGSLTHSRREALEKTEKQLETIDELHLE YAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLI AAHDQFKATLPDADREREAILGIQREAQRIADLHS IKLSGNNPYTSVTPQVINSKWERVQQLVPTRDRAL QDEQSRQQCNERLRRQFAGQANIVGPWMQTKMEEI GRISIEMHGTLEDQLQHLKHYEQSIVDYKPNLELL EHEHQLVEEALIFDNKHTNYTMEHIRVGWEQLLTT IARTINEVENQILTRDAKGISQEQMQEFRASFNHF DKDHCGALGPEEFKACLISLGYDVENDRQGDAEFN RIMSLVDPNGSGSVTFQAFIDFMSRETTDTDTADQ VIASFKVLAGDKNYITAEELRRELPPEQAEYCIAR MAPYRGPDAAPGALDYKSFSTALYGESDL

[0063] 13. Angiotensin-Converting Enzyme

[0064] This protein has accession number Q10751 in the UniProt database (see uniprot.org/uniprot/Q10751). Angiotensin-converting enzyme (ACE) are localized in the intestinal brush border membrane and are involved as major functional enzymes in the final stadium of protein digestion in the small intestine (Yoshioka et al., 1987).

[0065] This protein has the following amino acid sequence (i.e., SEQ IDNO:134; the gray boxes indicate peptides obtained via a trypsin digest of ileal samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00016 AKELYGNIWSNFSDPQLKKIIGSIQTLGPSNLPLD KRQQYNTILSDMDKIYSTAKVCLDNGTCWDLEPDI SDIMATSRSYKKLLYAWEGWHNAAGNPLRAKYQEF VTLSNEAYQMDGFEDTGSYWRSWYDSTTFEDDLEH LYNQLEPLYLNLHAFVRRKLYDRYGPKYINLKGPI PAHLLGNMWAQQWNNIYDLMVPYPDKPNLDVTNTM VNQGWNATHMFRVSEEFFTSLGLLEMPPEFWEKSM LEKPADGREVVCHASAWDFYNRKDFRIKQCTTVTM EQLFTVHHEMGHVQYYLQYKDQPVSFRGGANPGFH EAIGDVLSLSVSTPSHLQKIGLLSSAVEDEESNIN YLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPSR YNYDWWYLRTKYQGICAPVSRNESNFDPGAKYHIP GNTPYIRYFVSFILQFQFHKALCQAANHTGPLHTC DIYMSKEAGAKLREVLKAGSSKSWQEILFNLTGTD KMDAGALLEYFSPVTTWLQEQNNKTNEVLGWPEFD WRSPIPEGYPEGIDKIVDEAQAKEFLSEYNSTAEV VWNAYTEASWEYNTNITDHNKEVMLEKNLAMSKHT IEYGMRARQFDPSDFQDETVTRILNKLSVLERAAL PEDELKEYNTLLSDMETTYSVAKVCRENNTFHPLD PDLTDILATSRDYNELLFAWKGWWDASGAKIKDKY KRYVELSNKAAVLNGYTDNGAYWRSLYETPTFEED LERLYLQLQPLYLNLHAYVRRALYNKYGAEHISLK GPIPAHLLGNMWAQSWSNIFDLVMPFPDATKVDAT PAMKQQGWTPKMMFEESDRFFTSLGLIPMPQEFWD KSMIEKPADGREVVCHASAWDFYNRKDFRIKQCTV VNMDDLITVHHEMGHVQYFLQYMDQPISFRDGANP GFHEAIGDVMALSVSTPKHLHSINLLDQVTENEES DINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIK EDEYNQQWWNLRLKYQGLCPPVPRSEDDFDPGAKF HIPANVPYIRYFVSFVIQFQFHQALCKAAGHTGPL HTCDIYQSKEAGKLLGDAMKLGFSKPWPEAMQLIT GQPNMSAEALMSYFEPLMTWLVKKNTENGEVLGWP EYSWTPYAVTEFHAATDTADFLGMSVGTKQATAGA WVLLALALVFLITSIFLGVKLFSSRRKAFKSSSEM ELK

[0066] 14. WD Repeat-Containing Protein 1

[0067] This protein has accession number 093277 in the UniProt database (see uniprot.org/uniprot/093277). WD (tryptophan-aspartate) repeat-containing protein 1 (WDR1), also called actin-interacting protein 1 (AIP1), acts as a cofactor of ADF-cofilin and facilitates actin turnover by disassembly of actin filaments (Fujibuchi et al., 2004).

[0068] This protein has the following amino acid sequence (i.e., SEQ IDNO:135; the gray boxes indicate peptides obtained via a trypsin digest of ileal samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00017 MRMPYEIKKVFASLPQVERGVSKIIGGDPKGNNFL YTNGKCVVIRNIDNPAIADIYTEHAHQVVVAKYAP SGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAG KIKDLAWTEDSKRIAVVGEGREKFGAVFLWDSGSS VGEITGHNKVINSVDIKQTRPYRLATGSDDNCAAF FEGPPFKFKFTLSDHTRFVNCVRFSPDGNRFATAS ADGQIFIYDGKTGEKVCALGGGKAHDGGIYAISWS PDSSQLLSASGDKTAKIWDVGANSVVSTFNMGSNV LDQQLGCLWQKDHLLSLSLSGYINYLDKNNPDKPL RVIKGHSKSIQCLTVHKNGGKSYIYSGSNDGHINY WDSDTGENDGFSGKGHTNQVSRMAVDEMDQLVTCS MDDTVRYTNLSKRDYSGQDAVKMDVQPKCLAVGPG GYTVVLCIGQIVLMKDKKKCFAIDDLGYEPEAVAV HPGGGSVAVGGTDGNVRLYSIQGTSLKSDDKTLEA KGPVTDLAYSHDGAFLAVCDANKVVTVFSVPDGYV EHNVFYGHHAKVVCIAWSPDNEHFASGGMDMMVYV WTVSDPETRIKIPDAHRLHHVSGLAWLDEHTLVTT SHDASVKEWSISYN

[0069] 15. Aspartate Aminotransferase, Mitochondrial

[0070] This protein has accession number P00508 in the UniProt database (see uniprot.org/uniprot/P00508). Aspartate aminotransferase, mitochondrial (AATM), formerly known as glutamic-oxaloacetic transaminase, catalyzes the reaction of L-aspartate and 2-oxoglutatarate to oxaloacetate and glutamate. This mitochondrial isotype is present predominantly in liver (Kaneko et al., 2008).

[0071] This protein has the following amino acid sequence (i.e., SEQ IDNO:136; the gray boxes indicate peptides obtained via a trypsin digest of ileal samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00018 MALLQSRLLLSAPRRAAATARASSWWSHVEMGPPD PILGVTEAFKRDTNSKKMNLGVGAYRDDNGKSYVL NCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAEL ALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQR FFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYY DPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPT GVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASG DINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGER AGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMN GARIASLILNTPELRKEWLVEVKGMADRIISMRTQ LVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVE RLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQ VTK

[0072] 16. Histone H2A-IV

[0073] This protein has accession number P02263 in the UniProt database (see uniprot.org/uniprot/P02263). H2A4 is a core component of nucleosomes that wrap and compact DNA into chromatin.

[0074] This protein has the following amino acid sequence (i.e., SEQ IDNO:137; the gray boxes indicate peptides obtained via a trypsin digest of ileal samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00019 MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLL RKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQ GGVLPNIQAVLLPKKTDSHKAKAK

[0075] 17. Ig Lambda Chain C Region

[0076] This protein has accession number P20763 in the UniProt database (see uniprot.org/uniprot/P20763). Antibodies consist of two heavy and light chains whereby birds only have one isotope of light chain, namely lambda (λ). The light chain is made up by a constant, Ig lambda chain C-region (LAC), and a variable region, Ig lambda chain V1-region (LV1) (Benčina et al., 2014).

