MICROBIAL COMPOSITIONS COMPRISING ELLAGITANNIN AND METHODS OF USE

20250228277 ยท 2025-07-17

    Inventors

    Cpc classification

    International classification

    Abstract

    A combination is provided comprising an ellagitannin composition, and an enzymatic composition comprising one or more ellagitannin enzymes, where the one or more ellagitannin enzymes comprise a tannin acyl hydrolase enzyme, a gallate decarboxylase enzyme, or a combination thereof. Methods of making and using combinations disclosed herein are also provided.

    Claims

    1. A combination comprising: (a) an ellagitannin composition; and (b) an enzymatic composition comprising an ellagitannin-enzyme-synthesizing (EES) microbe or an extract thereof and one or more ellagitannin enzymes, wherein the one or more ellagitannin enzymes comprise a tannin acyl hydrolase enzyme, a gallate decarboxylase enzyme, or a combination thereof.

    2. The combination of claim 1, wherein the one or more ellagitannin enzymes comprises a tannin acyl hydrolase enzyme.

    3. The combination of claim 2, wherein the tannin acyl hydrolase enzyme is a tanB tannase enzyme.

    4. The combination of claim 1, wherein the one or more ellagitannin enzymes comprises a gallate decarboxylase enzyme.

    5. The combination of claim 4, wherein the gallate decarboxylase enzyme is an lpdB gallate decarboxylase enzyme.

    6. The combination of claim 4, wherein the gallate decarboxylase enzyme is an lpdC gallate decarboxylase enzyme.

    7. The combination of claim 1, wherein the one or more ellagitannin enzymes comprises an lpdB gallate decarboxylase enzyme and an lpdC gallate decarboxylase enzyme.

    8. The combination of claim 1, wherein the one or more ellagitannin enzymes comprises a tanB tannase enzyme, an lpdB gallate decarboxylase enzyme, and an lpdC gallate decarboxylase enzyme.

    9. (canceled)

    10. The combination of claim 9, wherein the EES microbe is found in nature.

    11. The combination of claim 9, wherein the EES microbe is an engineered EES microbe.

    12. The combination of claim 11, wherein the engineered EES microbe comprises a genetic alteration relative to an otherwise comparable reference microbe so that it produces the one or more ellagitannin enzymes at an absolute or relative level different from that of the reference microbe.

    13. The combination of claim 9, wherein the EES microbe is a member of the Lactobacillaceae family.

    14. The combination of claim 13, wherein the member of the Lactobacillaceae family is a L. plantarum species.

    15. The combination of claim 9, wherein the EES microbe is viable or alive.

    16. The combination of claim 15, wherein the combination includes a sufficient amount of the EES microbe to colonize the microbiome of a subject.

    17. The combination of claim 9, wherein the EES microbe is lyophilized.

    18. The combination of claim 1, wherein the ellagitannin composition comprises a plant extract of pomegranate, strawberry, raspberry, cranberry, blackberry, cloudberry, artic blackberry, muscadine grapes, guava, a Myrtaceae family fruit, walnut, pecan, chestnut, cashew, almond, pistachio, hazelnut, brazil nut, macadamia red wine aging in oak barrels, muscadine grapes juice, pomegranate juice, tea, cognac, Indian gooseberry, beefsteak fungus, or combinations thereof.

    19. The combination of claim 9, further comprising a prebiotic.

    20. The combination of claim 19, further comprising a fructooligosaccharide, an inulin, an isomaltooligosaccharide, a lactilol, a lactosucrose, a lactulose, a soy oligosaccharide, a transgalactooligosaccharide, a xylooligosaccharide, or a combination thereof.

    21. The combination of claim 1, wherein the ellagitannin composition, the enzymatic composition, or both is formulated for oral administration.

    22. The combination of claim 1, wherein the combination is a food, a beverage, a feed composition, or a nutritional supplement.

    23. The combination of claim 1, wherein the combination is a liquid, syrup, tablet, troche, gummy, capsule, powder, gel, or film.

    24. The combination of claim 1, further comprising a pharmaceutically acceptable carrier.

    25. The combination of claim 24, wherein the combination is an enteric-coated formulation.

    26. A method comprising administering the combination of claim 1 to a subject.

    27. A method comprising administering to a subject a combination comprising: (a) an ellagitannin composition, and (b) an enzymatic composition comprising an ellagitannin-enzyme-synthesizing (EES) microbe or an extract thereof and one or more ellagitannin enzymes, wherein the one or more ellagitannin enzymes comprise a tannin acyl hydrolase enzyme, a gallate decarboxylase enzyme, or a combination thereof.

    Description

    BRIEF DESCRIPTION OF THE DRAWING

    [0102] FIG. 1 shows induction levels of gst-4 expression using reporter CL2166 dvIs19 [pAF15 (gst-4::gfp-nls)] III in Caenorhabditis elegans using a qualitative visual screen. Panel (a) shows induction levels of gst-4 expression from the reporter CL2166 dvIs19 [pAF15 (gst-4::gfp-nls)] III in C. elegans fed negative control bacteria and no pome extract. Panel (b) shows induction levels of gst-4 expression from the reporter CL2166 dvIs19 [pAF15 (gst-4::gfp-nls)] III in C. elegans fed negative control bacteria and pome extract. Panel (c) shows induction levels of gst-4 expression from the reporter CL2166 dvIs19 [pAF15 (gst-4::gfp-nls)] III in C. elegans fed Lactobacillus planetarium (MBT501) and no pome extract. Panel (d) shows induction levels of gst-4 expression from the reporter CL2166 dvIs19 [pAF15 (gst-4::gfp-nls)] III in C. elegans fed L. planetarium (MBT501) and pome extract.

    [0103] FIG. 2, panel (A) includes a schematic of a cluster of genes involved in ellagitannin metabolism. FIG. 2, panel (B) includes a bar graph showing normalized expression levels from tannase (tanB), gallate decarboxylase (lpdB), and gallate decarboxylase (lpdC) genes in C. elegans fed negative control bacteria with (gray bars) and without (black bars) pome extract.

    [0104] FIG. 3, panel (A) includes a bar graph showing colony forming units of L. planetarium (MBT501) at 0, 2, and 4 weeks alone (black bars) or with pome extract (gray bars). FIG. 3, panel (B) shows colony forming units of L. planetarium (MBT501) on a culture plate at 0, 2, and 4 weeks alone (black rectangle) or with pome extract (gray rectangle).

    [0105] FIG. 4, panel (A) includes a bar graph showing induction levels of Nrf2 expression using reporter Nrf2: Luciferase in a human liver cell line (HepG) treated with L. planetarium (MBT501) alone, pome extract alone, or L. planetarium (MBT501) and pome extract. FIG. 4, panel (B) includes a Western blot showing Nrf2 protein levels in a human liver cell line (HepG) treated with L. planetarium (MBT501) alone, pome extract alone, or L. planetarium (MBT501) and pome extract.

    [0106] FIG. 5 includes a line graph showing the number of polyQ aggregates formed when using reporter rmls133 (unc_54p::Q40::YFP) in C. elegans fed negative control bacteria, pome extract, fed on L. planetarium (MBT501), and fed on L. planetarium (MBT501) and pome extract. The aggregates were determined using a qualitative visual screen.

    DETAILED DESCRIPTION

    [0107] The present disclosure recognizes that ellagitannin metabolites have biological properties, including in some cases beneficial biological activities. For example, urolithins (e.g., urolithin A, urolithin B, urolithin C, urolithin D, and/or isourolithin A) resulting from ellagitannin metabolism may improve, e.g., mitochondrial function, by (among other things) increasing mitophagy (e.g., recycling of mitochondria by autophagy). While ellagitannin metabolites (e.g., urolithins) can influence biological activities, such metabolites have been reported to have a low bioavailability. Accordingly, a need for approaches that can increase the bioavailability of ellagitannin metabolites remains in the art.

    [0108] The present disclosure provides the insight that enzymatic compositions comprising one or more ellagitannin enzymes (e.g., a tannin acyl hydrolase enzyme, a gallate decarboxylase enzyme, or a combination thereof) can be utilized to increase the bioavailability of urolithins resulting from the processing of ellagitannin. Thus, among other things, the present disclosure provides technologies in which one or more ellagitannin enzymes are included with an ellagitannin composition. Such technologies provide an increased production urolithins (e.g., urolithin A, urolithin B, urolithin C, urolithin D, and/or isourolithin A) and/or an increase in the bioavailability of urolithins (e.g., urolithin A, urolithin B, urolithin C, urolithin D, and/or isourolithin A), and therefore, provide a solution to needs in the art. In some embodiments, technologies herein can be useful for modifying (e.g., improving) mitochondrial function (e.g., by decreasing mitochondrial dysfunction), and/or modifying antioxidant levels.

    [0109] The present disclosure provides the further insight that microbes, such as natural or genetically modified variants of microbial strains found in a microbiome (e.g., of a mammal, e.g., of a human), can include and/or express one or more ellagitannin enzymes (e.g., ellagitannin-enzyme-synthesizing microbes). Accordingly, the present disclosure provides, among other things, technologies that utilize such microbes, either alone or in combination with an ellagitannin composition, to increase production and/or bioavailability of urolithins. One benefit of using microbial strains that include and/or express one or more ellagitannin enzymes includes that microbial strains, such as those found in a microbiome, are generally safe for administration or consumption by a subject (e.g., a mammal, e.g., a human). Another benefit of using such microbial strains can be that microbial strains can colonize the gut of a subject to whom the strains are administered, which can reduce the number of administrations needed and lengthen the time in which ellagitannin enzymes are present in the gut of the subject. Additionally, microbial strains can be easy to administer to a subject via a number of probiotic forms, as discussed herein.

