EX VIVO GAMMA DELTA T CELL POPULATIONS
20230159638 · 2023-05-25
Assignee
Inventors
- Oliver NUSSBAUMER (London, GB)
- Oxana POLYAKOVA (London, GB)
- Adrian Hayday (London, GB)
- Pierre Vantourout (London, GB)
Cpc classification
C07K2317/70
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K16/2809
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
Abstract
The invention relates to ex vivo methods of modulating gamma variable 4 (Vγ4) T cells using antibodies or fragments thereof, which specifically bind to a Vγ4 chain of a γδ T cell receptor (TCR) and not to a gamma variable 2 (Vγ2) chain of a γδ TCR. Methods of treatment and other uses of expanded populations of Vγ4 T cells produced by said methods are also provided.
Claims
1. An ex vivo method of modulating gamma variable 4 (Vγ4) T cells comprising administering an antibody or fragment thereof, which specifically binds to a Vγ4 chain of a γδ T cell receptor (TCR) and not to a gamma variable 2 (Vγ2) chain of a γδ TCR, to a cell population comprising Vγ4 T cells.
2. The method as defined in claim 1, wherein the Vγ4 chain of the γδ TCR is human Vγ4 and the Vγ2 chain of the γδ TCR is human Vγ2.
3. The method as defined in claim 1 or 2, wherein the antibody or fragment thereof binds to an epitope of the Vγ4 chain of the γδ TCR comprising one or more amino acid residues within amino acid region 67-82 of SEQ ID NO: 1.
4. The method as defined in claim 3, wherein the epitope comprises at least one of amino acid residues 71, 73, 75, 76, 79 of SEQ ID NO: 1.
5. The method as defined in any one of claims 1 to 4, wherein the epitope comprises or consists of K76 and/or M80 of SEQ ID NO: 1.
6. The method as defined in any one of claims 1 to 5, wherein the epitope is an activating epitope of a γδ T cell.
7. The method as defined in claim 6, wherein binding of the activating epitope: (i) downregulates the γδ TCR; (ii) activates degranulation of the γδ T cell; (iii) activates γδ T cell-mediated killing; and/or (iv) activates or increases Vγ4 chain-mediated cell signalling.
8. An ex vivo method of modulating gamma variable 4 (Vγ4) T cells comprising administering an anti-Vγ4 antibody or fragment thereof, which comprises one or more of: a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-47, preferably with SEQ ID NO: 10 and/or 33; a CDR2 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 48-70 and SEQUENCES: A1-A23 (of Figure 1), preferably with SEQ ID NO: 56 and/or SEQUENCE A9; and/or a CDR1 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 71-116, preferably with SEQ ID NO: 79 and/or 102, to a cell population comprising Vγ4 T cells.
9. The method as defined in claim 8, wherein the antibody of fragment thereof comprises a VH region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-24, such as SEQ ID NOs: 10, 4, 14, 15, 17, 19 or 23.
10. The method as defined in claim 8 or claim 9, wherein the antibody of fragment thereof comprises a VL region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 25-47, such as SEQ ID NOs: 33, 27, 37, 38, 40, 42 or 46.
11. An ex vivo method of modulating gamma variable 4 (Vγ4) T cells comprising administering an anti-Vγ4 antibody or fragment thereof, which comprises an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 117-162 or 261-283, to a cell population comprising Vγ4 T cells.
12. An ex vivo method of modulating gamma variable 4 (Vγ4) T cells comprising administering an anti-Vγ4 antibody or fragment thereof comprises one or more of: (a) a VH comprising a HCDR1 having SEQ ID NO: 79, a HCDR2 having SEQ ID NO: 56 and a HCDR3 having SEQ ID NO: 10, optionally wherein the VH comprises SEQ ID NO: 125; and a VL comprising a LCDR1 having SEQ ID NO: 102, a LCDR2 having SEQUENCE A9 (of
13. An ex vivo method of modulating gamma variable 4 (Vγ4) T cells comprising administering an anti-Vγ4 antibody or fragment thereof which comprises an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 163-185, to a cell population comprising Vγ4 T cells.
14. An ex vivo method of modulating gamma variable 4 (Vγ4) T cells comprising administering an anti-Vγ4 antibody which comprises an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 233-255, to a cell population comprising Vγ4 T cells.
15. An ex vivo method of modulating gamma variable 4 (Vγ4) T cells comprising administering an anti-Vγ4 antibody or fragment thereof comprising a heavy chain amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 284-306 and/or a light chain amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 307-329, to a cell population comprising Vγ4 T cells.