[0077] This protein has the following amino acid sequence (i.e., SEQ IDNO:138; the gray boxes indicate peptides obtained via a trypsin digest of ileal samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00020 QPKVAPTITLFPPSKEELNEATKATLVCLINDFYP SPVTVDWVIDGSTRSGETTAPQRQSNSQYMASSYL SLSASDWSSHETYTCRVTHNGTSITKTLKRSEC

[0078] 18. Ig Lambda Chain V1 Region

[0079] This protein has accession number P04210 in the UniProt database (see uniprot.org/uniprot/P04210). Antibodies consist of two heavy and light chains whereby birds only have one isotope of light chain, namely lambda (λ). The light chain is made up by a constant, Ig lambda chain C-region (LAC), and a variable region, Ig lambda chain V1-region (LV1) (Benčina et al., 2014).

[0080] This protein has the following amino acid sequence (i.e., SEQ IDNO:139; the gray boxes indicate peptides obtained via a trypsin digest of ileal samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00021 MAWAPLLLAVLAHTSGSLVQAALTQPSSVSANPGE TVKITCSGDRSYYGWYQQKAPGSAPVTLIYDNTNR PSNIPSRFSGSKSGSTATLTITGVQADDEAVYYCG SADSSSTA

[0081] 19. Cathepsin D

[0082] This protein has accession number Q05744 in the UniProt database (see uniprot.org/uniprot/Q05744). Cathepsin D (CATD), an aspartic proteinase, is optimally active against denatured proteins at acidic pH. CATD is expressed in lysozomes, but also exists bound to some intracellular membranes, which has been detected in several different cell types (Fusek and Vetvicka, 1995).

[0083] This protein has the following amino acid sequence (i.e., SEQ IDNO:140; the gray boxes indicate peptides obtained via a trypsin digest of ileal samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00022 MAPRGLLVLLLLALVGPCAALIRIPLTKFTSTRRM LTEVGSEIPDMNAITQFLKFKLGFADLAEPTPEIL KNYMDAQYYGEIGIGTPPQKFTVVFDTGSSNLWVP SVHCHLLDIACLLHHKYDASKSSTYVENGTEFAIH YGTGSLSGFLSQDTVTLGNLKIKNQIFGEAVKQPG ITFIAAKFDGILGMAFPRISVDKVTPFFDNVMQQK LIEKNIFSFYLNRDPTAQPGGELLLGGTDPKYYSG DFSWVNVTRKAYWQVHMDSVDVANGLTLCKGGCEA IVDTGTSLITGPTKEVKELQTAIGAKPLIKGQYVI SCDKISSLPVVTLMLGGKPYQLTGEQYVFKVSAQG ETICLSGFSGLDVPPPGGPLWILGDVFIGPYYTVF DRDNDSVGFAKCV

[0084] 20. Retinol-Binding Protein 4

[0085] This protein has accession number P41263 in the UniProt database (see uniprot.org/uniprot/P41263). Transthyretin (TTR) is a highly conserved protein in animal species that is involved in transport of thyroid hormones and retinol bound to retinol-binding protein 4 (RET4) in the bloodstream (Ingenbleek & Bernstein, 2015). Retinol (vitamin A) is known to be essential for differentiation and proliferation of epithelial cells (Thomas et al., 2004).

[0086] This protein has the following amino acid sequence (i.e., SEQ IDNO:141; the gray boxes indicate peptides obtained via a trypsin digest of ileal samples as is described further and represent non-limiting examples of protein fragments that can be quantified in a fecal or an intestinal content sample):

TABLE-US-00023 MAYTWRALLLLALAFLGSSMAERDCRVSSFKVKEN FDKNRYSGTWYAMAKKDPEGLFLQDNVVAQFTVDE NGQMSATAKGRVRLFNNWDVCADMIGSFTDTEDPA KFKMKYWGVASFLQKGNDDHWVVDTDYDTYALHYS CRELNEDGTCADSYSFVFSRDPKGLPPEAQKIVRQ RQIDLCLDRKYRVIVHNGFCS

[0087] The disclosure further relates to a method as described above wherein an increased level of a protein chosen from the group consisting of myeloid protein 1, fibronectin, annexin A5, nucleophosmin, carbonic anhydrase 2, transthyretin, ovoinhibitor, apolipoprotein A-1, hemoglobin subunit beta, alpha-actinin-4, histone H2A-IV and retinol-binding protein 4 present in the fecal or intestinal content sample, when compared to the level found in fecal and/or intestinal content samples of healthy control animals, is an indicator of poor intestinal health. The terms “increased levels of protein compared to the level found in healthy control animals” means at least a two-fold increase such as a 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold . . . increase compared to the level found in healthy control animals.

[0088] The disclosure further relates to a method as described above wherein a decreased level of the protein aminopeptidase Ey, superoxide dismutase [Cu—Zn], angiotensin-converting enzyme, WD repeat-containing protein 1, mitochondrial aspartate aminotransferase, immunoglobulin lambda chain C region, immunoglobulin lambda chain V-1 region and cathepsin D present in the fecal or an intestinal content sample, when compared to the level found in fecal and/or an intestinal content samples of healthy control animals, is an indicator of poor intestinal health. The terms “decreased levels of protein compared to the level found in healthy control animals” means at least a two-fold decrease such as a 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold . . . decrease compared to the level found in healthy control animals.

[0089] The disclosure thus relates to a method as described above wherein the protein abundance is significantly differential between healthy and challenged group and/or level of protein correlates with the intestinal health as determined by measuring villus length in the duodenum of the birds, and/or, by measuring villus-to-crypt ratio in the duodenum of the birds, and/or by measuring T-lymphocyte infiltration is the villi, and/or, by scoring the macroscopic gut appearance of the birds. It is clear that the intestinal health is a measure for/correlates with performance parameters of the birds such as body weight and feed conversion ratio.

[0090] The disclosure further relates to a method as described above wherein the intestinal content sample is a colonic content sample and wherein the protein is chosen from the group consisting of: myeloid protein 1, fibronectin, annexin A5, nucleophosmin, carbonic anhydrase 2, aminopeptidase Ey, transthyretin, ovoinhibitor, apolipoprotein A-1, hemoglobin subunit beta, superoxide dismutase [Cu—Zn] and alpha-actinin-4.

[0091] The disclosure further relates to a method as described above wherein the intestinal content sample is an ileal content sample and wherein the protein is chosen from the group consisting of: aminopeptidase Ey, transthyretin, apolipoprotein A-1, superoxide dismutase [Cu—Zn], angiotensin-converting enzyme, WD repeat-containing protein 1, mitochondrial aspartate aminotransferase, histone H2A-IV, immunoglobulin lambda chain C region, immunoglobulin lambda chain V-1 region, cathepsin D and retinol-binding protein 4.