    Ellagitannin Compositions

    [0110] Ellagitannins are a diverse class of complex hydrolyzable plant tannin polyphenols composed of hexahydroxydiphenoyl moieties esterified to a sugar, i.e., hexahydroxydiphenoyl-glucose esters. Ellagitannins can be found in a variety of foods, such as strawberries (Fragaria vesca), raspberries, blackberries, cloudberries (Rubus chamaemorus), fruits of the Myrtaceae family, including, but not limited to jabuticaba, cambuci, Surinam cherries, camu-camu, red guava, white guava, pomegranate, walnuts, pecans, beefsteak fungus (Fistulina hepatica) and cranberries. Ellagitannin hexahydroxydiphenoyl-glucose esters may comprise varying numbers of hexahydroxydiphenoyl (HHDP) units and galloyl and/or sanguisorboyl units bound to a sugar, and may be produced primarily in dicot angiosperm plant species, including, but not limited to species in the order Myrtales.

    [0111] Following consumption by a subject (e.g., a mammal, e.g., a human), ellagitannins (ETs) can be metabolized in the subject to ellagitannin metabolites, such as an ellagic acid (EA) metabolite, which can be, but is not limited to, urolithin A, urolithin B, urolithin C, urolithin D, isourolithin A, methyl-urolithin A, hydroxyl-urolithin A, and/or derivatives thereof. Although these metabolites can be derived from ellagitannins present in certain foods (e.g., pomegranates), the consumption of these foods often leads to insufficient bioavailability of these beneficial bioactive metabolites. Specifically, certain subjects may fail to produce detectable amounts of these metabolites after consumption of ET-containing foods (e.g., pomegranate juice). In some cases, subjects could benefit from compositions and methods described herein that can increase the bioavailability of ellagitannins in the diet and/or co-administered as part of a composition as described herein. Subjects who produce very low or undetectable levels of ellagitannin metabolites after ingestion may benefit from technologies disclosed herein. However, subjects who may produce detectable levels of ellagitannin metabolites can also benefit from technologies disclosed herein, as increased levels of such metabolites may be desirable.

    [0112] In certain embodiments, an ellagitannin composition is used as a constituent of a composition described herein, or is administered in a method described herein. Non-limiting examples of ellagitannins useful in the methods and compositions described herein include pomegranate ellagitannins, which are numerous, but notably include punicalagins, including punicalin and gallagic acid, each of which can be hydrolyzed to ellagic acid (EA), which can be further hydrolyzed to urolithins A and B by gut microbes. Other ellagitannins include, for example, pedunculagins, rosacyanins (Fukiu et al., Tetrahedron 62:9661-9670 (2006), which is incorporated herein by reference herein in its entirety), phyllanemblinins (Zhang et al., J. Nat. Prod. 64:1527-1532 (2001), which is incorporated herein by reference) and sanguiin H6.

    [0113] Ellagitannin compositions that may be useful in the methods and compositions described herein can include, for example, juices or homogenates of a plant material, including, but not limited to, fruit, or a peel and/or a husk thereof, of an ellagitannin-producing plant. It can be preferable to use a juice or homogenate enriched for ellagitannins by, for example, extraction. Different plant materials can be extracted in different ways. For example, in certain embodiments, materials can be extracted by solvent extraction of lyophilized, ground plant material. Some examples are discussed in the following.

    [0114] An extraction of pomegranate husk or peel that can enrich for ellagitannins, while removing anthocyanins is described, e.g., by Adams et al., J. Agric. Food Chem. 54:980-985 (2006), Seeram et al., Sep. Purif. Technol. 41:49-55, and Sharma et al., J. Agric. Food Chem. 58:3965-3969 (2010), each of which are incorporated herein by reference in their entirety. Purity and concentration of the ellagitannins in such extracts can be determined by HPLC and by liquid chromatography electrospray ionization mass spectrometry (LC-ESI/MS). Pomegranate extract can be obtained commercially, e.g., an extract comprising 37.5% of major pomegranate ellagitannins gallic acid, punicalagin and punicalagin, and 2.7% ellagic acid is available from Verdure Sciences, Noblesville IN. That extract is prepared by the method described by Pacheco-Palencia et al., J. Agric. Food Chem. 56:8434-8441 (2008), which is also incorporated herein by reference.

    [0115] An extract of strawberry ellagitannins can be prepared as described, for example, by Zhang et al., J. Agric. Food Chem. 56:670-675 (2008), which is also incorporated herein by reference. Briefly, lyophilized whole-fruit strawberry powder can be extracted by cold percolation with methanol to yield an extract that is then partitioned in chloroform followed by ethyl acetate. A remaining aqueous portion can be further purified by adsorption chromatography on an XAD-16 (Amberlite Resin, Sigma, St. Louis, MO) column and eluted with water followed by acidic methanol. Methanol eluate can be dried under vacuum and then further enriched in ellagitannin content by suspending in distilled water and filtering to yield a water insoluble fraction enriched in ellagitannins and ellagic acid. Extracts can be standardized by HPLC to 5.0% ellagic acid. Generally, resulting extracts can contain about 20.5% of phenolics, measured as gallic acid equivalents (GAEs).

    [0116] A jamun seed extraction process is also described by Sharma et al., J. Agric. Food Chem. 58:3965-3969 (2010), which is also incorporated herein by reference. Indian jamun (Eugenia jambolana) berry has ellagitannins in its fleshy pulp, but its seeds can be a richer source that do not contain as many anthocyanins. In some instances, anthocynanins can be removed. In some embodiments, compositions described herein are essentially free of or are free of anthocynanins. Extraction of jamun seeds can include, for example, extraction of seed powder in acetone, followed by vacuum drying. The resulting extract can be standardized by HPLC to about 4.2% ellagic acid, with 20.5% phenolics as GAEs. Similar approaches or others known previously can be applied to prepare ellagitannin-containing preparations from other sources for use in methods and compositions described herein.

    [0117] An ellagitannin composition as disclosed herein can be formulated for oral administration. In some embodiments, an ellagitannin composition can be a food, a beverage, a feed composition, or a nutritional supplement. In some embodiments, an ellagitannin composition can be a liquid, syrup, tablet, troche, gummy, capsule, powder, gel, or film.

    [0118] In some embodiments, an ellagitannin composition can be admixed with a pharmaceutically acceptable carrier. In some embodiments, an ellagitannin composition can be include in an enteric-coated formulation.

    [0119] When consumed, ellagitannins can hydrolyze to release ellagic acid. Ellagic acid can be detected in human plasma and has been proposed to act directly on a methyltransferase involved in histone methylation, among other activities. However, ellagitannin metabolites, including, but not limited to, urolithin A (3,8-dihydroxyurolithin), urolithin C (3,8,9 trihydroxyuolithin), Isourolithin A (3,9 dihydroxyuolithin) urolithin B (3-hydroxyuolithin), urolithin D (3,4,8,9-tetrahydroxyurolithin) or a combination thereof require the action of gut microbiota on ellagitannins.

    [0120] The concentration of urolithin A can reach up to micromolar (M) levels in plasma without any apparent toxic effects in vivo. For example, upon consumption of pomegranate juice by humans, peak plasma levels of urolithin A can reach 14 to 40 M. However, there may be wide variations among urolithin levels that result from ellagitannin processing among individuals (see, e.g., Cerda et al., Eur. J. Nut. 43:205-220, which is incorporated herein by reference). Selma et al. identified mono-cultured bacteria (Gordonibacter urolithinfaciens and Gordonibacter pamelaeae DSM 19378T) that can metabolize ellagic acid to produce luteic acid, urolithin M-5, urolithin M-6 and urolithin C. However, these cultured bacteria were incapable of producing downstream products, urolithin A and urolithin B; see Selma et al., Food & Nut. 5:1779-1784 (2014), which is incorporated herein by reference. The present disclosure provides the recognition that wide inter-individual variation may be due to differences in microbiota.

    [0121] Tissue disposition studies reveal that urolithins may be enriched in prostate, intestinal, and colon tissues in mouse. Urolithin A can inhibit proliferation of colon cancer cells, induce cell cycle arrest, and modulate key cellular processes associated with colon cancer development, such as MAPK signaling in vitro (Larossa et al, J. Agric. Fool Chem., 54:1611-1620 (2006); Gonzalez-Sarrias et al., Mol. Nut. Food Res. 53:686-698 (2009), each of which is incorporated herein by reference). In a rat colitis model, urolithin A can decrease inflammatory markers including inducible nitric oxide synthase, cycloxygenase-2 (COX-2), prostaglandin E synthase and prostaglandin E2, in colonic mucosa. Urolithin B has been found to be a regulator of skeletal muscle mass in some embodiments (see, e.g., Rodriguez et al., J. Cachexia Sarcopenia Muscle 8:583-597 (2017), which is incorporated herein by reference). Where urolithins are directly bioavailable, treatments that promote urolithin production as described herein can increase the bioavailability of ellagitannin metabolites.

    [0122] Urolithins have distinct UV spectra that can permit their detection and measurement by, for example, HPLC coupled with UV photodiode array detectors. Correlations between structural characteristics, including conjugation, with the UV spectra and retention times have been reported (see, e.g., Gonzalez-Barrio et al., J. Agric. Food Chem. 59:1152-1162 (2011), which is incorporated herein by reference). Thus, HPLC and UHPLC can be used to assay and identify levels of urolithins in urine obtained from a subject (see e.g., Piwowarski, J P et al. Drug Metabolism and Disposition 45 (6): 657-665 (2017), the contents of which are incorporated herein by reference in its entirety).

    Ellagitannin Enzymes

    Tannin Acyl Hydrolase Enzymes

    [0123] Embodiments of the compositions and methods described herein include use of microbes that express enzymes that act on ellagitannins or in an ellagitannin metabolic pathway. Exemplary enzymes include tannin acyl hydrolase enzymes that can catalyze hydrolysis of the galloyl ester bond in hydrolysable tannins, including ellagitannins, to release gallic acid. Tannin acyl hydrolases as described herein can catalyze a reaction characteristic of E.C. 3.1.1.20. Fungi, such as Aspergillus species, and bacteria, such as members of the family Lactobacillus, can naturally produce tannase enzymes suitable for use in compositions and methods as described herein. Tannase enzymes encoded by fungi may share little structural similarity to those encoded by bacteria, yet they can share a similar range of substrate specificities. As such, for embodiments in which tannase enzyme can be administered or used as a preparation derived from, but not including, live microorganisms, tannase can be isolated or prepared from fungal, as well as bacterial sources. Tannases produced by yeast and methods of producing them are described, for example, by Boer et al., Yeast 26:323-337 (2009), and secretion, purification and characterization of Aspergillus oryzae tannase in Pichjia pastoris yeast is described by Zhong et al., Protein Expression and Purif. 36:165-169 (2004), both of which are incorporated herein by reference.