16. The method as defined in any one of claims 1 to 15, wherein the anti-Vγ4 antibody or fragment thereof is: (i) an scFv or a full length antibody; and/or (ii) a human antibody or fragment thereof.
17. The method as defined in any one of claims 1 to 16, wherein the modulation comprises expansion of Vγ4 T cells.
18. The method as defined in claim 17, wherein the method provides an expanded population of Vγ4 T cells which contains greater than about 60% Vγ4 T cells, such as greater than about 70% Vγ4 T cells.
19. The method as defined in any one of claims 1 to 18, wherein the method comprises culturing the cell population for at least 5 days.
20. The method as defined in any one of claims 1 to 19, wherein the method comprises culturing the cell population in the presence of IL-2 and/or IL-15.
21. The method as defined in any one of claims 1 to 20, wherein the cell population is obtained from a haematopoietic sample or a fraction thereof.
22. The method as defined in claim 21, wherein the haematopoietic sample consists of peripheral blood mononuclear cells (PBMCs) or low density mononuclear cells (LDMCs).
23. The method as defined in any one of claims 1 to 20, wherein the cell population is obtained from a non-haematopoietic tissue sample, such as a skin, colon, gut, mammary gland, lung, prostate, liver, spleen, pancreas, uterus, vagina or other cutaneous, mucosal or serous membrane sample.
24. The method as defined in any one of claims 1 to 23, wherein the cell population is obtained from human or non-human animal tissue.
25. A Vγ4 T cell population obtained by the ex vivo method as defined in any one of claims 1 to 24.
26. A composition comprising the Vγ4 T cell population as defined in claim 25.
27. A pharmaceutical composition comprising the Vγ4 T cell population as defined in claim 25, together with a pharmaceutically acceptable diluent or carrier.
28. The pharmaceutical composition as defined in claim 27, for use as a medicament.
29. The pharmaceutical composition as defined in claim 27 for use in the treatment of cancer, an infectious disease or an inflammatory disease.
30. A method of treating a cancer, an infectious disease or an inflammatory disease in a subject in need thereof, comprising administering a therapeutically effective amount of the Vγ4 T cell population as defined in claim 25 or the pharmaceutical composition as defined in claim 27.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0084] Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. As used herein, the following terms have the meanings ascribed to them below.
[0085] Gamma delta (γδ) T cells represent a small subset of T cells that express on their surface a distinct, defining T Cell Receptor (TCR). This TCR is made up of one gamma (γ) and one delta (δ) chain. Each chain contains a variable (V) region, a constant (C) region, a transmembrane region and a cytoplasmic tail. The V region contains an antigen binding site. There are two major sub-types of human γδ T cells: one that is dominant in the peripheral blood and one that is dominant in non-haematopoietic tissues. The two sub-types may be defined by the type of δ and/or γ present on the cells. For example, most blood-resident γδ T cells express a Vδ2 TCR, for example Vγ9Vδ2, whereas this is less common among tissue-resident γδ T cells, which more frequently use Vδ1 for example in skin and Vγ4 in the gut. References to “Vγ4 T cells” refer to γδ T cells with a Vγ4 chain, i.e. Vγ4+ cells.
[0086] References to “gamma variable 4” may also be referred to as Vγ4 or Vg4. A gamma variable 4 polypeptide, or a nucleotide encoding a TCR chain containing this region, or the TCR protein complex comprising this region, may be referred to as “TRGV4”. Antibodies or fragments thereof which interact with the Vγ4 chain of a γδ TCR, are all effectively antibodies or fragments thereof which bind to Vγ4 and may referred to as “anti-TCR gamma variable 4 antibodies or fragments thereof” or “anti-Vγ4 antibodies or fragments thereof”. Reference to a human Vγ4 polypeptide may mean a polypeptide having an amino acid sequence corresponding to amino acids 1-99 of SEQ ID NO. 1. This 99 amino-acid sequence also corresponds to SEQ ID NO: 334. Therefore, it should be understood that reference herein to amino acids 1-99 of SEQ ID NO. 1 may be used interchangeably with reference to SEQ ID NO: 334, according to all aspects and embodiments of the invention. For instance, reference herein to amino acid region 67-82 of SEQ ID NO: 1 is equivalent with amino acid region 67-82 of SEQ ID NO: 334 and may be used interchangeably herein.