[0092] More specifically, the disclosure relates to a method as described above wherein the fragment of myeloid protein 1 comprises at least one of the following amino acid sequences: APFSGELSGPVK (SEQ IDNO:10), APFSGQLSGPIR (SEQ IDNO:11), FSGELSGPVK (SEQ IDNO:12), HGQIQK (SEQ IDNO:13), SDPTSNLER (SEQ IDNO:14), SGELSGPVK (SEQ IDNO:15), SGQLSGPIR (SEQ IDNO:16), VFPGIISHI (SEQ IDNO:17), VFPGIVSH (SEQ IDNO:18), VFPGIVSHI (SEQ IDNO:19); wherein the fragment of fibronectin comprises at least one of the following amino acid sequences: ATITGYK (SEQ IDNO:20), DDQESIPISK (SEQ IDNO:21); wherein the fragment of annexin A5 comprises at least one of the following amino acid sequences: KAMKGMGTDEETILK (SEQ IDNO:22), LLLAVVK (SEQ IDNO:23), VDEALVEK (SEQ IDNO:24); wherein the fragment of nucleophosmin comprises at least one of the following amino acid sequences: IGNASTK (SEQ IDNO:25), TPDSK (SEQ IDNO:26), TVTLGAGAK (SEQ IDNO:27), VVLASLK (SEQ IDNO:28); wherein the fragment of carbonic anhydrase 2 comprises at least one of the following amino acid sequences: VGNAKPEIQK (SEQ IDNO:29), VVDALNSIQTK (SEQ IDNO:30); wherein the fragment of aminopeptidase Ey comprises at least one of the following amino acid sequences: ADNQDIGFGSGTR (SEQ IDNO:31), AIAEGQGEYALEK (SEQ IDNO:32), APVVSEADK (SEQ IDNO:33), AQIIDDAFNLAR (SEQ IDNO:34), AVFTVTMIHPS (SEQ IDNO:35), AWDFIR (SEQ IDNO:36), DFIWER (SEQ IDNO:37), DFLTEDVFK (SEQ IDNO:38), DHLQEAVNK (SEQ IDNO:39), DLWDHLQEAVNK (SEQ IDNO:40), DNAYSSIGNK (SEQ IDNO:41), EAPVVSEADK (SEQ IDNO:42), EGQGEYALEK (SEQ IDNO:43), ENSLLYDNAYSSIGNK (SEQ IDNO:44), EQALER (SEQ IDNO:45), FLEAPVVSEADK (SEQ IDNO:46), FLEAPVVSEADKLR (SEQ IDNO:47), FNTEFELK (SEQ IDNO:48), GADSAETWDIK (SEQ IDNO:49), HYNTAYPLPK (SEQ IDNO:50), IAEGQGEYALEK (SEQ IDNO:51), ILSFFER (SEQ IDNO:52), IWGRPAAIAE (SEQ IDNO:53), IWGRPAAIAEGQGEY (SEQ IDNO:54), IWGRPAAIAEGQGEYALEK (SEQ IDNO:55), KQDATSTIN (SEQ IDNO:56) KQDATSTINSIASNVVGQPL (SEQ IDNO:57), KQDATSINSIASNVVGQPLA (SEQ IDNO:58), LAGPLQQGQHYR (SEQ IDNO:59), LEAPVVSEADK (SEQ IDNO:60), LPTALKPESYEVTLQPF (SEQ IDNO:61), MLSDFLTEDVFK (SEQ IDNO:62), NSVPLPDSIGAIMDR (SEQ IDNO:63), PAAIAEGQGEYALEK (SEQ IDNO:64), QAIPVINR (SEQ IDNO:65), QDATSTINSIASNVVGQPL (SEQ IDNO:66), QNVSNNPIAPNLR (SEQ IDNO:67), SDFLTEDVFK (SEQ IDNO:68), SDQVGLPDFNAGAMENWG (SEQ IDNO:69), SEVFDSIAYSK (SEQ IDNO:70), SLLYDNAYSSIGNK (SEQ IDNO:71), SNNHQAIPVINR (SEQ IDNO:72), SVPLPDSIGAIMDR (SEQ IDNO:73), TDLWDHLQEAVNK (SEQ IDNO:74), TGELADDLAGFYR (SEQ IDNO:75), TGPILSFFER (SEQ IDNO:76), TIDPTK (SEQ IDNO:77), TLFGQYGGGSFSFSR (SEQ IDNO:78), TNINWVK (SEQ IDNO:79), VNYNQENWDQLL (SEQ IDNO:80), VNYQENWDQLLQ (SEQ IDNO:81), VNYQENWDQLLQQ (SEQ IDNO:82), VVATTQMQAPDAR (SEQ IDNO:83), WRLPTAL (SEQ IDNO:84), WRLPTALKPES (SEQ IDNO:85), WRLPTALKPESYEVTLQPF (SEQ IDNO:86), YDNAYSSIGNK (SEQ IDNO:87), YLQYTIDPTK (SEQ IDNO:88), YPLPK (SEQ IDNO:89); wherein the fragment of transthyretin comprises at least one of the following amino acid sequences: AADGTWQDFATGK (SEQ IDNO:90), CPLMVK (SEQ IDNO:91), DGTWQDFATGK (SEQ IDNO:92), DVVFTANDSGHR (SEQ IDNO:93), GLGLSPFH (SEQ IDNO:94), GLGLSPFHEY (SEQ IDNO:95), GLGLSPFHEYA (SEQ IDNO:96), GLGLSPFHEYADVVF (SEQ IDNO:97), GLGLSPFHEYADVVFTANDSGHR (SEQ IDNO:98), GSPAANVAVK (SEQ IDNO:99), GSPAANVAVKV (SEQ IDNO:100), GTWQDFATGK (SEQ IDNO:101), HYTIAALL (SEQ IDNO:102), HYTIAALLSPF (SEQ IDNO:103), HYTIAALLSPFS (SEQ IDNO:104), TTEEQFVEGVYR (SEQ IDNO:105), TTEFGEIHEL (SEQ IDNO:106), TTEFGEIHELTTEEQ (SEQ IDNO:107), TTEFGEIHELTTEEQFVEGV (SEQ IDNO:108), TTEFGEIHELTTEEQFVEGVYR (SEQ IDNO:109), TTEFGEIHELTTEEQFVEGVYRVEFDTSSYWK (SEQ IDNO:110), VEFDTSSYWK (SEQ IDNO:111), VLDAVR (SEQ IDNO:112); wherein the fragment of ovoinhibitor comprises at least one of the following amino acid sequences: EHGANVEK (SEQ IDNO:113), TLNLVSMAAC (SEQ IDNO:114), TLVACPR (SEQ IDNO:115); wherein the fragment of apolipoprotein A-1 comprises at least one of the following amino acid sequences: DLEEVKEK (SEQ IDNO:116), EMWLK (SEQ IDNO:117), IRDMVDV (SEQ IDNO:118), IRPFLDQF (SEQ IDNO:119), IRPFLDQFSAK (SEQ IDNO:120), LADNLDTLSAAAAK (SEQ IDNO:121), LISFLDELQK (SEQ IDNO:122), LSQKLEEI (SEQ IDNO:123), LTPVAEEAR (SEQ IDNO:124), LTPVAQELK (SEQ IDNO:125), LTPYAENLK (SEQ IDNO:126), MTPLVQEFR (SEQ IDNO:127), QKLSQK (SEQ IDNO:128), QLDLK (SEQ IDNO:129), YKEVR (SEQ IDNO:130); wherein the fragment of hemoglobin subunit beta comprises at least one of the following amino acid sequences: KVLTSFGDAV (SEQ IDNO:142), LHVDPENF (SEQ IDNO:143), LLIVYPWTQR (SEQ IDNO:144), NLDNIK (SEQ IDNO:145), VLTSFGDAVK (SEQ IDNO:146); wherein the fragment of superoxide dismutase [Cu—Zn]comprises at least one of the following amino acid sequences: AVCVMK (SEQ IDNO:147), FQQQGSGPVK (SEQ IDNO:148), GDAPVEGVIHFQQQGSGPVK (SEQ IDNO:149), GGVAEVEI (SEQ IDNO:150), GGVAEVEIEDSVISLTGPH (SEQ IDNO:151), GVIGIAK (SEQ IDNO:152), HVGDLGNVTA (SEQ IDNO:153), HVGDLGNVTAK (SEQ IDNO:154), ITGLSDGDHGFHVH (SEQ IDNO:155), LACGVIGIAK (SEQ IDNO:156), LTGNAGPR (SEQ IDNO:157), SDDLGR (SEQ IDNO:158), SDDLGRGGDNESK (SEQ IDNO:159), TMVVHA (SEQ IDNO:160); wherein the fragment of alpha-actinin-4 comprises at least one of the following amino acid sequences: DAEDIVNTARDPEK (SEQ IDNO:161), TIPWLEDR (SEQ IDNO:162); wherein the fragment of angiotensin-converting enzyme comprises at least one of the following amino acid sequences: AALPEDELKEYNTLLSDMETTYSVAK (SEQ IDNO:163), ALYNK (SEQ IDNO:164), DGANPGFHEAIGDV (SEQ IDNO:165), DGANPGFHEAIGDVMA (SEQ IDNO:166), DGANPGFHEAIGDVMAL (SEQ IDNO:167), DYNELLFAWK (SEQ IDNO:168), ETPTFEEDLER (SEQ IDNO:169), EVMLEK (SEQ IDNO:170), FEESDR (SEQ IDNO:171), FFTSLGLIPMPQEFWDK (SEQ IDNO:172), GGANPGFHEAIGDVLS (SEQ IDNO:173), GLIPMPQEFWDK (SEQ IDNO:174), GLLEMPPEFWEK (SEQ IDNO:175), GPIPAHL (SEQ IDNO:176), GPIPAHLLGNMW (SEQ IDNO:177), GPIPAHLLGNMWAQQ (SEQ IDNO:178), GPIPAHLLGNMWAQS (SEQ IDNO:179), GYLIDQWR (SEQ IDNO:180), IIGSIQTLGPSNLPLDK (SEQ IDNO:181), IIGSIQTLGPSNLPLDKR (SEQ IDNO:182), IKEDEYNQQWWNL (SEQ IDNO:183), IYSTAK (SEQ IDNO:184), KIIGSIQTLGPSNLPLDK (SEQ IDNO:185), LLGDAMK (SEQ IDNO:186), LLYAWEGWHNAAGNPLR (SEQ IDNO:187), LSVLER (SEQ IDNO:188), MSIALDK (SEQ IDNO:189), NTILSDMDK (SEQ IDNO:190), QCTVVNMDDLITVH (SEQ IDNO:191), QFDPSDFQDETVTR (SEQ IDNO:192), QQGWTPK (SEQ IDNO:193), QQYNTILSDMDK (SEQ IDNO:194), RYVELSNK (SEQ IDNO:195), SLGLIPMPQEFWDK (SEQ IDNO:196), SLSVSTPSHLQK (SEQ IDNO:197), SLYETPTFEEDLER (SEQ IDNO:198), SMIEKPADGR (SEQ IDNO:199), SNIFDLVMPFPDATK (SEQ IDNO:200), SVSTPK (SEQ IDNO:201), SVSTPSHLQK (SEQ IDNO:202), TLGPSNLPLDK (SEQ IDNO:203), TNEVLGWPEFDWRSPIPEGYPEGIDK (SEQ IDNO:204), TSLGLIPMPQEFWDK (SEQ IDNO:205), TSLGLLEMPPEFWEK (SEQ IDNO:206), VDATPAMK (SEQ IDNO:207), VELSNK (SEQ IDNO:208), YGAEHISLK (SEQ IDNO:209), YHIPGNTPY (SEQ IDNO:210), YINLK (SEQ IDNO:211), YNELLFAWK (SEQ IDNO:212), YQGLCPPVPR (SEQ IDNO:213), YVELSNK (SEQ IDNO:214); wherein the fragment of WD repeat-containing protein 1 comprises at least one of the following amino acid sequences: IIGGDPK (SEQ IDNO:215), KVFASLPQVERGVSK (SEQ IDNO:216), VINSVDIK (SEQ IDNO:217); wherein the fragment of mitochondrial aspartate aminotransferase comprises at least one of the following amino acid sequences: GPPDPILGVTEAFK (SEQ IDNO:218), LLLSAPR (SEQ IDNO:219), MDKEYLPI (SEQ IDNO:220), MGLYGER (SEQ IDNO:221), NPTGVDPR (SEQ IDNO:222), TQLVSNLK (SEQ IDNO:223); wherein the fragment of histone H2A-IV comprises at least one of the following amino acid sequences: NDEELNK (SEQ IDNO:224), VTIAQGGVLPNIQAAVLLPK (SEQ IDNO:225); wherein the fragment of immunoglobulin lambda chain C region comprises at least one of the following amino acid sequences: DFYPSPVTVDWVIDGSTR (SEQ IDNO:226), ITLFPPSK (SEQ IDNO:227), NDFYPSPVTVDWVIDGSTR (SEQ IDNO:228), SGETTAPQR (SEQ IDNO:229), THNGTSITK (SEQ IDNO:230), TVDWVIDGSTR (SEQ IDNO:231), VAPTITLFPPSK (SEQ IDNO:232), VAPTITLFPPSKEELN (SEQ IDNO:233), VAPTITLFPPSKEELNEAT (SEQ IDNO:234), VAPTITLFPPSKEELNEATK (SEQ IDNO:235), VTHNGTSITK (SEQ IDNO:236); wherein the fragment of immunoglobulin lambda chain V1 region comprises at least one of the following amino acid sequences: ALTQPSSVSANPGETVK (SEQ IDNO:237), APGSAPVTLIYDNTNRPSNIPSR (SEQ IDNO:238), GSAPVTLIYDNTNRPSNIPSR (SEQ IDNO:239), ITCSGDR (SEQ IDNO:240), NPGETVK (SEQ IDNO:241), PSNIPSR (SEQ IDNO:242), RPSNIPSR (SEQ IDNO:243), SANPGETVK (SEQ IDNO:244), SVSANPGETVK (SEQ IDNO:245), YGWYQQK (SEQ IDNO:246); wherein the fragment of cathepsin D comprises at least one of the following amino acid sequences: DPTAQPGGELLLGGTDPK (SEQ IDNO:247), ELQTAIGAKPL (SEQ IDNO:248), ELQTAIGAKPLI (SEQ IDNO:249), FDGILGMAFPR (SEQ IDNO:250), IPLTK (SEQ IDNO:251), QPGGELLLGGTDPK (SEQ IDNO:252), VTPFFDNVMQQK (SEQ IDNO:253); wherein the fragment of retinol-binding protein 4 comprises at least one of the following amino acid sequences: QIDLCLDR (SEQ IDNO:254), TVDENGQMSATAK (SEQ IDNO:255).