    [0124] Tannases acting on ellagitannins can selectively hydrolyze galloyl moieties, yielding gallic acid and degalloylated ellagitannins. See, e.g., Rodriguez-Duran et al., Enzyme Res. 2011:823619 (2011), which includes illustrations of hydrolytic products of tannase digestion of various ellagitannins, and is incorporated herein by reference. In one embodiment, a tannin acyl hydrolase is a tannase B or tanB tannase enzyme. Examples include, but are not limited to, tanB enzymes encoded and expressed by members of the Lactobacillaceae family, including, but not limited to, L. plantarum species. Tannase B tannases encoded and expressed by other species that can catalyze the same reaction may also be useful in various embodiments of the compositions and methods described herein, as can naturally-occurring or artificially created variants that retain the ability to catalyze the same reaction.

    [0125] Methods of producing and isolating recombinant tannase, for example, L. plantarum tannase, are described, for example, by Curiel et al., J. Agric. Food Chem. 57:6224-6230 (2009), which is incorporated herein by reference. The crystal structure of a tannase B polypeptide encoded and expressed by L. plantarum has been determined (see Ren et al., J. Mol. Biol. 425:2737-2751 (2013), which is incorporated herein by reference). As reported, tannase B displays an a/ structure, featured by a large cap domain inserted into a serine hydrolase fold. Structural studies of the enzyme in complex with a number of substrates indicated that the interactions at a galloyl binding site are a determinant force for the binding of substrates. A galloyl binding site is responsible for esterase and depsidase activities of the enzyme. A catalytic triad composed of Ser163, His451, and Asp419 was identified. Mutagenesis studies showed that during binding of gallic acid, the carboxyl group of the molecule forges hydrogen-bonding interactions with the catalytic triad of the enzyme, while the three hydroxyl groups make contacts with Asp421, Lys343, and Glu357 to form another hydrogen-bonding network, and that these residues are necessary for enzyme activity. As such, modifications to tannin acyl hydrolase or tannase B polypeptide that change the identity of one or more of these residues or their equivalent in homologous proteins will likely not be tolerated. Similarly, it is anticipated that changes that disrupt the positioning of these residues or their equivalent in other homologues relative to each other would also disrupt hydrogen bonding networks and interfere with enzyme function. On the other hand, changes that do not affect the identity or relative positioning of the noted residues would be more likely to be tolerated. In one embodiment, a tannase B polypeptide as described herein is at least 85% identical to a L. plantarum tannase B enzyme encoded by strain WCFS1 and retains catalytic triad amino acids Ser163, His451 and Asp419 and tannin hydroxyl-contacting amino acids Asp 421, Lys343 and Glu357 noted above, or their equivalent as located in homologous polypeptides. In another embodiment, a tannase B polypeptide as described herein has at least 90% or at least 95% or greater identity to a L. plantarum tannase B enzyme encoded by strain WCFS1 and retains the catalytic triad amino acids Ser163, His451 and Asp419 and tannin hydroxyl-contacting amino acids Asp 421, Lys343 and Glu357 noted above, or their equivalent as located in homologous polypeptides.

    [0126] A large number of L. plantarum strains encode and express a similar tannase B polypeptide. Non-limiting examples include, L. plantarum WCFS1 (see, nucleic acid and amino acid sequences below), as well as, for example, L. plantarum 5-2, L. plantarum LP3, L. plantarum BLS41, L. plantarum LQ80, L. plantarum A3, L. plantarum FBR6, and L. plantarum RI-515.

    [0127] L. plantarum WCFS1 tannase B nucleic acid sequence (NCBI Accession No. NC_004567.2):

    TABLE-US-00002 atgagtaaccgattgatttttgatgctgactggctggtgc cggaacaggtccaagttgccgggcaggctattcaatatta tgctgcccgtaatattcagtacgttcagcatccagtcgca gcgattcaggtcctaaacgtttttgtaccagccgcatact tgcatggcagttcagtcaatggttatcagcgggcaacggc gccaattctgatgccgaatacggtcggcggttatttgcca ggaccggcggatgatccgcaacgtgtcacttggccgacga atgcagggacgattcaacaggcacttaaacgcggttacgt tgtggtggccgctggaattcgcggtcgtacgacggttgat aagtctgggcaacgggtcgggcaagcgccggcttttatcg tagatatgaaggcggcaatccgttacgttaagtataatca gggccggctgccaggtgacacgaaccggatcatcacgaat ggaacgagtgctgggggtgccacttcggctttagcgggtg cgagtggcaattcggcttattttgaaccagccttaactgc gctcggggcagcaccggcgactgacgatatctttgcggtg tcagcttactgcccgattcataatctggaacacgcagaca tggcctacgagtggcagtttaatggtattaatgactggca ccgttatcagcctgttgcggggacgaccaagaatgggcga ccaaaatttgaaccggttagtggtcagctcacagttgaag aacaggccctttcgttggcgttaaaagcccagttcagtac ctacttgaaccagttgaaactcacggccagtgacgggacg cacttgacgcttaatgaggcgggaatgggttcatttcgtg atgttgttcgccaattattgatatcatctgctcagacggc attcgatcaagggacggatattcataagtacgcaggcttt gtcgttactggaaatcaggtgacggacttggatttatcag cttatttgaagtcgttaactcgcatgaaagccgtcccggc gtttgaccaattagatttgacgagtccagagaataatttg tttggcgatgcaacggcgaaagccaagcactttacggcct tggcacagacgcgaagtacggtgacggcacaactagcgga cgctgagctgattcaggcgattaatccgctcagttactta acgacaacttcgtcacgagttgctaagcactggcggattc gccacggtgcggccgaccgagatacgagttttgcaatccc gattattctagcaataatgttagaaaatcatggttatggc attgattttgcgctaccgtgggatattccccacagtggtg actatgatttaggcgatttattttcctggattgatggctt gtgccaatga

    [0128] L. plantarum WCFS1 tannase B amino acid sequence, NCBI Accession No. WP 011101979.1:

    TABLE-US-00003 MSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVA AIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLP GPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVD KSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDTNRIITN GTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAV SAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGR PKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGT HLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGF VVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNL FGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYL TTTSSRVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYG IDFALPWDIPHSGDYDLGDLFSWIDGLCQ
    Amino acids Ser163, His451, Asp419, Asp 421, Lys343 and Glu357 are bolded.

    [0129] Methods for detecting or measuring tannin acyl hydrolase activity include exemplary methods such as those described by: Beverini & Metche, Sci. Aliments. 10:807-816 (1990) describing an HPLC assay, Haslam et al. J. Chem. Soc. 1829-1835 (1961) describing an unbuffered titrimetric assay, Yamada et al. Agr. Biol. Chem. 45:233-240 (1967) describing a buffered titrimetric assay, Skene & Booker, Anareobe 1:321-327 (1995) describing a single wavelength spectrophotometric assay, Bajpai & Patil, World J. Microbiol. Biotechnol. 12:217-220 (1996) describing a double-wavelength spectrophotometric assay, and Aguilar et al. (Braz. Arch. Biol. Technol. 42 (No. 3), Curitiba 1999) describing a double-wavelength spectrophotometric assay. Each of these publications is incorporated herein by reference in its entirety, and particularly with respect to tannin acyl hydrolase assay conditions and calculation of results. The Aguilar reference includes a comparison of these six methods, using tannic acid as the sole substrate in the enzymatic reaction. Each of the methods described were useful for measuring extracellular tannin acyl hydrolase activity, and all except the Bajpai & Patil method were useful for measurement of intracellular activity. For spectrophotometric and HPLC assays, one unit of enzyme activity is typically defined as an amount of enzyme liberating 1 mol (micromole) of gallic acid per ml per minute; for the titrimetric methods, one unit of enzyme is typically an amount of enzyme that releases 1 mol carboxyl group per ml per minute. While any of these methods can be used on the basis of this comparison, the HPLC assay described by Beverini and Metche had the lowest coefficient of variation, indicating a higher reliability than other methods. An HPLC method can be preferred when accuracy in measuring tannin acyl hydrolase activity matters. To determine whether a given bacterium expresses a tannin acyl hydrolase activity, any of the assays provided above, among others, can be used, but where necessary or desired to measure the amount of such activity, a HPLC approach is preferred. The presence of a tannin acyl hydrolase gene can be detected in a bacterium via PCR using primers based on available tannin acyl hydrolase nucleic acid sequences, or, where the genome of the bacterium has been sequenced, the presence of sequence encoding a tannin acyl hydrolase can be determined based upon homology or identity to known tannin acyl hydrolases.