[0087] References to “delta variable 1” may also be referred to as Vδ1 or Vd1. A delta variable 1 polypeptide, or a nucleotide encoding a TCR chain containing this region, , or the TCR protein complex comprising this region, may be referred to as “TRDV1”. Antibodies or fragments thereof which interact with the Vδ1 chain of a γδ TCR, are all effectively antibodies or fragments thereof which bind to Vδ1 and may referred to as “anti-TCR delta variable 1 antibodies or fragments thereof” or “anti-Vδ1 antibodies or fragments thereof”. Reference to a human Vδ1 polypeptide may mean a polypeptide having an amino acid sequence corresponding to SEQ ID NO. 337.
[0088] References to “gamma variable 2” may also be referred to as Vγ2 or Vg2. A gamma variable 2 polypeptide, or a nucleotide encoding a TCR chain containing this region, , or the TCR protein complex comprising this region, may be referred to as “TRGV2”. Antibodies or fragments thereof which interact with the Vγ2 chain of a γδ TCR, are all effectively antibodies or fragments thereof which bind to Vγ2 and may referred to as “anti-TCR gamma variable 2 antibodies or fragments thereof” or “anti-Vγ2 antibodies or fragments thereof”. Reference to a human Vγ2 polypeptide may mean a polypeptide having an amino acid sequence corresponding to SEQ ID NO. 335.
[0089] References to “gamma variable 8” may also be referred to as Vγ8 or Vg8. A gamma variable 8 polypeptide, or a nucleotide encoding a TCR chain containing this region, , or the TCR protein complex comprising this region, may be referred to as “TRGV8”. Antibodies or fragments thereof which interact with the Vγ8 chain of a γδ TCR, are all effectively antibodies or fragments thereof which bind to Vγ8 and may referred to as “anti-TCR gamma variable 8 antibodies or fragments thereof” or “anti-Vγ8 antibodies or fragments thereof”. Reference to a human Vγ8 polypeptide may mean a polypeptide having an amino acid sequence corresponding to SEQ ID NO. 336.
[0090] The term “antibody” includes any antibody protein construct comprising at least one antibody variable domain comprising at least one antigen binding site (ABS). Antibodies include, but are not limited to, immunoglobulins of types IgA, IgG, IgE, IgD, IgM (as well as subtypes thereof). The overall structure of Immunoglobulin G (IgG) antibodies assembled from two identical heavy (H)-chain and two identical light (L)-chain polypeptides is well established and highly conserved in mammals (Padlan (1994) Mol. Immunol. 31:169-217).
[0091] A conventional antibody or immunoglobulin (Ig) is a protein comprising four polypeptide chains: two heavy (H) chains and two light (L) chains. Each chain is divided into a constant region and a variable domain. The heavy (H) chain variable domains are abbreviated herein as VH, and the light (L) chain variable domains are abbreviated herein as VL. These domains, domains related thereto and domains derived therefrom, may be referred to herein as immunoglobulin chain variable domains. The VH and VL domains (also referred to as VH and VL regions) can be further subdivided into regions, termed “complementarity determining regions” (“CDRs”), interspersed with regions that are more conserved, termed “framework regions” (“FRs”). The framework and complementarity determining regions have been precisely defined (Kabat et al. Sequences of Proteins of Immunological Interest, Fifth Edition U.S. Department of Health and Human Services, (1991) NIH Publication Number 91-3242). There are also alternative numbering conventions for CDR sequences, for example those set out in Chothia et al. (1989) Nature 342: 877-883. In a conventional antibody, each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The conventional antibody tetramer of two heavy immunoglobulin chains and two light immunoglobulin chains is formed with the heavy and the light immunoglobulin chains interconnected by e.g. disulphide bonds, and the heavy chains similarly connected. The heavy chain constant region includes three domains, CH1, CH2 and CH3. The light chain constant region is comprised of one domain, CL. The variable domain of the heavy chains and the variable domain of the light chains are binding domains that interact with an antigen. The constant regions of the antibodies typically mediate the binding of the antibody to host tissues or factors, including various cells of the immune system (e.g. effector cells) and the first component (C1q) of the classical complement system.