[0093] Furthermore, the disclosure relates to a method as described above wherein the domesticated bird is a broiler. The term “broiler” refers to any chicken (Gallus gallus domesticus) that is bred and raised specifically for meat production.

[0094] Moreover, the preset disclosure relates to a method as described above wherein the proteins or fragments thereof are quantified by using antibodies that specifically bind to the proteins or fragments thereof.

[0095] The phrase “specifically (or selectively) binds (or detects)” a protein or peptide, when referring to an antibody, refers to a binding reaction that is determinative of the presence of the protein in a heterogeneous population of proteins and other biologics. Thus, under designated immunoassay conditions, the specified antibodies bind to a particular protein at least two times the background and do not substantially bind in a significant amount to other proteins present in the sample. Specific binding to an antibody under such conditions may require an antibody that is selected for its specificity for a particular protein. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988), for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity). Typically a specific or selective reaction will be at least twice background signal or noise and more typically more than 10 to 100 times background. “Immunoassay” is an assay that uses an antibody to specifically bind an antigen (e.g., a marker). The immunoassay is characterized by the use of specific binding properties of a particular antibody to isolate, target, and/or quantify the antigen.

[0096] Furthermore, the disclosure relates to a method as described above wherein the antibodies are part of an Enzyme-Linked Immunosorbent Assay.

[0097] The disclosure will be further illustrated by the following, non-limiting Examples.

Examples

List of Abbreviations

[0098] BHI Brain Heart Infusion [0099] BW Body weight [0100] CD Crypt depth [0101] CD.sub.3 Cluster of differentiation 3 [0102] CFU Colony forming units [0103] DAB Di-amino-benzidine [0104] DDA Data Dependent Acquisition [0105] DFI Daily feed intake [0106] DTT Dithiothreitol [0107] DWG Daily weight gain [0108] FCR Feed conversion ratio [0109] HPLC-MS High performance liquid chromatography-mass spectrometry [0110] HRP Horseradish peroxidase [0111] LB Lysogeny Broth [0112] MGAS Macroscopic Gut Appearance Score [0113] MMTS Methyl methanethiosulfonate [0114] MPDS 2 Mass prep digestion standard 2 [0115] MRS Man-Rogosa-Sharpe [0116] MWCO Molecular weight cut-off [0117] OTU Operational taxonomic unit [0118] PBS Phosphate buffered saline [0119] psi Pound per square inch [0120] TEABC Triethylammonium bicarbonate [0121] VL Villus length [0122] VL/CD Villus-to-crypt ratio