    Gallate Decarboxylase Enzymes

    [0130] Embodiments of the compositions and methods described herein include the use of microbes that encode and express a gallate decarboxylase enzyme. The enzyme can catalyze the conversion of 3,4,5-trihydroxybenzoate (gallic acid) to pyrogallol and carbon dioxide, which is a characteristic of E.C. 4.1.1.59. Microbial gallate decarboxylase genes can be encoded in an operon arrangement of three separate protein coding sequences referred to as subunits C, B and D, but an active enzyme is not a complex of the three subunits. Rather, for species that have this arrangement, the C subunit appears to be the catalytic subunit. In Lactobacillus plantarum WCFS1, a B subunit, but not a D subunit is required together with a C subunit for gallate decarboxylase activity, based on gene knockout experiments; it has been proposed that the B subunit plays a role in, for example, establishing correct folding of the C subunit. See, e.g., Jimenez et al., Appl. Environ. Microbiol. 79:4253-4263 (2013), which is incorporated herein by reference. For the gallate decarboxylase expressed by L. plantarum WCFS1 (also known as ATCC-deposited strain BAA-793), the C subunit, lpdC, has the sequence at GenBank Accession No. F9US27-1:

    TABLE-US-00004 atggcagaacaaccatgggatttgcgtcgcgtgcttgatg agatcaaggatgatccaaagaactatcatgaaactgacgt cgaagttgatccaaatgcggaactttctggtgtttatcgg tatatcggtgctggtgggaccgttcaacggccaacgcaag agggtccagcaatgatgtttaacaacgttaaggggtttcc tgatacgcgggtcttgactggattgatggcgagtcgccgg cgcgttggtaagatgttccaccacgattatcagacgttag ggcaatacttgaacgaagcagtctctaatccagtggcgcc agaaacggttgctgaagcggatgcgccagctcacgatgtc gtttataaagcgacggatgaaggctttgatattcgtaagt tagtggcagcaccaacgaatacgccccaagatgctggacc atatattacggtcggtgtggtgtttggctcaagcatggac aagtctaagagtgatgtgacgattcaccgaatggtccttg aagataaggataagttagggatttatatcatgcctggcgg tcggcacattggtgcgtttgcggaagagtatgagaaagct aacaagccaatgccaattacaattaatattggtttggatc cagccattacgattggtgcaactttcgaaccaccgaccac gccattcggttataacgaattaggtgttgctggtgcgatt cggaaccaagctgttcaattagttgacggggtgaccgtcg atgaaaaggcgattgcgcgttctgaatatacgcttgaggg gtacattatgcctaacgaacgtattcaggaagatatcaat acgcatacgggcaaggcgatgcctgaattcccgggttatg atggtgacgccaacccagctttacaagtgattaaggtgac ggcggtgactcatcggaagaatgccatcatgcaaagcgtg attggaccatccgaagaacatgtcagcatggcgggaattc caactgaagctagtatcttacaattggttaaccgtgccat tcctggtaaagtgacgaatgtttataatccgccggctggt ggtggtaagttgatgaccatcatgcagattcacaaggata atgaagcggatgaaggaattcaacggcaagctgccttgct tgcgttctcagcctttaaggaattgaagactgttatcctg gttgatgaagatgttgatatttttgatatgaatgatgtga tttggacgatgaatacccgtttccaagccgatcaggactt gatggtcttatcaggcatgcggaatcatccgttggaccca tcggaacgcccacaatatgatccaaagtcgattcgtttcc gtgggatgagttctaaactagtgattgatggcaccgtacc attcgatatgaaggaccaatttgaacgggcccaattcatg aaagtggctgactgggagaagtatttgaagtaa
    lpdC:
    F9US27-1 (UniprotKB; L. plantarum ATCC BAA-793)

    TABLE-US-00005 MAEQPWDLRRVLDEIKDDPKNYHETDVEVDPNAELSGVYR YIGAGGTVQRPTQEGPAMMFNNVKGFPDTRVLTGLMASRR RVGKMFHHDYQTLGQYLNEAVSNPVAPETVAEADAPAHDV VYKATDEGFDIRKLVAAPTNTPQDAGPYITVGVVFGSSMD KSKSDVTIHRMVLEDKDKLGIYIMPGGRHIGAFAEEYEKA NKPMPITINIGLDPAITIGATFEPPTTPFGYNELGVAGAI RNQAVQLVDGVTVDEKAIARSEYTLEGYIMPNERIQEDIN THTGKAMPEFPGYDGDANPALQVIKVTAVTHRKNAIMQSV IGPSEEHVSMAGIPTEASILQLVNRAIPGKVTNVYNPPAG GGKLMTIMQIHKDNEADEGIQRQAALLAFSAFKELKTVIL VDEDVDIFDMNDVIWTMNTRFQADQDLMVLSGMRNHPLDP SERPQYDPKSIRFRGMSSKLVIDGTVPFDMKDQFERAQFM KVADWEKYLK

    [0131] The B subunit of the L. plantarum WCFS1 gallate decarboxylase (lpdB) has the sequence at GenBank Accession No. F9UT67:

    TABLE-US-00006 atgaaacgaattgttgtgggaatcacgggagcgtccggta cgatttacgcggtcgacttattagaaaagttacatcagcg gccagatgttgaagttcatctggtaatgagtgcgtgggct aaaaaaaacttggagttagagactgattactcgctcgcgc agctgacggcgctcgcggatgctacttatcgggctaatga ccaaggcgcagcgattgccagcggttcgtttttgaatgac ggaatggtcattgtcccagctagtatgaagacggtagcag ggattgcgtacggcttcggtgataatttaatatcgcgggc tgctgatgtcacgattaaagaacaacgtaaacttgtgatt gttccacgtgaaacaccgttaagcgtgattcatttagaaa atctaacgaagttggcaaaactcggtgcccaaattattcc accgattcccgcgttttataatcatccgcaatccattcag gatctggtcaatcatcaaaccatgaaaattttagatgcgt ttcatattcataatgaaactgatcgccgttgggaggggga ttaa MKRIVVGITGASGTIYAVDLLEKLHQRPDVEVHLVMSAWA KKNLELETDYSLAQLTALADATYRANDQGAAIASGSFLND GMVIVPASMKTVAGIAYGFGDNLISRAADVTIKEQRKLVI VPRETPLSVIHLENLTKLAKLGAQIIPPIPAFYNHPQSIQ DLVNHQTMKILDAFHIHNETDRRWEGD

    [0132] The D subunit of, for example, L. plantarum gallate decarboxylase (lpdD) has the sequence at GenBank Accession No. F9UT68:

    TABLE-US-00007 atggcaacttttacgactgagcaggccgggtatcaaatgc aagcaatactccaagtgattggatatgacttgttgatcgt cgttaccggtgggaccaatccccatattggtgacgtgacc acactaactgccagcacggttcccgaaacggttaagtttc ccagccatgatggtcgcttccacaaagataactttatttc ggaacgaatggccaagcggattcagcgttatctagctgga agctgtacaattactgcgggaattcatgtcaaccaaatta ctaaagcacaaatagcagctgcggcaccaatgacggatga cctcagccgccagattattagctggttacaggcccatccc gtccaggctgaaaagccggaatattatggacaagacgagc aaccgcggtag MATFTTEQAGYQMQAILQVIGYDLLIVVTGGTNPHIGDVT TLTASTVPETVKFPSHDGRFHKDNFISERMAKRIQRYLAG SCTITAGIHVNQITKAQIAAAAPMTDDLSRQIISWLQAHP VQAEKPEYYGQDEQPR

    [0133] In L. plantarum species that express gallate decarboxylase, and other species that express gallate decarboxylase, such as Streptococcus galloylyticus, gallic acid released from tannins, e.g., by action of tannin acyl hydrolase enzymes, can be decarboxylated to pyrogallol, but these species lack the ability to further degrade this product. Gallate decarboxylase enzymes from a number of microbial sources are known, including, but not limited to Lactobacillus plantarum, e.g., L. plantarum WCFS1. Gallate decarboxylase activity is widely present among lactic acid bacteria, e.g., L. brevis, L. casei and L. fermentum.

    [0134] In one embodiment, the gallate decarboxylase comprises a gallate decarboxylase C polypeptide, such as, but not limited to an L. plantarum lpdC polypeptide. In another embodiment, a microbe useful in methods and compositions described herein encodes and expresses gallate decarboxylase C and B polypeptides. In such microbes or compositions made from or comprising them, the B polypeptide is not necessarily bound to the C polypeptide, but appears to be important for generating highly active gallate decarboxylase enzyme. Examples include, but are not limited to lpdC and lpdB polypeptides of L. plantarum species, including but not limited to L. plantarum WCFS1, among others. Gallate decarboxylases encoded and expressed by other species and that catalyze the same reaction can also be useful in various embodiments of the compositions and methods described herein, as can naturally-occurring or artificially created variants that retain the ability to catalyze the same reaction.

    [0135] Methods of expressing or producing recombinant gallate decarboxylase are similar to those for producing recombinant tannin acyl hydrolase enzymes or other recombinant enzyme preparations. See, e.g., Jimenez et al., Appl. Environ. Microbiol. 79:4253-4263 (2013), which is incorporated herein by reference. Gallate decarboxylase activity can be assayed as described therein as well, and the authors further describe PCR primers and PCR amplification to identify species that encode enzyme activity and to prepare nucleic acids encoding enzyme polyeptides, e.g., for cloning into expression vectors for overexpression.

    [0136] In one embodiment, a gallate decarboxylase enzyme has at least 80% sequence identity to the catalytic gallate decarboxylase C polypeptide of L. plantarum lpdC of strain WCFS1 as described herein and retains at least 50% of the gallate decarboxylase activity of the lpdC polypeptide when expressed in the presence of lpdB polypeptide. Variations contemplated in a gallate decarboxylase enzyme molecule include, for example, conservative amino acid substitutions as the term is defined herein

    [0137] Thus, in one embodiment, a gallate decarboxylase enzyme has 50 or fewer, e.g., 40 or fewer, 30 or fewer, 20 or fewer, 15 or fewer, 10 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer or one or fewer conservative amino acid substitutions relative to a wild-type gallate decarboxylase enzyme, or relative to a gallate decarboxylase enzyme encoded and expressed by L. plantarum WCFS1, and retains at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or higher activity relative to a wild type enzyme or that encoded and expressed by L. plantarum WCFS1. In another embodiment, a gallate decarboxylase enzyme has at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity to a catalytic gallate decarboxylase C polypeptide of L. plantarum lpdC of strain WCFS1 as described herein and retains at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more of the gallate decarboxylase activity of a lpdC polypeptide when expressed in the presence of a lpdB polypeptide. It is contemplated that some mutations can potentially improve the relevant activity, such that a gallate decarboxylase variant has more than 100% of the activity of a wild-type or native polypeptide, e.g., 110%, 125%, 150%, 175%, 200%, 500%, 1000% or more.