[0092] A fragment of the antibody (which may also be referred to as “antibody fragment”, “immunoglobulin fragment”, “antigen-binding fragment” or “antigen-binding polypeptide”) as used herein refers to a portion of an antibody (or constructs that contain said portion) that specifically binds to the target, the gamma variable 4 (Vγ4) chain of a γδ T cell receptor (e.g. a molecule in which one or more immunoglobulin chains is not full length, but which specifically binds to the target). Examples of binding fragments encompassed within the term antibody fragment include: [0093] (i) a Fab fragment (a monovalent fragment consisting of the VL, VH, CL and CH1 domains); [0094] (ii) a F(ab′)2 fragment (a bivalent fragment consisting of two Fab fragments linked by a disulphide bridge at the hinge region); [0095] (iii) a Fd fragment (consisting of the VH and CH1 domains); [0096] (iv) a Fv fragment (consisting of the VL and VH domains of a single arm of an antibody); [0097] (v) a single chain variable fragment, scFv (consisting of VL and VH domains joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules); [0098] (vi) a VH (an immunoglobulin chain variable domain consisting of a VH domain); [0099] (vii) a VL (an immunoglobulin chain variable domain consisting of a VL domain); [0100] (viii) a domain antibody (dAb, consisting of either the VH or VL domain); [0101] (ix) a minibody (consisting of a pair of scFv fragments which are linked via CH3 domains); and [0102] (x) a diabody (consisting of a noncovalent dimer of scFv fragments that consist of a VH domain from one antibody connected by a small peptide linker to a VL domain from another antibody).
[0103] “Human antibody” refers to antibodies having variable and constant regions derived from human germline immunoglobulin sequences. Human subjects administered with said human antibodies do not generate cross-species antibody responses (for example termed HAMA responses -human-anti-mouse antibody) to the primary amino acids contained within said antibodies. Said human antibodies may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g. mutations introduced by random or site-specific mutagenesis or by somatic mutation), for example in the CDRs and in particular CDR3. However, the term is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences. Human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial human antibody library, antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences, may also be referred to as “recombinant human antibodies”.
[0104] Substituting at least one amino acid residue in the framework region of a non-human immunoglobulin variable domain with the corresponding residue from a human variable domain is referred to as “humanisation”. Humanisation of a variable domain may reduce immunogenicity in humans.
[0105] “Specificity” refers to the number of different types of antigens or antigenic determinants to which a particular antibody or fragment thereof can bind. The specificity of an antibody is the ability of the antibody to recognise a particular antigen as a unique molecular entity and distinguish it from another. An antibody that “specifically binds” to an antigen or an epitope is a term well understood in the art. A molecule is said to exhibit “specific binding” if it reacts more frequently, more rapidly, with greater duration and/or with greater affinity with a particular target antigen or epitope, than it does with alternative targets. An antibody “specifically binds” to a target antigen or epitope if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances. An antibody (or fragment thereof) may be considered to specifically bind to a target if the binding is statistically significant compared to a non-relevant binder.
[0106] “Affinity”, represented by the equilibrium constant for the dissociation of an antigen with an antigen-binding polypeptide (KD), is a measure of the binding strength between an antigenic determinant and an antigen-binding site on the antibody (or fragment thereof): the lesser the value of the KD, the stronger the binding strength between an antigenic determinant and the antigen-binding polypeptide. Alternatively, the affinity can also be expressed as the affinity constant (KA), which is 1/KD. Affinity can be determined by known methods, depending on the specific antigen of interest. For example. KD may be determined by surface plasmon resonance.
[0107] Any KD value less than 10.sup.-6 is considered to indicate binding. Specific binding of an antibody, or fragment thereof, to an antigen or antigenic determinant can be determined in any suitable known manner, including, for example, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance, or spectroscopy (e.g. using a fluorescence assay) and the different variants thereof known in the art.
[0108] “Avidity” is the measure of the strength of binding between an antibody, or fragment thereof, and the pertinent antigen. Avidity is related to both the affinity between an antigenic determinant and its antigen binding site on the antibody and the number of pertinent binding sites present on the antibody.
[0109] “Human tissue Vγ4+ cells,” and “haemopoietic and blood Vγ4+ cells” and “tumour infiltrating lymphocyte (TIL) Vγ4+ cells,” are defined as Vγ4+ cells contained in or derived from either human tissue or the haemopoietic blood system or human tumours respectively. All said cell types can be identified by their (i) location or from where they are derived and (ii) their expression of the Vγ4+ TCR.
[0110] Suitably, the antibody or fragment thereof (i.e. polypeptide) is isolated. An “isolated” polypeptide is one that is removed from its original environment. The term “isolated” may be used to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g. an isolated antibody that specifically binds Vγ4, or a fragment thereof, is substantially free of antibodies that specifically bind antigens other than Vγ4). The term “isolated” may also be used to refer to preparations where the isolated antibody is sufficiently pure to be administered therapeutically when formulated as an active ingredient of a pharmaceutical composition, or at least 70-80% (w/w) pure, more preferably, at least 80-90% (w/w) pure, even more preferably, 90-95% pure; and, most preferably, at least 95%, 96%, 97%, 98%, 99%, or 100% (w/w) pure.