Materials and Methods

[0123] Study Design

[0124] A total of 360 day-old broilers (Ross 308) were obtained from a local hatchery and housed in floor pens on wooden shavings. Throughout the study, feed and drinking water were provided ad libitum. The broilers were randomly assigned to two treatment groups, a control and challenge group (9 pens per treatment and 20 broilers per pen). All animals were fed a commercial feed till day 12 and the feed was switched to a wheat (57.5%) based diet supplemented with 5% rye (Table 1). From day 12 to 18, all animals from the challenge group received 10 mg florfenicol and 10 mg enrofloxacin per kg body weight via the drinking water daily, to induce substantial changes in the gut microbial community. After the antibiotic treatment, 1 ml of a bacterial cocktail consisting of Escherichia coli (G.78.71), Enterococcus faecalis (G.78.62), Lactobacillus salivarius (LMG22873), Lactobacillus crispatus (LMG49479), Clostridium perfringens (netB-) (D.39.61) and Ruminococcus gnavus (LMG27713) was given daily by oral gavage from day 19 till 21. Cultures of the bacteria were prepared as follows. Lysogeny Broth (LB, Oxoid,) was used for growing E. coli. Enterococcus faecalis and C. perfringens were grown in Brain Heart Infusion (BHI, Sigma) broth. Man-Rogosa-Sharpe (MRS, Oxoid) medium was used for the growth of L. crispatus and L. salivarius. For the growth of R. gnavus, anaerobic M2GSC medium (pH 6) as described by Miyazaki et al. (1997) was used but with 15% clarified rumen fluid instead of 30% and addition of 1 mg/ml cysteine HCl and 4 mg/ml NaHCO.sub.3 after autoclaving. E. coli and Enterococcus faecalis was cultured in aerobic conditions at 37° C. In an aerobic (5% 02) incubator, Lactobacillus spp. were cultured. C. perfringens and R. gnavus were cultured an anaerobic chamber (gas mixture 84% N2, 8% 02 en 8% H.sub.2, GP[concept], Jacomex, France) at 37° C. The bacterial cells were collected by ultracentrifugation (10,000 rpm, 10 minutes, 20° C.) and each pellet was resuspended in 100 ml anaerobic phosphate buffered saline (PBS, 1 mg/ml cysteine HCl, pH 6). The resuspended pellets were mixed and diluted with anaerobic PBS to a total volume of 1.5:1 to reach a final concentration of about 109 colony-forming units (CFU)/ml for each bacterial strain (Table 2). On day 20, the animals were administered a coccidial challenge consisting of different Eimeria sp., namely 60,000 oocysts of E. acervulina and 30,000 oocysts E. maxima.

[0125] At day 26, the birds were weighed and 3 birds per pen were euthanized. The duodenal loop was sampled for histological examination and content from ileum and colon was collected for protein extraction.

TABLE-US-00024 TABLE 1 Composition and nutrient content of the wheat/rye based broiler diet. Starter diet was given till day 11. Grower was given from day 12 to day 34. Starter Grower Calculated nutrient Starter Grower Feedstuff % % composition (%) % % Wheat 55.13 57.87 Dry matter 88.45 88.38 Rye 0.00 5.00 Ash 5.11 4.79 Soy meal, crude fiber 22.86 22.86 Crude protein 20.85 18.98 content < 50 Full fat soybeans 7.50 2.50 Crude fat 10.83 9.90 Animal fat 7.20 7.20 Crude fiber 2.93 2.49 Soybean oil 1.00 1.00 Carbohydrates 48.46 51.95 Premix 0.50 0.50 Starch 34.62 38.46 Lime fine 1.11 1.11 Sugars 4.77 4.53 Monocalcium 0.83 0.83 NDF 10.52 9.93 phosphate Salt 0.18 0.18 ADF 4.18 3.52 NaHCO.sub.3 0.25 0.25 Calcium 0.69 0.66 L-lysine HCl 0.30 0.30 Phosphorus, total 0.57 0.54 DL-methionine 0.30 0.30 Calcium/dP poultry 0.22 0.22 L-threonine 0.10 0.10 Magnesium 0.16 0.14 Rapeseed meal < 380 2.74 0.00 Potassium 0.88 0.79 Sodium 0.15 0.15 Chloride 0.20 0.20 Base-excess (mEq/kg) 23.39 20.97 Linolic acid 2.38 1.92

TABLE-US-00025 TABLE 2 Broilers were orally inoculated with 1 ml of a bacterial cocktail on day 19, 20 and 21 with 10.sup.6-10.sup.10 CFU of Escherichia coli, Enterococcus faealis, Lactobacillus salivarius, Lactobacillus crispatus, Clostridium perfringens (netB−) and Ruminococcus gnavus Day 19 Day 20 Day 21 Bacterial strain (CFU/ml) (CFU/ml) CFU/ml) E. coli 2.11 × 10.sup.9 1.22 × 10.sup.9 2.28 × 10.sup.9 Enterococcus faecalis 3.44 × 10.sup.9 .sup. 2.28 × 10.sup.10 3.56 × 10.sup.9 Lactobacillus salivarius 4.78 × 10.sup.7 1.16 × 10.sup.7 2.39 × 10.sup.7 Lactobacillus crispatus 1.89 × 10.sup.9 7.78 × 10.sup.7 7.22 × 10.sup.6 Clostridium perfringens   1 × 10.sup.7 1.06 × 10.sup.7 2.78 × 10.sup.8 Ruminococcus gnavus 2.89 × 10.sup.8 2.78 × 10.sup.8 3.17 × 10.sup.8

[0126] Macroscopic Scoring System

[0127] The macroscopic appearance of the gut was evaluated using a previously described scoring system (Teirlynck et al., 2011), in which, in total, 10 parameters were assessed and assigned 0 (absent) or 1 (present), which resulted in a total score between 0 and 10. A total score of 0 represents a normal appearance of the intestinal tract while 10 points to severe deviations from the normal appearance. The parameters are (1) “ballooning” of the gut; (2) inflammation, cranial to the Meckel's diverticulum; (3) macroscopically visible and tangible fragile small intestine cranial to the Meckel's diverticulum; (4) loss of tonus in longitudinal cutting of the intestine cranial to the Meckel's diverticulum within the 3 seconds after incision; (5) abnormal occurrence of the intestinal content (excess mucus, orange content, gas) cranial to the Meckel's diverticulum; (6, 7, 8, 9) are identical to (2, 3, 4, 5) but caudal to the Meckel's diverticulum and (10) presence of undigested particles in the colon. A coccidiosis scoring was performed as described in Johnson & Reid (1970) in which the animals were given a score for typical lesions associated with Eimeria acervulina, E. maxima and E. tenella. For each, a score was given between 0 (absent) and 4 (severe). A total coccidiosis score was calculated as the sum of the scores given for lesions caused by each individual Eimeria species.

[0128] Morphological Parameters

[0129] The duodenal loop was fixated in 4% formaldehyde for 24 hours, dehydrated in xylene and embedded in paraffin. Sections of 4 μm were cut using a microtome (Microme HM360, Thermo Scientific) and were processed as described by De Maesschalck et al. (2015). Morphological parameters were determined using standard light microscopy. Villus length and crypt depth in the duodenum were measured by random measurement of twelve villi per intestinal segment using Leica DM LB2 Digital and a computer based image analysis program, LAS V4.1 (Leica Application Suite V4, Germany). Also the villus-to-crypt ratio was calculated.

[0130] Immunohistochemical Examination

[0131] Antigen retrieval was performed on 4 μm sections with a pressure cooker in citrate buffer (10 mM, pH 6). Slides were rinsed with washing buffer (Dako kit, K4011) and blocked with peroxidase reagent (Dako, S2023) for 5 minutes. Slides were rinsed with aqua destillata and Dako washing buffer before incubation with anti-CD.sub.3 primary antibodies (Dako CD.sub.3, A0452) for 30 minutes at room temperature diluted 1:100 in antibody diluent (Dako, S3022). After rinsing again with washing buffer, slides were incubated with labelled polymer-HRP anti-rabbit (Envision.sup.+ System-HRP, K4011) for 30 minutes at room temperature. Before adding di-amino-benzidine (DAB.sup.+) substrate and DAB.sup.+ chromogen (Dako kit, K4011) for 5 minutes, slides were rinsed 2 times with washing buffer. To stop the staining, the slides were rinsed with Aquadest, dehydrated using the Shandon Varistain-Gemini Automated Slide Stainer and counterstained with hematoxylin for 10 seconds. The slides were analyzed with Leica DM LB2 Digital and a computer based image analysis program LAS V4.1 (Leica Application Suite V4, Germany) to measure CD.sub.3 positive area on a total area of 3 mm.sup.2, which represents T-lymphocyte infiltration in approximately 10 villi per section.