    Ellagitannin-Enzyme-Synthesizing (EES) Microbes

    [0138] A number of microbial species are known that encode and can produce tannase enzymes as described herein, as are species that encode and can produce gallate decarboxylase as described herein. In one embodiment, a single microbial species or strain can express both tannase and gallate decarboxylase enzymes. In another embodiment, each enzyme is encoded and can be expressed by a different species or strain; in such instances it is generally beneficial to administer both species or strains to provide the best benefit in terms of ellagitannins metabolism and urolithin production. In addition to microbes that can natively express tannase and/or gallate decarboxylase enzymes, microbes can be engineered to recombinantly express enzymes of interest. In one embodiment, a microbial species or strain may be modified such that both tannase and gallate decarboxylase enzymes can be engineered to include a polynucleotide that encodes the enzymes and thus can be recombinantly expressed. In another embodiment, a microbial species or strain may be modified such that either tannase or gallate decarboxylase enzymes are encoded and can be recombinantly expressed.

    [0139] It is possible to identify a species or strain of microbes that encodes a given enzyme or enzyme gene cluster using, e.g., genomic sequencing. Once a species or strain is identified as encoding a given enzyme or enzyme gene cluster, it can be determined whether the bacterium actually produces the enzyme(s) using transcriptomics, RT-PCR, or analysis of expressed proteins via Western blot or other antibody-based assay or via an assay for enzyme activity that was known previously.

    [0140] Lactobacillus plantarum is an exemplary species that encodes and can express tannase and gallate decarboxylase enzymes. In some embodiments, Streptococcus gallolyticus is used (Genetic and biochemical approaches towards unravelling the degradation of gallotannins by Streptococcus gallolyticus, Microb Cell Fact. 2014 Oct. 31; 13:154. doi: 10.1186/s12934-014-0154-8, which is incorporated herein by reference).

    Combinations

    [0141] Given that certain factors can influence the effective amount of ellagitannin composition and effective amount of microbes that encode and can express tannin acyl hydrolase and gallate decarboxylase enzymes, it should also be understood that various combinations of ellagitannin amount and microbes amount can provide an amount effective to promote urolithin production in the gut as described herein. Thus, for example, a combination can include an ellagitannin composition, and an enzymatic composition comprising one or more ellagitannin enzymes. In some embodiments, one or more ellagitannin enzymes comprise a tannin acyl hydrolase enzyme, a gallate decarboxylase enzyme, or a combination thereof. In some embodiments, an enzymatic composition can be an EES microbe.

    [0142] In some embodiments, a combination can include about 10 mg to about 10 g, about 10 mg to about 5 g, 10 mg to about 2500 mg, about 100 mg to about 10 g, about 100 mg to about 5 g, or 100 mg to about 2500 mg of an ellagitannin composition. In some embodiments, a combination can include at least 10 mg, at least 50 mg, at least 100 mg, at least 150 mg, at least 200 mg, at least 250 mg, at least 300 mg, at least 350 mg, at least 400 mg, at least 450 mg, at least 500 mg, at least 550 mg, at least 600 mg, at least 650 mg, at least 700 mg, at least 800 mg, at least 850 mg, at least 900 mg, at least 950 mg, at least 1000 mg (1 g), at least 1250 mg, at least 1500 mg, at least 2000 mg, at least 2500 mg, at least 3000 mg, at least 3500 mg, at least 4000 mg, at least 4500 mg, at least 5000 mg, or more of an ellagitannin composition. In some embodiments, a combination can include at most 50 mg, at most 100 mg, at most 150 mg, at most 200 mg, at most 250 mg, at most 300 mg, at most 350 mg, at most 400 mg, at most 450 mg, at most 500 mg, at most 550 mg, at most 600 mg, at most 650 mg, at most 700 mg, at most 800 mg, at most 850 mg, at most 900 mg, at most 950 mg, at most 1000 mg (1 g), at most 1250 mg, at most 1500 mg, at most 2000 mg, at most 2500 mg, at most 3000 mg, at most 3500 mg, at most 4000 mg, at most 4500 mg, at most 5000 mg, at most 5500 mg, at most 6000 mg, at most 6500 mg, at most 7000 mg, at most 7500 mg, at most 8000 mg, at most 8500 mg, at most 9000 mg, at most 9500 mg, or at most 10 g of an ellagitannin composition.

    [0143] In some embodiments, a composition can include about 10.sup.5 CFU to 10.sup.12 CFU, about 10.sup.5 CFU to 10.sup.10 CFU, or about 10.sup.8 CFU to 10.sup.12 CFU of one or more EES microbes. In some embodiments, a composition can include at least 10.sup.5, 510.sup.5, 10.sup.6, 510.sup.6, 10.sup.7, 510.sup.7, 10.sup.8, 510.sup.8, 10.sup.9, 510.sup.9, 10.sup.10, 510.sup.10, 10.sup.11, 510.sup.11, 10.sup.12, or more of one or more EES microbes.

    [0144] The amount of an ellagitannin composition effective to promote urolithin production will vary with, for example, the amount and/or activity of microbes in the gut that can metabolize ellagitannins. Thus, when an ellagitannin composition is consumed or administered with a preparation or formulation comprising microbes that encode and express tannin acyl hydrolase and/or gallate decarboxylase enzymes, the amount of ellagitannin composition effective to promote urolithin production will generally be lower than a case where ellagitannins are consumed or administered without such microbes. It should be understood that where the enzyme expression levels from microbes that encode and express tannin acyl hydrolase and/or gallate decarboxylase enzymes can vary, the amount of microbes necessary to promote urolithin production will vary with such expression levels; that is, the amount of a given microbial strain or strains can be adjusted for effect depending upon relative levels of tannin acyl hydrolase and/or gallate decarboxylase enzymes that are produced. It should also be noted that the presence of ellagitannins can induce expression of enzymes necessary to metabolize them in microbes that can encode such enzymes-see, e.g., Example 2. Thus, when microbes are or have recently been exposed to ellagitannins, an amount of microbes necessary to promote urolithin production may be lower than an amount needed when the microbes have not been so exposed prior to administration or consumption.

    [0145] In one embodiment, effective treatment can be determined by an increase in urolithin concentration in excreted urine by at least 10%, at least 20%, at least 30%, at least 40%, or at least 50% compared to the level of urinary urolithin prior to treatment with a composition comprising an ellagitannin composition or an ellagitannin composition in combination with microbes that encode and express a tannin acyl hydrolase and/or a gallate decarboxylase as described herein. In some embodiments, efficacy can be assessed by measuring the degree of oxidative stress of cells in a biological sample prior to and following administration of a composition as described herein. The degree of oxidative stress of cells can be assessed by, for example, measuring the expression of oxidative stress biomarkers, such as high sensitivity C-reactive protein (hs-CRP) or by determining the ratio of oxidized to reduced forms of glutathione. High levels of oxidative stress can be cytotoxic, so the degree of oxidative stress can be measured by assessing the concentration of intracellular proteins present in the systemic circulation from inflamed or lysed cells, for example, cardiomyocyte oxidative stress can be determined by assessing troponin-I levels in blood. Liver oxidative stress can be determined by the presence of increased levels of liver enzymes in the bloodstream, including, but not limited to, alanine transaminase (ALT), aspartate transaminase (AST), alkaline phosphatase (ALP) and gamma-glutamyl transpeptidase (GGT).

    [0146] In some embodiments, effective treatment can be determined by an increase in urolithin concentration in the gut of a subject by at least 10%, at least 20%, at least 30%, at least 40%, or at least 50% compared to the level of urolithin in the gut prior to treatment with a composition comprising an ellagitannin composition or an ellagitannin composition in combination with microbes that encode and express a tannin acyl hydrolase and/or a gallate decarboxylase as described herein. In some embodiments, effective treatment can be determined by an increase in urolithin concentration in plasma of a subject by at least 10%, at least 20%, at least 30%, at least 40%, or at least 50% compared to the plasma level of urolithin prior to treatment with a composition comprising an ellagitannin composition or an ellagitannin composition in combination with microbes that encode and express a tannin acyl hydrolase and/or a gallate decarboxylase as described herein.

    [0147] In some embodiments, a subject is evaluated using one or more additional diagnostic procedures, for example, by medical imaging, physical exam, laboratory test(s), clinical history, family history, and genetic test. Medical imaging techniques are well-documented methods. As such, medical imaging can be selected from any known method of imaging, including, but not limited to, ultrasound, computed tomography scan, positron emission tomography, photon emission computerized tomography, and magnetic resonance imaging.

    Bioavailability of an Ellagitannin Composition

    [0148] Phenolic compounds constitute a substantial and an important group of phenylpropanoids produced by plants as secondary metabolites for the purpose of chemical defense against predators and to participate in reproduction as well as in plant-plant interference. Structurally, phenolic compounds have an aromatic ring with several hydroxyl groups attached to it. Phenolic compounds are classified into different groups based on their function, the number of phenolic rings that they contain, and the radicals that bind these rings to another one. An important factor in the determination of antioxidant activity of a given phenolic compound is both the number and position of hydroxyl groups. For example, flavonoids have more hydroxyl groups than other phenolic compounds and this structure is associated with higher antioxidant activity. In addition to providing antioxidant activity, the structure of a phenolic compound can affect the solubility of the phenol and/or impart steric effects regarding interaction with other molecules.

    [0149] It has been reported that the structure of such compounds can play a role in their bioavailability. Whether a compound is bioavailable depends on the formulation, the absorption characteristics, gastric emptying rate, the route of administration, degradation and elimination kinetics in a given subject. Thus, bioavailability of a compound can vary from one individual to the next. Bioavailability can be assessed using an assay to measure levels of a given compound in the systemic circulation, and in particular, in blood, plasma, and/or urine.

    [0150] Another important determinant of bioavailability is bioaccessibility, which relates to the amount of a food constituent, nutrient (e.g., polyphenols) etc. that is released from the food matrix into the gut and can be absorbed through the intestinal barrier. Bioaccessibility relates to the degree in which a food is masticated, whether the food is cooked or raw, gastric emptying time, gut transit time, the amount of fiber or fat in the food, what is consumed alongside the food, cofactors necessary for absorption, presence of particular microorganisms, and the complexity of the food matrix structure.

    [0151] A bioavailable compound may not be bioactive simply because it is absorbed. For example, some nutrients are not directly active and require metabolism to a bioactive metabolite. Further, some polyphenols are high molecular weight compounds that are mostly bound to dietary fiber or protein that remains insoluble in the usual solvent and requires an extra step of hydrolysis during extraction to make them soluble and bioavailable.