[0111] Suitably, the polynucleotides used in the present invention are isolated. An “isolated” polynucleotide is one that is removed from its original environment. For example, a naturally-occurring polynucleotide is isolated if it is separated from some or all of the coexisting materials in the natural system. A polynucleotide is considered to be isolated if, for example, it is cloned into a vector that is not a part of its natural environment or if it is comprised within cDNA.
[0112] The antibody or fragment thereof may be a “functionally active variant” which also includes naturally occurring allelic variants, as well as mutants or any other non-naturally occurring variants. As is known in the art, an allelic variant is an alternate form of a (poly)peptide that is characterized as having a substitution, deletion, or addition of one or more amino acids that essentially does not alter the biological function of the polypeptide. By way of non-limiting example, said functionally active variants may still function when the frameworks containing the CDRs are modified, when the CDRs themselves are modified, when said CDRs are grafted to alternate frameworks, or when N- or C-terminal extensions are incorporated. Further, CDR-containing binding domains may be paired with differing partner chains such as those shared with another antibody. Upon sharing with so called ‘common’ light or ‘common’ heavy chains, said binding domains may still function. Further, said binding domains may function when multimerized. Further, ‘antibodies or fragments thereof’ may also comprise functional variants wherein the VH or VL or constant domains have been modified away or towards a different canonical sequence (for example as listed at IMGT.org) and which still function.
[0113] For the purposes of comparing two closely-related polypeptide sequences, the “% sequence identity” between a first polypeptide sequence and a second polypeptide sequence may be calculated using NCBI BLAST v2.0, using standard settings for polypeptide sequences (BLASTP). For the purposes of comparing two closely-related polynucleotide sequences, the “% sequence identity” between a first nucleotide sequence and a second nucleotide sequence may be calculated using NCBI BLAST v2.0, using standard settings for nucleotide sequences (BLASTN).
[0114] Polypeptide or polynucleotide sequences are said to be the same as or “identical” to other polypeptide or polynucleotide sequences, if they share 100% sequence identity over their entire length. Residues in sequences are numbered from left to right, i.e. from N- to C- terminus for polypeptides; from 5′ to 3′ terminus for polynucleotides.
[0115] In some embodiments, any specified % sequence identity of a sequence is calculated without the sequences of all 6 CDRs of the antibody. For example, the anti-Vγ4 antibody or antigen-binding fragment thereof may comprise a variable heavy chain region sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% to a specified variable heavy chain region sequence and/or a variable light chain region sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a specified variable light chain region sequence, wherein any amino acid variations occur only in the framework regions of the variable heavy and light chain region sequences. In such embodiments, the anti-Vγ4 antibody or fragment thereof having certain sequence identities retain the complete heavy and light chain CDR1, CDR2 and CDR3 sequences of the corresponding anti-Vγ4 antibody or fragment thereof.
[0116] A “difference” between sequences refers to an insertion, deletion or substitution of a single amino acid residue in a position of the second sequence, compared to the first sequence. Two polypeptide sequences can contain one, two or more such amino acid differences. Insertions, deletions or substitutions in a second sequence which is otherwise identical (100% sequence identity) to a first sequence result in reduced % sequence identity. For example, if the identical sequences are 9 amino acid residues long, one substitution in the second sequence results in a sequence identity of 88.9%. If first and second polypeptide sequences are 9 amino acid residues long and share 6 identical residues, the first and second polypeptide sequences share greater than 66% identity (the first and second polypeptide sequences share 66.7% identity).
[0117] Alternatively, for the purposes of comparing a first, reference polypeptide sequence to a second, comparison polypeptide sequence, the number of additions, substitutions and/or deletions made to the first sequence to produce the second sequence may be ascertained. An “addition” is the addition of one amino acid residue into the sequence of the first polypeptide (including addition at either terminus of the first polypeptide). A “substitution” is the substitution of one amino acid residue in the sequence of the first polypeptide with one different amino acid residue. Said substitution may be conservative or non-conservative. A “deletion” is the deletion of one amino acid residue from the sequence of the first polypeptide (including deletion at either terminus of the first polypeptide).