Discovery Proteomics

[0132] Sample Preparation

[0133] Individual colon and ileal content samples were collected and stored at −20° C. before use. 500 mg was solubilized in 10 ml 2 M urea, 50 mM ammonium bicarbonate and homogenized by vortexing. After centrifugation (20,000×g, 15 minutes, 4° C.), the supernatant was filtered through a 0.22 μm filter unit (Merck, Germany) directly in a Vivaspin 20 with a 5 kDa MWCO filter (Sartorius, Germany) and centrifuged for 1 hour at 4000×g. The filter was washed 3 times with 1 ml 2 M urea, 50 mM ammonium bicarbonate followed by centrifugation (4000×g, 10 minutes, 4° C.). The samples were washed 3 times with 1 ml 500 mM triethylammonium bicarbonate (TEABC, Sigma) to remove the urea. Subsequently, the samples were concentrated to a volume of ±500 μl. To determine the protein concentration, a Bradford assay was performed where OD was measured at 595 nm. Approximately 50 μg of proteins were reduced with 1 mM dithiothreitol (DTT) and incubated at 60° C. for 30 minutes, followed by alkylation for 10 minutes at room temperature with 10 mM methyl methanethiosulfonate (MMTS). Hereafter, calcium chloride and acetonitrile were added to a final concentration of 1 mM and 5% (v/v) respectively. Finally trypsin was added in a 1:20 (trypsin:protein) ratio for overnight digestion at 37° C. The samples were vacuum dried and analyzed with high performance liquid chromatography-mass spectrometry (HPLC-MS).

[0134] HPLC-MS

[0135] Peptides were dissolved in 0.1% formic acid in HPLC-grade water (buffer A) to a final concentration of 1 μg/μL. 100 fmol of mass prep digestion standard 2 (MPDS 2) was spiked into each sample. Data Dependent Acquisition MS analysis was performed on a TripleTOF 5600 (Sciex) fitted with a DuoSpray ion source in positive ion mode, coupled to an Eksigent NanoLC 400 HPLC system (Sciex). Peptides were separated on a microLC YMC Triart C18 column (id 300 μm, length 15 cm, particle size 3 μm) at a flow rate of 5 μL/minute by means of trap-elute injection (YMC Triart C18 guard column, id 500 μm, length 5 mm, particle size 3 μm). Elution was performed using a gradient of 4-40% buffer B (0.1% formic acid, 5% DMSO in 80% ACN) over 90 minutes. Ion source parameters were set to 5.5 kV for the ion spray voltage, 30 psi for the curtain gas, 13 psi for the nebulizer gas and 80° C. as temperature.

[0136] For DDA, a 2.25-second instrument cycle was repeated in high sensitivity mode throughout the whole gradient, consisting of a full scan MS spectrum (300-1250 m/z) with an accumulation time of 0.2 seconds, followed by 20 MS/MS experiments (50-1800 m/z) with 0.2 seconds accumulation time each, on MS precursors with charge state 2 to 5+ exceeding a 500 cps threshold. Rolling collision energy was used as suggested by the manufacturer and former target ions were excluded for 10 seconds.

[0137] Database Searching

[0138] The *.wiff files generated during LC-MS/MS analysis were imported into the Progenesis QI for Proteomics software (Non-linear Dynamics). The different samples were aligned based on retention time and m/z of reoccurring features to enable relative quantification. After subsequent peak picking, a merged *.mgf file was exported from the software and searched for identifications with MASCOT Daemon (Matrix Science, version 2.5.1) against a chicken database (reviewed protein database downloaded from Swissprot, January 2016) supplemented with the cRAP database (laboratory proteins and dust/contact proteins thegpm.org/crap/) and the internal standard. Maximum peptide mass tolerance and fragment mass tolerance were set to 10 ppm and 0.1 Da respectively. Additionally, methylthio on cysteine was set as a fixed modification and deamidation of asparagine and/or glutamine and oxidation of methionine were set as variable modifications. Enzyme specificity was set to trypsin with a maximum of one missed cleavage. The identifications were exported from MASCOT Daemon with a 5% false discovery rate (*.xml format) and imported into Progenesis QI for Proteomics.

[0139] Statistical Analysis

[0140] Statistical analysis was performed with Graphpad Prism (v.5). To evaluate whether the data is normally distributed, a Kolmogorov-Smirnov test was performed. In case of a normal distribution, comparison of the data was performed with an independent samples t-test. Otherwise, the non-parametric Mann-Whitney test was performed. A p-value of <0.05 was considered statistically significant. The statistical coherence between different parameters was evaluated via correlation analysis.

Results

[0141] Performance Parameters

[0142] Body weight (BW), daily weight gain (DWG), daily feed intake (DFI) and feed conversion ratio (FCR) were measured during different time periods. Significant differences between treatment and control groups were seen at day 26, 35 and 41, but not at the age of 12 days (Table 3).

TABLE-US-00026 TABLE 3 Mean ± standard deviation of body weight (BW), daily weight gain (DWG), daily feed intake (DFI) and feed conversion ratio (FCR) measured during different time periods for the control and challenge group. Significant differences (p < 0.05) are shown in bold. Control Challenge Time period parameters Mean ± SD Mean ± SD p-value D 1-D 12 BW (g) 290 ± 13 295 ± 11 0.485 DWG (g) 19.6 ± 1.sup.  20.2 ± 1.sup.  0.342 DFI (g) 24 ± 1 25 ± 1 0.614 FCR  1.25 ± 0.06  1.23 ± 0.05 0.321 D 12-D 26 BW (g) 1375 ± 58  1195 ± 46  <0.001 DWG (g) 78 ± 4 64 ± 4 <0.001 DFI (g) 116 ± 6  108 ± 7  0.014 FCR  1.50 ± 0.07  1.69 ± 0.18 0.004 D 26-D 35 BW (g) 2345 ± 174 2153 ± 129 0.003 DWG (g) 106 ± 10 105 ± 6  0.857 DFI (g) 185 ± 10 203 ± 15 0.016 FCR  1.76 ± 0.14  1.94 ± 0.20 0.040 D 35-D 41 BW (g) 3095 ± 164 2850 ± 176 0.001 DWG (g) 121 ± 17 114 ± 21 0.276 DFI (g) 161 ± 14 166 ± 10 0.427 FCR  1.35 ± 0.14  1.53 ± 0.45 0.041 D 12-D 35 DWG (g) 86 ± 5 76 ± 4 <0.001 DFI (g) 136 ± 6  135 ± 8  0.811 FCR  1.59 ± 0.08  1.79 ± 0.18 0.002 D 12-D 41 DWG (g) 91 ± 4 82 ± 5 <0.001 DFI (g) 139 ± 7  140 ± 7  0.864 FCR  1.52 ± 0.04  1.72 ± 0.13 <0.001

[0143] Macroscopic Scoring

[0144] The appearance of the gut and a coccidiosis score were given to 27 birds per treatment. A lower body weight was observed at day 26 (p=0.0001) for broilers that received challenge treatment. The score for the macroscopic appearance of the gut and the total coccidiosis score were higher in the challenged group at day 26 (p<0.001) (FIGS. 1A-1C, Table 4).

TABLE-US-00027 TABLE 4 Mean ± standard deviation of body weight (BW), macroscopic gut appearance score (MGAS) and coccidiosis score (CS) for the control (n = 27) and challenge group (n = 27) at day 26. Significant differences (p < 0.05) are shown in bold. Control Challenge Timepoint parameters Mean ± SD Mean ± SD p-value D 26 BW (g)  1375 ± 157.4  1187 ± 170.1 p = 0.0001 MGAS 0.9 ± 0.7 3.1 ± 1.1 p < 0.001 CS 0.8 ± 0.7 3.5 ± 1.7 p < 0.001

[0145] Intestinal Morphology and Immunohistochemistry

[0146] A significant shorter villus length, an increased crypt depth, a lower villus-to-crypt ratio and a higher inflammation level in duodenal sections on day 26 (p<0.0001) were detected in the gut of animals from the treatment group as compared to the control group (Table 5).

TABLE-US-00028 TABLE 5 Mean ± standard deviation of villus length (VL), crypt depth (CD), villus-to-crypt ratio (VL/CD) and T-lymphocyte infiltration (CD.sub.3 area %) on day 26 for control (n = 27) and challenge group (n = 27). For all evaluated parameters, statistical significance was p < 0.0001. Control Challenge Timepoint parameters Mean ± SD Mean ± SD D 26 VL (μm) 2035.7 ± 134.6 1369.9 ± 158.7  CD (μm)  190.1 ± 15.43 365.7 ± 31.41 VL/CD 11.03 ± 1.03 3.85 ± 0.63 CD.sub.3 area %  7.88 ± 1.35 9.54 ± 2.71

[0147] Correlations

[0148] Pearson r has a value between −1 (total negative correlation) and +1 (total positive correlation). In case of a positive correlation, one parameter increases as the other parameter increases and vice versa. When one parameter decreases and the other one increases, there is a negative correlation. On day 26, all macroscopic (macroscopic gut appearance score, coccidiosis score and body weight) and histological parameters (villus length, crypt depth, villus-to-crypt ratio and T-lymphocyte infiltration) correlate with one another (Table 6).