    [0152] Phenolic compounds can have varying degrees of bioavailability based on their structure, food processing and matrix characteristics, and the host, among others. For example, bioavailability of phenols varies over a wide range from 0.3% estimated for anthocyanins to 43% in the case of isoflavones.

    [0153] Hydrolysable tannins and proanthocyanidins are polyphenols that have a high degree of extraction from the food and thus bioavailability to the host. The bioactivity of tannins is thought to depend on the degree of polymerization and their solubility in the gut, for example, highly polymerized tannins have low bioaccessibility in the small intestine and are not easily fermented by colonic microflora. Low rates of fermentation reduce the bioavailability of downstream metabolites, for example urolithins. In some embodiments, the present disclosure describes a composition administered to modify or increase the bioavailability of urolithins in the gut.

    [0154] In some embodiments, a method is a method of increasing the bioavailability of an ellagitannin composition for a subject. In some embodiments, a method comprises determining a bioavailability level of an ellagitannin of the ellagitannin composition in the gut of a subject. In some embodiments, a method comprises comparing the bioavailability level of the ellagitannin of the ellagitannin composition in the gut of the subject to a reference level. In some embodiments, a reference level is a historical bioavailability reference level for an ellagitannin, a bioavailability level of an ellagitannin in the gut of the subject prior to receiving a combination; or bioavailability level of an ellagitannin in the gut of a comparable subject who has not received the combination.

    [0155] In some embodiments, a method comprises determining a level of the urolithin produced in plasma of a subject. In some embodiments, a method comprises comparing the level of the urolithin in plasma of a subject to a reference level. In some embodiments, a reference level is a concentration of urolithin in plasma, e.g., 0.2-20 M (Espn J C, Larrosa M, Garca-Conesa M T, Toms-Barbern F. Biological significance of urolithins, the gut microbial ellagic Acid-derived metabolites: the evidence so far. Evid Based Complement Alternat Med. 2013; 2013:270418. doi: 10.1155/2013/270418, which is incorporated herein by reference). In some embodiments, a reference level is a concentration of urolithin in plasma of at least 0.1 M, at least 0.2 M, at least 0.5 M, at least 1 M, at least 5 M, at least 10 M, or at least 15 M. In some embodiments, a reference level is a concentration of urolithin in plasma of at least 0.5 M, at most 1 M, at most 5 M, at most 10 M, at most 15 M, at most 20 M, or at most 25 M.

    [0156] In some embodiments, a reference level, whether in gut or plasma, is a historical reference level of a urolithin, a urolithin level of in the gut of the subject prior to receiving a combination, or a urolithin level of in the gut of a comparable subject who has not received a combination.

    [0157] The concentration of urolithin A can reach up to micromolar (M) levels in plasma without any apparent toxic effects in vivo. For example, upon consumption of pomegranate juice by humans, peak plasma levels of UA can reach 14 to 40 M, but there may be wide variations among individuals (see, e.g., Cerda et al., Eur. J. Nut. 43:205-220, which is incorporated herein by reference). Wide inter-individual variation is likely due to differences in microbiota. Selma et al. identified mono-cultured bacteria (Gordonibacter urolithinfaciens and Gordonibacter pamelaeae DSM 19378T) that can metabolize ellagic acid to produce luteic acid, urolithin M-5, urolithin M-6 and urolithin C. However, these cultured bacteria were incapable of producing downstream products, urolithin A and urolithin B; see Selma et al., Food & Nut. 5:1779-1784 (2014), which is incorporated herein by reference.

    Methods of Treatment

    [0158] The present disclosure recognizes that compositions described herein can be useful in the treatment of subjects. Methods provided by the present disclosure include methods for the treatment of certain diseases, disorders and conditions. In some embodiments, relevant diseases, disorders and conditions may be or include liver diseases and conditions or disorders associated with mitochondrial dysfunction.

    [0159] Generally, methods of treatment provided by the present disclosure involve administering a therapeutically effective amount of a probiotic alone or in combination with a ellagitannin composition as described herein to a subject who is in need of, or who has been determined to be in need of, such treatment.

    [0160] In some embodiments, methods of treatment provided herein are therapeutic, e.g., may be administered to subjects after development of significant symptoms of diseases or disorders associated with mitochondrial dysfunction.

    [0161] In some embodiments, provided methods of treatment are administered to a subject that is a mammal, e.g., a mammal that experiences a disease, disorder, or condition as described herein; in some embodiments, a subject is a human or non-human veterinary subject, e.g., an ape, cat dog, monkey, or pig.

    [0162] In many embodiments, treatment involves ameliorating at least one symptom of a disease, disorder, or condition associated with diseases or disorders associated with mitochondrial dysfunction. In some embodiments, a method of treatment can be prophylactic.

    [0163] In some embodiments, the methods can include administration of a therapeutically effective amount of a probiotic and/or ellagitannin composition before, during (e.g., concurrently with), or after administration of a treatment that is expected to be associated with liver disease or disorders associated with mitochondrial dysfunction.

    [0164] In some embodiments, the compositions described herein can be administered in a form containing one or more pharmaceutically acceptable carriers. Suitable carriers have been described previously and vary with the desired form and mode of administration of a composition. For example, pharmaceutically acceptable carriers can include diluents or excipients such as fillers, binders, wetting agents, disintegrators, surface-active agents, glidants, and lubricants. Typically, a carrier may be a solid (including powder), liquid, or any combination thereof. Each carrier is preferably acceptable in the sense of being compatible with other ingredients in the composition and not injurious to a subject. A carrier can be biologically acceptable and inert (e.g., it permits the composition to maintain viability of the biological material until delivered to the appropriate site).

    [0165] Oral compositions can include an inert diluent or an edible carrier. For purposes of oral therapeutic administration, an active compound can be incorporated with excipients and used in the form of tablets, lozenges, pastilles, troches, or capsules, e.g., gelatin capsules. Oral compositions can also be prepared by combining a composition of the present disclosure with a food. In some embodiments, microbes can be formulated in a food item. Some non-limiting examples of food items to be used with the methods and compositions described herein include: popsicles, cheeses, creams, chocolates, milk, meat, drinks, pickled vegetables, kefir, miso, sauerkraut, etc. In other embodiments, food items can be juices, refreshing beverages, tea beverages, drink preparations, jelly beverages, and functional beverages; alcoholic beverages such as beers; carbohydrate-containing foods such as rice food products, noodles, breads, and pastas; paste products such as fish, hams, sausages, paste products of seafood; retort pouch products such as curries, food dressed with a thick starchy sauce, and Chinese soups; soups; dairy products such as milk, dairy beverages, ice creams, and yogurts; fermented products such as fermented soybean pastes, fermented beverages, and pickles; bean products; various confectionery products including biscuits, cookies, and the like, candies, chewing gums, gummies, cold desserts including jellies, cream caramels, and frozen desserts; instant foods such as instant soups and instant soy-bean soups; and the like. It is preferred that food preparations not require cooking after admixture with microbial strain(s) to avoid killing any microbes.

    [0166] In one embodiment a food used for administration is chilled, for example, iced flavored water. In certain embodiments, the food item is not a potentially allergenic food item (e.g., not soy, wheat, peanut, tree nuts, dairy, eggs, shellfish or fish). Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. Tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, primogel, or corn starch; a lubricant such as magnesium stearate or sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, orange flavoring, or other suitable flavorings. These are for purposes of example only and are not intended to be limiting.

    [0167] In a related embodiment, the compositions described herein are contemplated to comprise one or more microbes as described herein in combination with a viable lactic acid bacteria in combination with any material to be absorbed, including but not limited to nutrient supplements, foodstuffs, vitamins, minerals, medicines, therapeutic compositions, antibiotics, hormones, steroids, and the like compounds where it is desirable to insure efficient and healthy absorption of materials from the gastrointestinal tract into the blood. The amount of material included in the composition can vary widely depending upon the material and the intended purpose for its absorption, such that the composition is not to be considered as limiting.

    Pharmaceutical Compositions

    [0168] Provided herein are compositions comprising probiotic microbes or combinations of probiotic microbes and ellagitannin compositions. In some embodiments, such compositions are used to treat liver diseases or disorders associated with mitochondrial dysfunction in a subject. In some embodiments, compositions for use in accordance with the present disclosure are pharmaceutical compositions, e.g., for administration (e.g., oral administration) to a mammal (e.g., a human). Pharmaceutical compositions typically include an active agent (e.g., individual microbial strains or combinations of microbial strains with ellagitannin compositions), and a pharmaceutically acceptable carrier. Certain exemplary pharmaceutically acceptable carriers include, for instance saline, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration.

    [0169] In some embodiments, a pharmaceutical composition for use in accordance with the present disclosure may include and/or may be administered in conjunction with, one or more supplementary active compounds; in certain embodiments, such supplementary active agents can include ginger, curcumin, probiotics (e.g, probiotic strains of one or more of the following genera: Lactobacillus, Bifidobacterium, Saccharomyces, Enterococcus, Streptococcus, Pediococcus, Leuconostoc, Bacillus, and/or Escherichia coli (see Fijan, Int J Environ Res Public Health. 2014 May; 11 (5): 4745-4767, which is incorporated herein by reference); prebiotics (nondigestible food ingredients that help support growth of probiotic microbes, e.g., fructans such as fructooligosaccharides (FOS) and inulins, galactans such as galactooligosaccharides (GOS), dietary fibers such as resistant starch, pectin, beta-glucans, and xylooligosaccharides (Hutkins et al., Curr Opin Biotechnol. 2016 February; 37:1-7, which is incorporated herein by reference) and combinations thereof.

    [0170] Pharmaceutical compositions are typically formulated to be compatible with their intended route of administration. Examples of routes of administration include oral administration. Methods of formulating suitable pharmaceutical compositions have been reported, see, e.g., Remington: The Science and Practice of Pharmacy, 21st ed., 2005; and the books in the series Drugs and the Pharmaceutical Sciences: a Series of Textbooks and Monographs (Dekker, NY). Oral compositions generally include an inert diluent or an edible carrier. To give but a few examples, in some embodiments, an oral formulation may be or comprise a syrup, a liquid, a tablet, a troche, a gummy, a capsule, e.g., gelatin capsules, a powder, a gel, a film, etc.