[0118] Using the three letter and one letter codes, the naturally occurring amino acids may be referred to as follows: glycine (G or Gly), alanine (A or Ala), valine (V or Val), leucine (L or Leu), isoleucine (I or Ile), proline (P or Pro), phenylalanine (F or Phe), tyrosine (Y or Tyr), tryptophan (W or Trp), lysine (K or Lys), arginine (R or Arg), histidine (H or His), aspartic acid (D or Asp), glutamic acid (E or Glu), asparagine (N or Asn), glutamine (Q or Gln), cysteine (C or Cys), methionine (M or Met), serine (S or Ser) and Threonine (T or Thr). Where a residue may be aspartic acid or asparagine, the symbols Asx or B may be used. Where a residue may be glutamic acid or glutamine, the symbols Glx or Z may be used. References to aspartic acid include aspartate, and glutamic acid include glutamate, unless the context specifies otherwise.
[0119] A “conservative” amino acid substitution is an amino acid substitution in which an amino acid residue is replaced with another amino acid residue of similar chemical structure and which is expected to have little influence on the function, activity or other biological properties of the polypeptide. Such conservative substitutions suitably are substitutions in which one amino acid within the following groups is substituted by another amino acid residue from within the same group:
TABLE-US-00001 Group Amino acid residue Non-polar aliphatic Glycine Alanine Valine Methionine Leucine Isoleucine Aromatic Phenylalanine Tyrosine Tryptophan Polar uncharged Serine Threonine Cysteine Proline Asparagine Glutamine Negatively charged Aspartate Glutamate Positively charged Lysine Arginine Histidine
[0120] Suitably, a hydrophobic amino acid residue is a non-polar amino acid. More suitably, a hydrophobic amino acid residue is selected from V, I, L, M, F, W or C. In some embodiments, a hydrophobic amino acid residue is selected from glycine, alanine, valine, methionine, leucine, isoleucine, phenylalanine, tyrosine, or tryptophan.
[0121] As used herein, numbering of polypeptide sequences and definitions of CDRs and FRs are as defined according to the Kabat system (Kabat et al., 1991, herein incorporated by reference in its entirety). A “corresponding” amino acid residue between a first and second polypeptide sequence is an amino acid residue in a first sequence which shares the same position according to the Kabat system with an amino acid residue in a second sequence, whilst the amino acid residue in the second sequence may differ in identity from the first. Suitably corresponding residues will share the same number (and letter) if the framework and CDRs are the same length according to Kabat definition. Alignment can be achieved manually or by using, for example, a known computer algorithm for sequence alignment such as NCBI BLAST v2.0 (BLASTP or BLASTN) using standard settings.
[0122] References herein to an “epitope” refer to the portion of the target which is specifically bound by the antibody or fragment thereof. Epitopes may also be referred to as “antigenic determinants”. An antibody binds “essentially the same epitope” as another antibody when they both recognize identical or sterically overlapping epitopes. Commonly used methods to determine whether two antibodies bind to identical or overlapping epitopes are competition assays, which can be configured in a number of different formats (e.g. well plates using radioactive or enzyme labels, or flow cytometry on antigen-expressing cells) using either labelled antigen or labelled antibody. An antibody binds “the same epitope” as another antibody when they both recognize identical epitopes (i.e. all contact points between the antigen and the antibody are the same). For example, an antibody may bind the same epitope as another antibody when all contact points across a specified region of an antigen are identified as the same with the aid of a characterization method such as antibody/antigen cross-linking-coupled MS , HDX, X-ray crystallography, cryo-EM, or mutagenesis.
[0123] Further, with aid of such characterization methods, it is also possible to characterize antibodies which bind essentially the same epitope by recognizing some but not all of the identical contact points. Specifically, such antibodies may share a sufficient number of identical contact points in a specified antigenic region to deliver a broadly equivalent technical effect and/or equivalent antigen interaction selectivity. Additionally, in some instances whereby antibodies recognize essentially the same epitope and confer a broadly equivalent technical effect and/or interaction selectivity, it can also be useful to define the epitope binding footprint by the totality of antigen contacts inclusive of the most N-terminal antigen contact point through to the most C-terminal antigen contact point.
[0124] Epitopes found on protein targets may be defined as “linear epitopes” or “conformational epitopes”. Linear epitopes are formed by a continuous sequence of amino acids in a protein antigen. Conformational epitopes are formed of amino acids that are discontinuous in the protein sequence, but which are brought together upon folding of the protein into its three-dimensional structure.