TABLE-US-00029 TABLE 6 Pearson correlation coefficient between macroscopic gut appearance score (MGAS), coccidiosis score (CS), body weight (BW), villus length (VL), crypt depth (CD), villus-to-crypt ratio (VL/CD) and T-lymphocyte infiltration (CD3 area %). Correlation coefficients with a statistical significance of p < 0.05 are shown. Day 26 CD.sub.3 area MGAS CS BW VL CD VL/CD % MGAS — CS 0.0905 — BW −0.6836 −0.5974 — VL −0.8400 −0.8572 0.7400 — CD 0.8220 0.8045 −0.7546 −0.9073 — VL/CD −0.8507 −0.8599 0.7303 0.9570 −0.9773 — CD.sub.3 0.8559 0.8177 −0.770 −0.9028 0.8959 −0.8979 — area %

[0149] Discovery Proteomics 1.

[0150] Using MASCOT Daemon (Matrix Science, version 2.5.1) against a chicken database (reviewed protein database downloaded from Swissprot, January 2016) supplemented with the cRAP database (laboratory proteins and dust/contact proteins thegpm.org/crap/), 157 proteins were identified for colon. In theory, a good gut health biomarker should relate with one or more histological parameters since measurement of villus length and inflammation level are used as standard measurements in the evaluation of intestinal health. Also correlation with the macroscopic gut appearance score was evaluated. It is noted that proteins of which the colonic concentration has a negative correlation with the villus length, inverse correlation was seen with crypt depth, CD.sub.3 area % and macroscopic gut appearance score. Only correlations with a statistical significance of p<0.1 are shown (Table 7).

TABLE-US-00030 TABLE 7 Pearson correlation coefficient between the abundance of the protein in colon content and villus length (VL), crypt depth (CD), villus-to-crypt ratio (VL/CD) and T-lymphocyte infiltration (CD.sub.3 area %) and macroscopic gut appearance score (MGAS) on day 26. Correlation coefficients with a statistical significance of p < 0.1 are shown. Day 26 Accession number VL CD.sub.3 area % MGAS P08940 Myeloid protein 1 −0.7283 0.5466 0.5668 P11722 Fibronectin −0.8114 0.6515 0.6519 P17153 Annexin A5 −0.5746 P16039 Nucleophosmin −0.5263 0.7196 P07630 Carbonic anhydrase 2 −0.5899 0.5726 O57579 Aminopeptidase Ey 0.5462 −0.7177 P27731 Transthyretin −0.5778 0.6065 P10184 Ovoinhibitor −0.4852 P08250 Apolipoprotein A-1 −0.5066

[0151] Discovery Proteomics 2

[0152] Using MASCOT Daemon (Matrix Science, version 2.5.1) against a chicken database (reviewed protein database downloaded from Swissprot, January 2016) supplemented with the cRAP database (laboratory proteins and dust/contact proteins thegpm.org/crap/), 157 and 181 proteins were identified for colon and ileum respectively whereby significant differential proteins between control and challenged birds were selected (p<0.05). In broilers from the challenge group, the following proteins showed a significantly higher abundance compared to control animals in colonic content (p<0.05): alpha-actinin-4 (ACTN4), annexin A5 (ANXA5), apolipoprotein A-1 (APOA1), fibronectin (FINC), hemoglobin subunit beta (HBB), myeloid protein 1 (MIMI), nucleophosmin (NPM), ovoinhibitor (IOV7) and transthyretin (TTR). Both in colonic and ileal content, superoxide dismutase [Cu—Zn] (SOD) showed a decreased abundance compared to control animals (p<0.05). Angiotensin-converting enzyme (ACE), mitochondrial aspartate aminotransferase (AATM), cathepsin D (CATD), Ig lambda chain C region (LAC), Ig lambda chain V-1 region (LV1), TTR and WD repeat-containing protein 1 (WDR1) showed a lower abundance in challenged birds (p<0.05) in ileal samples. Following proteins were more abundant (p<0.05): APOA1, histone H2A-IV (H2A4) and retinol-binding protein 4 (RET4) (Table 8 and Table 9).

TABLE-US-00031 TABLE 8 Significantly different proteins between control and challenge group in colonic content. Accession Highest number Protein name Abbreviation P-value mean Q90734 Alpha-actinin 4 ACTN4 0.0385 Challenge P17153 Annexin A5 ANXA5 0.0266 Challenge P08250 Apolipoprotein A-1 APOA1 0.0277 Challenge P11722 Fibronectin FINC 0.0106 Challenge P02112 Hemoglobin subunit HBB 0.0158 Challenge beta P08940 Myeloid protein 1 MIM1 0.0008 Challenge P16039 Nucleophosmin NPM 0.0071 Challenge P10184 Ovoinhibitor IOV7 0.0254 Challenge P80566 Superoxide dismutase SOD 0.0287 Control [Cu—Zn] P27731 Transthyretin TTR 0.0317 Challenge

[0153] Proteomics using high performance liquid chromatography-mass spectrometry (HPLC-MS) was performed on colonic content of animals from the control (n=9) and challenged (n=9) group at day 26. This resulted in significant differential proteins (p<0.05) with a higher normalized abundance of 9 proteins and a decrease of superoxide dismutase [Cu—Zn] in challenged birds.

TABLE-US-00032 TABLE 9 Significantly different proteins between control and challenge group in ileal content. Accession Highest number Protein name Abbreviation P-value mean O57579 Aminopeptidase Ey AMPN 0.0012 Control Q10751 Angiotensin-converting ACE 0.0006 Control enzyme P08250 Apolipoprotein A-1 APOA1 0.0364 Challenge P00508 Aspartate AATM 0.0067 Control aminotransferase, mitochondrial Q05744 Cathepsin D CATD 0.0203 Control P02263 Histone H2A-IV H2A4 0.0079 Challenge P20763 Ig lambda chain C LAC 0.0155 Control region P04210 Ig lambda chain V-1 LV1 0.0370 Control region P41263 Retinol-binding RET4 0.0399 Challenge protein 4 P80566 Superoxide dismutase SOD 0.0004 Control [Cu—Zn] P27731 Transthyretin TTR 0.0091 Control O93277 WD repeat-containing WDR1 0.0027 Control protein 1

[0154] Proteomics using high performance liquid chromatography-mass spectrometry (HPLC-MS) was performed on ileal content of animals from the control (n=9) and challenged (n=9) group at day 26. This resulted in 12 significant differential proteins (p<0.05) with a higher normalized abundance of apolipoprotein A-1 (APOA1), histone H2A-IV (H2A4) and retinol-binding protein 4 (RET4) and decrease in normalized abundance for the other 9 proteins in challenged birds.