    [0171] In some embodiments, pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of a pharmaceutical composition. In some particular embodiments, a pharmaceutical composition can contain, e.g., any one or more of the following inactive ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring. In some embodiments, the compositions can be taken as-is or sprinkled onto or mixed into a food or liquid (such as water). In some embodiments, a composition that may be administered to mammals as described herein may be or comprise an ingestible item (e.g., a food or drink) that comprises (e.g., is supplemented) with an individual microbial strain or combinations of microbial strains from a mammalian microbiome, extracts thereof, and/or components thereof.

    [0172] In some embodiments, a food can be or comprise one or more of bars, candies, baked goods, cereals, salty snacks, pastas, chocolates, and other solid foods, as well as liquid or semi-solid foods including yogurt, soups and stews, and beverages such as smoothies, shakes, juices, and other carbonated or non-carbonated beverages. In some embodiments, foods are prepared by a subject by mixing in individual microbial strains or combinations of microbial strains from a mammalian microbiome, extracts thereof, and/or components thereof.

    [0173] Compositions can be included in a kit, container, pack, or dispenser, together with instructions for administration or for use in a method described herein.

    [0174] Those skilled in the art, reading the present disclosure, will appreciate that, in some embodiments, a composition (e.g., a pharmaceutical composition) as described herein may be or comprise one or more cells, tissues, or organisms (e.g., plant or microbe cells, tissues, or organisms) that produce (e.g., have produced, and/or are producing) a relevant compound.

    [0175] In some embodiments, an individual microbial strain or combinations of microbial strains from a mammalian microbiome that have been killed (e.g., heat killed). Alternatively, in some embodiments, an individual microbial strain or combinations of microbial strains from a mammalian microbiome may include cells that are viable or alive.

    [0176] In some embodiments, methods of treatment as described herein involve administering a viable or living individual microbial strain or combinations of microbial strains from a mammalian microbiome. In some such embodiments, a viable or living individual microbial strain or combinations of microbial strains from a mammalian microbiome is administered according to a regimen that achieves population of the subject's microbiome with administered cells.

    [0177] In some embodiments, a viable or living individual microbial strain or combinations of microbial strains from a mammalian microbiome as described herein comprises and/or is formulated through use of one or more cell cultures and/or supernatants or pellets thereof, and/or a powder formed therefrom.

    [0178] In some embodiments, a pharmaceutical composition provided herein can promote the colonization of an individual microbial strain or combinations of microbial strains from a mammalian microbiome, particularly microbial strain(s) that have been identified, characterized, or assessed as decreasing the severity or incidence of a mammalian disease or condition, in a mammal suffering from or at risk of the mammalian disease or condition. In some embodiments, a pharmaceutical composition provided herein can attenuate the colonization of an individual microbial strain or combinations of microbial strains from a mammalian microbiome, particularly microbial strain(s) that have been identified, characterized, or assessed as increasing the severity or incidence of a mammalian disease or condition, in a mammal suffering from or at risk of the mammalian disease or condition. In some embodiments, a pharmaceutical composition provided herein can promote the colonization of an individual microbial strain or combinations of microbial strains from a mammalian microbiome, particularly microbial strain(s) that have been identified, characterized, or assessed as not affecting the severity or incidence of the mammalian disease or condition but have been identified, characterized, or assessed as being capable of outcompeting one or more microbial strains that have been identified, characterized, or assessed as increasing the severity or incidence of a mammalian disease or condition, in a mammal suffering from or at risk of the mammalian disease or condition.

    [0179] In some embodiments, a pharmaceutical composition is tailored to a specific mammal (e.g., a specific human subject) based on that mammal's (e.g., human's) microbiome. In some embodiments, a pharmaceutical composition is specific for a microbiome of a mammalian subject (e.g., human). In some embodiments, a pharmaceutical composition is specific for microbiomes of a population of mammals (e.g., humans). Populations of mammals can include, but are not limited to: families, mammals in the same regional location (e.g., neighborhood, city, state, or country), mammals with the same disease or condition, mammals of a particular age or age range, mammals that consume a particular diet (e.g., food, food source, or caloric intake).

    Treatment of Disorders Associated with Mitochondrial Dysfunction

    [0180] Mitochondrial dysfunction is an inability of mitochondria to undergo the processes associated with normal function, and can arise as a result of, e.g., issues with electron transport and ATP synthesis, lack of essential substrates, or low number of mitochondria in the cell. A number of mitochondrial disorders are associated with mitochondrial dysfunction, including, for example, mitochondrial myopathy, diabetes mellitus and deafness (DAD), Leber's hereditary optic neuropathy, Leigh syndrome, myoneurogenic gastrointestinal encephalopathy, myoclonic epilepsy with Ragged Red Fibers, mitochondrial DNA depletion syndrome, Alzheimer's Dementia, Parkinson's disease, Huntington Disease, Amyotrophic Lateral Sclerosis (ALS), mental retardation, deafness and blindness, diabetes, obesity, cardiovascular disease, stroke and autoimmune diseases such as multiple sclerosis, Sjogrens syndrome, lupus and rheumatoid arthritis.

    [0181] Mitophagy is an autophagy process that specifically targets non- or dysfunctional mitochondria and is crucial for maintaining mitochondrial homeostasis. Nutrient levels and nutritional stressors can lead to changes in mitophagy-related mitochondrial turnover and impact overall mitochondrial function. Urolithin A can induce mitophagy in muscular and intestinal tissue while also boosting mitochondrial biogenesis, leading to improved mitochondrial function. In some embodiments, the present disclosure describes methods of treatment of mitochondrial disorders and compositions designed for said treatment.

    [0182] Many human diseases are known to be associated with dysfunctional mitochondria, including, but not limited to, various cancers, neurodegenerative diseases, and metabolic disorders. In some embodiments, the present disclosure can lead to changes in mitochondrial function to improve overall health. For example, in certain embodiments, the present disclosure describes improving mitochondrial function through increasing the bioavailability of various nutrients, including, but not limited to, ellagitannins and their associated metabolites.

    Treatment Polyglutamine (polyQ) Diseases

    [0183] Expanded polyglutamine (polyQ) proteins can aggregate intracellularly, e.g., in age-related neurodegenerative disorders including (among others) Huntington's disease. Generally, polyQ diseases are characterized by a genetic mutation in cytosine-adenine-guanine triplet repeat expansion. The mutation leads to extended repeat elements of protein causing polyQ extension. These diseases are characterized by cognitive impairment, resulting from progressive loss of neuronal function. The exact mechanistic details on the cause of expanded polyQ toxicity are not fully understood. The striking phenotype is an aggregation of expanded polyQ proteins. Different cellular pathways including lysosomal degradation pathway, autophagy and proteasome degradation are known to promote clearance of polyQ protein. In some embodiments, disclosure describes the discovery our product formulation (pome extract and L. plantarum MBT501) mitigating the polyQ aggregates in transgenic worms expressing polyQ repeats.

    [0184] Methods provided herein can comprise administering to a subject an ellagitannin composition, an enzymatic composition comprising one or more ellagitannin enzymes, or a combination as disclosed herein so that the subject is receiving a combination disclosed herein. In some embodiments, a method is a method of decreasing the formation of polypeptide aggregates in a cell or tissue. In some embodiments, a method is a method of decreasing an amount of polypeptide aggregates in a cell or tissue. In some embodiments, polypeptide aggregates are aggregates of polypeptide comprising a polyQ region (i.e., polyQ aggregates). In some embodiments, a polyQ region comprises at least 10, at least 20, at least 30, at least 40, or at least 50 glutamines. In some embodiments, a cell is or comprises neurons. In some embodiments, a cell is or comprises central nervous system tissue.

    [0185] In some embodiments, a method comprises determining a level of polypeptide aggregate formation in a cell or tissue. In some embodiments, a method comprises determining a level of polypeptide aggregate formation in a cell or tissue. In some embodiments, a method comprises comparing a level of polypeptide aggregate formation in a cell or tissue to a reference level of polypeptide aggregate formation in a cell or tissue. In some embodiments, a reference level is determined in a cell or tissue of a subject that has not been administered an ellagitannin composition, an enzymatic composition comprising one or more ellagitannin enzymes, or a combination as disclosed herein. In some embodiments, a method comprises, prior to administration, determining a level of polypeptide aggregate formation in a cell or tissue. In some embodiments, a method comprises, following administration, determining a level of polypeptide aggregate formation in a cell or tissue. In some embodiments, a method comprises comparing a level of polypeptide aggregate formation in a cell or tissue determined prior to administration with a level of polypeptide aggregate formation in a cell or tissue determined following administration.

    [0186] In some embodiments, a method comprises determining a level of polypeptide aggregates in a cell or tissue. In some embodiments, a method comprises determining a level of polypeptide aggregates in a cell or tissue. In some embodiments, a method comprises comparing a level of polypeptide aggregates in a cell or tissue to a reference level of polypeptide aggregates in a cell or tissue. In some embodiments, a reference level is determined in a cell or tissue of a subject that has not been administered an ellagitannin composition, an enzymatic composition comprising one or more ellagitannin enzymes, or a combination as disclosed herein. In some embodiments, a method comprises, prior to administration, determining a level of polypeptide aggregates in a cell or tissue. In some embodiments, a method comprises, following administration, determining a level of polypeptide aggregates in a cell or tissue. In some embodiments, a method comprises comparing a level of polypeptide aggregates in a cell or tissue determined prior to administration with a level of polypeptide aggregates in a cell or tissue determined following administration.

    Treatment of Liver Diseases

    [0187] Antioxidant therapy has been considered to be beneficial for use in treating various diseases, including those of the liver. Levels of antioxidant compounds in the body can be influenced by the Nrf2 protein, which has been shown to have a role in liver diseases such as non-alcoholic steatohepatitis, acute hepatoxicity, non-alcoholic fatty liver disease, alcoholic liver disease, viral hepatitis, liver fibrosis, hepatic IRI, and some liver cancers. Low levels of Nrf2 expression has been reported to be associated with decreased anti-oxidant activity in the cell. Administration of ellagitannins can have positive effects on liver health and reduce oxidative damage, for example by protecting liver cells from ethanol-induced cellular damage through increased Nrf2 expression to reduce oxidative stress. In some embodiments, the present disclosure describes methods of treatment of various liver diseases through administration of ellagitannins and/or probiotic compositions either alone or combination. In some embodiments, said treatment increases expression of Nrf2 in a liver cell, promoting antioxidant activity in the cell and thereby promoting liver health or function.