[0125] The term “vector”, as used herein, is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a “plasmid”, which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian and yeast vectors). Other vectors (e.g. non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as “recombinant expression vectors” (or simply, “expression vectors”). In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, “plasmid” and “vector” may be used interchangeably as the plasmid is the most commonly used form of vector. However, other forms of expression vectors are also included, such as viral vectors (e.g. replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions, and also bacteriophage and phagemid systems. The term “recombinant host cell” (or simply “host cell”), as used herein, is intended to refer to a cell into which a recombinant expression vector has been introduced. Such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell, for example, when said progeny are employed to make a cell line or cell bank which is then optionally stored, provided, sold, transferred, or employed to manufacture an antibody or fragment thereof as described herein.
[0126] References to “subject”, “patient” or “individual” refer to a subject, in particular a mammalian subject, to be treated. Mammalian subjects include humans, non-human primates, farm animals (such as cows), sports animals, or pet animals, such as dogs, cats, guinea pigs, rabbits, rats or mice. In some embodiments, the subject is a human. In alternative embodiments, the subject is a non-human mammal, such as a mouse.
[0127] The term “sufficient amount” means an amount sufficient to produce a desired effect. The term “therapeutically effective amount” is an amount that is effective to ameliorate a symptom of a disease or disorder. A therapeutically effective amount can be a “prophylactically effective amount” as prophylaxis can be considered therapy.
[0128] A disease or disorder is “ameliorated” if the severity of a sign or symptom of the disease or disorder, the frequency with which such a sign or symptom is experienced by a subject, or both, is reduced.
[0129] As used herein, “treating a disease or disorder” means reducing the frequency and/or severity of at least one sign or symptom of the disease or disorder experienced by a subject.
[0130] “Cancer,” as used herein, refers to the abnormal growth or division of cells. Generally, the growth and/or life span of a cancer cell exceeds, and is not coordinated with, that of the normal cells and tissues around it. Cancers may be benign, pre-malignant or malignant. Cancer occurs in a variety of cells and tissues.
[0131] “Inflammation” refers to a chronic or acute triggering of the immune system resulting in an inflamed cell, cell type, tissue, or organ.
[0132] As used herein, the term “about” includes up to and including 10% greater and up to and including 10% lower than the value specified, suitably up to and including 5% greater and up to and including 5% lower than the value specified, especially the value specified. The term “between”, includes the values of the specified boundaries.
Methods of Modulating γδ T cells
[0133] According to a first aspect of the invention, there is provided an ex vivo method of modulating gamma variable 4 chain (Vγ4) T cells comprising administering an anti-Vγ4 antibody or fragment thereof as defined herein to a cell population comprising Vγ4 T cells. It will be understood that “administering” the antibody or fragment thereof includes “contacting” the Vγ4 T cells.
[0134] Modulation of Vγ4 T cells may include: [0135] expansion of the Vγ4 T cells, e.g. by selectively increasing the number of Vγ4 T cells or promotion of survival of Vγ4 T cells; [0136] stimulation of the Vγ4 T cells, e.g. by increasing Vγ4 T cell potency, i.e. increasing target cell killing; [0137] prevention of Vγ4 T cell exhaustion, e.g. by increasing persistence of the Vγ4 T cells; [0138] degranulation of Vγ4 T cells; [0139] immunosuppression of the Vγ4 T cells, e.g. by downregulation of Vγ4 TCR cell surface expression, i.e. by causing Vγ4 TCR internalisation or reduced expression of Vγ4 TCR protein, or blocking the Vγ4 TCR from binding; [0140] reducing Vγ4 T cell number, e.g. by inhibition of Vγ4 T cell proliferation or by inducing Vγ4 T cell death (i.e. killing Vγ4 T cells).
[0141] Such modulation of Vγ4 T cells may include, for example, Vγ4 T cell activation or Vγ4 T cell inhibition. In one embodiment, the Vγ4 T cells are activated by administering an anti-Vγ4 antibody or fragment thereof as defined herein. In an alternative embodiment, the Vγ4 T cells are inhibited by administering an anti-Vγ4 antibody or fragment thereof as defined herein. In an alternative embodiment, the Vγ4 T cells are not inhibited upon administration of an anti-Vγ4 antibody or fragment thereof as defined herein.
[0142] In one embodiment, the modulation of Vγ4 T cells comprises administering an anti-TCR gamma 4 variable antibody or fragment thereof to Vγ4 T cells in a culture (i.e. in vitro or ex vivo). The Vγ4 T cells may be present in a mixed cell population, e.g. in a cell population comprising other lymphocyte cell types (e.g. αβ T cells or NK cells).