REFERENCES

[0155] Adelman, D. C., Murray, J., Wu, T. T., Maki, M., Green, P. H. and Kelly, C. P. (2018). Measuring Change In Small Intestinal Histology In Patients With Celiac Disease. The American Journal of Gastroenterology doi: 10.1038/ajg.2017.480. [0156] Awad, W. A., Ghareeb, K., Abdel-Raheem, S., and Bohm, J. (2009). Effects of dietary inclusion of probiotic and synbiotic on growth performance, organ weights, and intestinal histomorphology of broiler chickens. Poultry Science 88: 49-55 [0157] Bailey, R. A. (2010). Intestinal Microbiota and the Pathogenesis of Dysbacteriosis in Broiler Chickens. Doctor of Philosophy, Institute of Food Research—Norwich Research Park, United Kingdom, https://core.ac.uk/download/pdf/2778547.pdf [0158] Benčina, M., Cizelj, I., Berčič, R. L., Narat, M., Benčina, D. and Dovč, P. (2014). Shared epitopes of avian immunoglobulin light chains. Veterinary Immunology and Immunopathology 158:175-181 [0159] Broom, L. J. and Kogut, M. H. (2018). Inflammation: friend or foe for animal production? Poultry Science 97, 2: 510-514 [0160] Caly, D. L., D'Inca, R., Auclair, E. and Drider, D. (2015). Alternatives to Antibiotics to Prevent Necrotic Enteritis in Broiler Chickens: A Microbiologist's Perspective. Frontiers in Microbiology 6: 1336 [0161] Canani, R. B., Terrin, G., Rapacciuolo, L., Miele, E., Siani, M. C., Puzone, C., Cosenza, L., Staiano, A. and Troncone, R. (2008). Faecal calprotectin as reliable non-invasive marker to assess the severity of mucosal inflammation in children with inflammatory bowel disease. Digestive and Liver Disease 40, 7: 547-553 [0162] Casewell, M., Friis, C., Marco, E., McMullin, P. and Phillips, I. (2003). The European ban on growth-promoting antibiotics and emerging consequences for human and animal health. Journal of Antimicrobial Chemotherapy 52, 2: 159-161 [0163] Chang, M-H., Chou, J-W., Chen, S-M., Tsai, M-C., Sun, Y-S., Lin, C-C. and Lin, C-P. (2014). Faecal calprotectin as a novel biomarker for differentiating between inflammatory bowel disease and irritable bowel syndrome. Molecular Medicine Reports 10, 1: 522-526 [0164] Chen, V. C., Li, X., Perreault, H. and Nagy, J. I. (2006). Interaction of Zonula Occludens-1 (ZO-1) with r-Actinin-4: Application of Functional Proteomics for Identification of PDZ Domain-Associated Proteins. Journal of Proteome Research 5:2123-2134 [0165] Cowieson, A. J. and Selle, P. H. (2012). The Environmental Impact of Low Feed Conversion Ratios in Poultry. Available at: https://en.engormix.com/poultry-industry/articles/(published 17 Jul. 2012). [0166] Craig, S. W. and Pardo, J. V. (1979). Alpha-actinin localization in the junctional complex of intestinal epithelial cells. Journal of cell biology 80: 203-210 [0167] De Maesschalck, C., Eeckhaut, V., Maertens, L., De Lange, L., Marchal, L., Nezer, C., De Baere, S., Croubels, S., Daube, G., Dewulf, J., Haesebrouck, F., Ducatelle, R., Taminau, B. and Van Immerseel, F. (2015). Effects of Xylo-Oligosaccharides on Broiler Chicken Performance and Microbiota. Applied and Environmental Microbiology 81, 17: 5880-5888 [0168] Fujibuchi, T., Abe, Y., Takeuchi, T., Imai, Y., Kamei, Y., Murase, R., Ueda, N., Shigemoto, K., Yamamoto, H. and Kito, K. (2004). AIP1/WDR1 supports mitotic cell rounding. Biochemical and Biophysical Research Communications 327: 268-275 [0169] Fusek, M. and Vetvicka, V. (2005). Dual role of cathepsin D: ligand and protease. Biomedical papers of the Medical Faculty of the University Palacky, Olomouc, Czechoslovakia 149, 1:43-50 [0170] Gal-Garber, O. and Uni, Z. (2000). Chicken intestinal aminopeptidase: Partial sequence of the gene expression and activity. Poultry Science 79: 41-45. [0171] Gilani, S., Howarth, G. S., Kitessa, S. M., Tran, C. D., Forder, R. E. A. and Hughes, R. J. (2016). Intestinal permeability induced by lipopolysaccharide and measured by lactulose, rhamnose and mannitol sugars in chickens. Animal 11, 7: 1174-1179 [0172] Gilani, S., Howarth, G. S., Kitessa, S. M., Tran, C. D., Forder, R. E. A. and Hughes, R. J. (2017). New biomarkers for increased intestinal permeability induced by dextran sodium sulphate and fasting in chickens. Journal of Animal Physiology and Animal Nutrition 101, 5: 237-245 [0173] Gilani, S., Howarth, G. S., Tran, C. D., Barekatain, R., Kitessa, S. M., Forder, R. E. A. and Hughes, R. J. (2018). Reduced fasting periods increase intestinal permeability in chickens. Journal of Animal Physiology and Animal Nutrition 102, 1: 486-492 [0174] Hong, Y. H., Dinh, H., Lillehoj, H. S., Song, K-D. and Oh, J-D. (2014). Differential regulation of microRNA transcriptome in chicken lines resistant and susceptible to necrotic enteritis disease. Poultry Science 93, 6: 1383-1395 [0175] Ingenbleek, Y. and Bernstein, L. H. (2015). Plasma Transthyretin as a Biomarker of Lean Body Mass and Catabolic States. Advances in Nutrition 6: 572-580 [0176] Johnson, J. and Reid, W. M. (1970). Anticoccidial Drugs: Lesion Scoring Techniques in Battery and Floor-Pen Experiments with Chickens. Experimental Parasitology 28, 30-36 [0177] Kaneko, J. J., Harvey, J. W., Bruss, M. L., Hoffmann, W. E. and Solter, P. F. (2008). Diagnostic Enzymology of Domestic Animals. Clinical Biochemistry of Domestic Animals 351-378 [0178] Kuttappan, V. A., Vicuna, E. A., Latorre, J. D., Wolfenden, A. D., Tellez, G. I., Hargis, B. M. and Bielke, L. R. (2015). Evaluation of Gastrointestinal Leakage in Multiple Enteric Inflammation Models in Chickens. Frontiers in Veterinary Science 2:66 [0179] Mellgren, R. L. (2010). A plasma membrane wound proteome: reversible externalization of intracellular proteins following reparable mechanical damage. Journal of Biological Chemistry 285: 36597-36607 [0180] Midorikawa, T., Abe, R., Yamagata, Y. Nakajima, T. and Ichishima, E. (1998). Isolation and characterization of cDNA encoding chicken egg yolk aminopeptidase Ey. Comparative Biochemistry and Physiology—Part B: Biochemistry & Molecular Biology 119, 3: 513-520 [0181] Milanini, J., Fayad, R., Partisani, M., Lecine, P., Borg, J-P., Franco, M. and Luton, F. (2017). EFA6 regulates lumen formation through alpha-actinin 1. Journal of Cell Science 131 [0182] Milanini, J., Fayad, R., Partisani, M., Lecine, P., Borg, J-P., Franco, M. and Luton, F. (2017). EFA6 regulates lumen formation through alpha-actinin 1. Journal of Cell Science 131 [0183] O'Reilly, E. L. and Eckersall, P. D. (2014). Acute phase proteins: a review of their function, behaviour and measurement in chickens. World's Poultry Science 70, 1: 27-44 [0184] Pankov, R. and Yamada, K. M. (2002). Fibronectin at a glance. Journal of Cell Science 115: 3861-3863 [0185] Scanes, C. G. (2007). The global importance of poultry. Poultry Science 86, 6: 1057-1058 [0186] Sun S C, Greenstein S M, Schechner R S, Sablay L B, Veith, F J and Tellis V A (1991). Superoxide dismutase: enhanced small intestinal preservation. Journal of surgical research 52, 583-590 [0187] Teirlynck, E., De Gussem, M., Dewulf, J., Haesebrouck, F., Ducatelle, R. and Van Immerseel, F. (2011). Morphometric evaluation of “dysbacteriosis” in broilers. Avian Pathology 40, 2: 139-144 [0188] Thomas, S., Prabhu, R. and Balasubramanian, K. A. (2018). Retinoid metabolism in the rat small intestine. British Journal of Nutrition 93: 59-63 [0189] Wang, L., Llorente, C., Hartmann, P., Yang, A. M., Chen, P. and Schnabl, B. (2015). Methods to determine intestinal permeability and bacterial translocation during liver disease. Journal of Immunological Methods 421: 44-53 [0190] Yamauchi, K. (2002). Histological Alterations Related with Intestinal Function. The Journal of Poultry Science 39, 4: 229-242 [0191] Yegani, M. and Korver, D. R. (2008). Factors Affecting Intestinal Health in Poultry. Poultry Science 87, 10: 2052-2063 [0192] Yoshioka, M., Erickson, R. H., Woodley, J. F., Gulli, R., Guan, D. and Kim, Y. S. (1987). Role of rat intestinal brush-border membrane angiotensin-converting enzyme in dietary protein digestion. American Journal of Physiology 253: G781-786