    [0188] Nuclear factor (erythroid-derived 2)-like 2 (NRF2) is a transcription factor that regulates the expression of antioxidant proteins that protect against oxidative damage triggered by injury or inflammation. When a cell is not in a state of stress, NRF2 is retained in the cytoplasm by the cytoplasmic inhibitor KEAP (Kelch-like ECH associated protein 1) and degraded quickly. However, when a cell is under oxidative stress, NRF2 is not degraded and localizes to the nucleus to induce expression of antioxidative gene products. Nuclear localization of NRF2 can be used as an indirect measure of NRF2 activity. However, as has been reported, an easier method for determining NRF2 activity is by assessing expression levels of genes that are positively regulated by NRF2. Such genes include but are not limited to, NAD (P) H quinone oxidoreductase 1 (Nqo1), glutamate-cysteine ligase, sulfiredoxin 1 (SRXN1), thioredoxin reductase 1 (TXNRD1), heme oxygenase-1 (HMOX1, HO01), glutathione S-transferase (GST), UDP-glucuronosyltransferase (UGT), and multidrug resistance-associated proteins (Mrps).

    [0189] The present disclosure provides methods comprising administering to a subject an ellagitannin composition, an enzymatic composition comprising one or more ellagitannin enzymes, or a combination as disclosed herein so that the subject is receiving a combination disclosed herein. In some embodiments, a method is a method of modifying an expression level or an activity level of Nrf2 in a cell or tissue of a subject. In some embodiments, a method is a method of increasing the expression level or the activity level of Nrf2 in the cell or tissue of the subject.

    [0190] In some embodiments, a method comprises determining the expression level or the activity level of nuclear respiratory factor-2 (Nrf2) in the cell or tissue of the subject. In some embodiments, a method comprises comparing the expression level or the activity level of Nrf2 in the cell or tissue to a reference level. In some embodiments, a reference level is a historical expression or activity level of Nrf2, an expression level or an activity level of nuclear respiratory factor-2 (Nrf2) in a comparable cell or tissue of the subject prior to receiving the combination, or an expression level or an activity level of nuclear respiratory factor-2 (Nrf2) in a comparable cell or tissue of a comparable subject who has not received the combination. In some embodiments, a method comprises determining an expression level or an activity level of a gene regulated by Nrf2 expression in a cell or tissue of the subject.

    [0191] Antioxidant compounds within the body are capable of protecting organisms from reactive processes that involve reactive oxygen and nitrogen species (ROS, RNS). These compounds can protect the human body from oxidative stress, which is associated with human diseases including, but not limited to, atherosclerosis, diabetes mellitus, chronic inflammation, neurodegenerative disorders, and certain cancers. In some embodiments, the present disclosure describes a composition and method of administration to modify antioxidant levels in the body. In some embodiments, a method comprises determining a level of one or more antioxidants in a cell or tissue of the subject. In some embodiments, a cell or tissue of a subject comprises a liver cell or liver tissue. In some embodiments, a method comprises measuring an indicator of liver health or function in a subject.

    Methods of Increasing Shelf-Life

    [0192] Storage methods for improved shelf-life of prebiotics and/or probiotics can vary depending on the organism involved. Often, probiotic formulations with dairy can be challenging to store while remaining stable and palatable. In some embodiments, the present disclosure describes a method for increasing the shelf-life of a probiotic composition through the use of one or more fruit extracts. In some embodiments, a method of increasing the viable shelf-life of a probiotic product comprising an EES microbe as described herein includes adding an ellagitannin composition as described herein to the probiotic product, where the EES microbe expresses one or more ellagitannin enzymes described herein.

    EXAMPLES

    [0193] The following examples are provided so as to describe to the skilled artisan how to make and use methods and compositions described herein, and are not intended to limit the scope of the present disclosure.

    Example 1

    [0194] This example demonstrates the identification of a bacterium, Lactobacillus planetarium, that induces the gst-4 expression in C. elegans transcriptional fusion reporter CL2166 dvIs19 [pAF15 (gst-4::gfp-nls)] III.sup.1,2 using a qualitative visual screen. gst-4 encodes glutathione-S-transferases (GSTs), an antioxidant gene which is regulated by skn-1, a homologue of Nrf2, a transcription factor plays a vital role in anti-oxidant pathway in human. The transcription factor skn-1, has been reported in regulating a variety of anti-oxidant genes including the anti-oxidant gene gst-4.sup.3.

    [0195] A transgenic strain CL2166 was used that expresses GFP only in hypodermal cells when fed on E. coli OP50 and pome extract only. E. coli OP50 was used as a control, as it is a standard microbial strain on which Caenorhabditis elegans are typically grown in the laboratory. The bacterium L. plantarum alone induced some expression in the intestine of worms. The treatment of L. plantarum and Pome extract in a transgenic strain CL2166 that expresses GFP induced the GFP expression in throughout intestines and body of the worm (FIG. 1).

    Example 2

    [0196] Genes encoding enzymes of tannase (tanB), gallate decarboxylase (lpdB) and gallate decarboxylase (lpdC) were tested to determine whether the enzymes are involved in ellagitanin metabolism.sup.4,5. L. plantarum possesses the decarboxylase enzyme, which is involved in the degradation polyphenolic compounds including pome extracts, berry extracts and walnut extracts 6,7 (FIG. 2a). The effect of pome extract or polyphenolic compounds on the expression of genes encoding enzymes of tannase (tanB), gallate decarboxylase (lpdB) and gallate decarboxylase (lpdC) was observed by qPCR. The prebiotic pome extract treatment greatly induced (>3-fold) the expression of the tannase (tanB), gallate decarboxylase (lpdB) and gallate decarboxylase (lpdC) (FIG. 2b).

    Example 3

    [0197] In this method, the prebiotic pome extract was tested to determine if it can aid in the maintenance of L. plantarum, e.g., enhance the shelf life of the bacterium. The pome extract was found to increase the shelf life of L. plantarum. so as to maintain the bacterium L. plantarum count in a beneficial manner. The pome extract treated L. plantarum showed the same count (10 billion CFU) for 4 weeks. In contrast, bacteria alone showed little greater than half of the initial count (FIGS. 3a and b).

    Example 4

    [0198] The human liver cell line (HepG) was used with stable expression of a Nrf2-luciferase reporter gene to observe Nrf2 induction. This cell line exhibited an increase in luciferase activity in response to the treatment of pome extract with L. plantarum. The luciferase activity was increased to 3-fold within 24 hours of treatment, compared to bacteria and pome extract alone (FIG. 4a).

    [0199] Also, the Nrf2 induction was confirmed by western blot analysis of cellular lysates. In a whole cell extract, an increase in Nrf2 protein expression by the treatment of L. plantarum with pome was demonstrated. This increase was specific for Nrf2 because there was no change in actin expression. In contrast, there was no change in Nrf2 expression of cell lysate prepared that was treated with L. plantarum and pome extract alone (FIG. 4b).

    Example 5

    [0200] This example demonstrates the combination of bacterium, L. planetarium MBT501 and pome extract, mitigated polyQ aggregates of rmls133 (unc_54p::Q40::YFP) in C. elegans using a qualitative visual screen. Young adult worms showed that the formation of up to 140 aggregates PolyQ40 repeats directly correlates with the observation of human disease. Such aggregates can contribute to cytoplasmic toxicity and neurodegenerative diseases (Morley J F, Brignull H R, Weyers J J, Morimoto R I. The threshold for polyglutamine-expansion protein aggregation and cellular toxicity is dynamic and influenced by aging in Caenorhabditis elegans. Proc Natl Acad Sci USA. 2002 August 6; 99 (16): 10417-22. doi: 10.1073/pnas. 152161099. Epub 2002 Jul. 16. PMID: 12122205, PMCID: PMC124929; Kailiang Jia, Anne C. Hart & Beth Levine (2007) Autophagy Genes Protect Against Disease Caused by Polyglutamine Expansion Proteins in Caenorhabditis elegans, Autophagy, 3:1, 21-25, DOI: 10.4161/auto.3528; Kokona B, May C A, Cunningham N R, et al. Studying polyglutamine aggregation in Caenorhabditis elegans using an analytical ultracentrifuge equipped with fluorescence detection. Protein Sci. 2016; 25 (3): 605-617, doi: 10.1002/pro.2854, each of which is incorporated herein by reference.

    [0201] PolyQ40 repeats fused with YFP were expressed in the cytoplasm of body wall muscles in the worms (transgenic strain unc_54p::Q40::YFP). The worms were fed: (1) E. coli OP50, pome extract, (2) L. planetarium (MBT501), or (3) L. planetarium (MBT501) and pome extract. E. coli OP50 was used as a control, as it is a standard microbial strain on which C. elegans are typically grown in the laboratory. As shown, the bacterium L. plantarum alone mitigated the formation of PolyQ40 aggregates to some level. Treatment of L. plantarum and Pome extract was shown to mitigate expression of the PolyQ40 aggregates (FIG. 5).

    Other Embodiments

    [0202] It is to be appreciated by those skilled in the art that various alterations, modifications, and improvements to the present disclosure will readily occur to those skilled in the art. Such alterations, modifications, and improvements are intended to be part of the present disclosure, and are intended to be within the spirit and scope of the invention. Accordingly, the foregoing description and drawing are by way of example only and any invention described in the present disclosure if further described in detail by the claims that follow.

    [0203] Those skilled in the art will appreciate typical standards of deviation or error attributable to values obtained in assays or other processes as described herein. The publications, websites and other reference materials referenced herein to describe the background of the invention and to provide additional detail regarding its practice are hereby incorporated by reference in their entireties.

    [0204] It is to be understood that while embodiments of the invention have been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.