[0143] In one embodiment, the cell population comprising Vγ4 T cells is isolated (i.e. from a sample as described herein) prior to administration of the anti-Vγ4 antibody or fragment thereof. In a further embodiment, the cell population is enriched for T cells prior to administration of the anti-Vγ4 antibody or fragment thereof. In a yet further embodiment, the cell population is enriched for γδ T cells prior to administration of the anti-Vγ4 antibody or fragment thereof.
[0144] The method may also be performed on a cell population comprising a purified fraction of .sub.γδ T cells. In such embodiments, the cell population is depleted of cells types other than γδ T cells present in the sample, such as αβ T cells and/or NK cells, prior to administration of the anti-Vγ4 antibody or fragment thereof. The cell population may additionally, or alternatively, be enriched of cells types which may contain Vγ4, such as T cells and/or γδ cells, prior to administration of the anti-Vγ4 antibody or fragment thereof. For example, prior to culturing the sample, the sample may be enriched for T cells, or enriched for γδ T cells, or depleted of αβ T cells or depleted of non-γδ T cells. In one embodiment, the sample is first depleted of αβ T cells and then enriched for CD3+ cells. Enrichment or depletion may be achieved using techniques known in the art, such as using magnetic beads coated with antibodies that bind to molecules on the cell surface relevant to the phenotype to be enriched/depleted.
[0145] The presence of cell types other than lymphocytes in cell culture, may inhibit Vγ4 cell expansion. Such cells, e.g. stromal, epithelial, tumour and/or feeder cells, may be removed prior to culture. Thus, in one embodiment, the cell population is not in direct contact with stromal cells during culture. Examples of stromal cells include fibroblasts, pericytes, mesenchymal cells, keratinocytes, endothelial cells and non-haematological tumour cells. Preferably, the lymphocytes are not in direct contact with fibroblasts during culture. In one embodiment, the cell population is not in direct contact with epithelial cells during culture. In one embodiment, the cell population is not in direct contact with tumour cells and/or feeder cells during culture.
[0146] In one embodiment, the method comprises culturing the Vγ4 T cells in the absence of substantial stromal cell contact. In a further embodiment, the method comprises culturing the Vγ4 T cells in the absence of substantial fibroblast cell contact.
[0147] In one embodiment, the method comprises culturing the Vγ4 T cells in media which is substantially free of serum (e.g. serum-free media or media containing a serum-replacement (SR)). Thus, in one embodiment, the method comprises culturing in serum-free media. Such serum free medium may also include serum replacement medium, where the serum replacement is based on chemically defined components to avoid the use of human or animal derived serum. In an alternative embodiment, the method comprises culturing in media which contains serum (e.g. human AB serum or fetal bovine serum (FBS)). In one embodiment, the media contains serum-replacement. In one embodiment, the media contains no animal-derived products.
[0148] It will be appreciated that a sample cultured in serum-free media has the advantage of avoiding issues with filtration, precipitation, contamination and supply of serum. Furthermore, animal derived products are not favoured for use in clinical grade manufacturing of human therapeutics.
[0149] In one embodiment, the anti-Vγ4 antibody or fragment thereof is in a soluble or immobilized form. For example, the antibody or fragment thereof may be administered to the Vγ4 T cells in a soluble form. Alternatively, the antibody or fragment thereof may be administered to the Vγ4 T cells when the antibody or fragment thereof is bound or covalently linked to a surface, such as a bead or plate (i.e. in an immobilized form). In one embodiment, the antibody is immobilized on a surface, such as Fc-coated wells. Alternatively, the antibody or fragment thereof is bound to the surface of a cell (e.g. immobilized on the surface of an antigen presenting cell (APC)). In another embodiment, the antibody is not immobilized on a surface when the cell population is contacted with the antibody.
[0150] The cell population contacted by the anti-Vγ4 antibody or fragment thereof may be obtained from a variety of sample types (methods of isolation are further described below). In one embodiment, the sample is a non-haematopoietic tissue sample. References herein to “non-haematopoietic tissues” or “non-haematopoietic tissue sample” include skin (e.g. human skin) and gut (e.g. human gut). Non-haematopoietic tissue is a tissue other than blood, bone marrow, lymphoid tissue, lymph node tissue, or thymus tissue. In one embodiment, the non-haematopoietic tissue sample is skin (e.g. human skin). In some embodiments, the cell population (e.g. γδ T cells) is not obtained from particular types of samples of biological fluids, such as blood or synovial fluid. In some embodiments, the cell population (e.g. γδ T cells) is obtained from skin (e.g. human skin), which can be obtained by methods known in the art. For example, the cell population may be obtained from the non-haematopoietic tissue sample by culturing the non-haematopoietic tissue sample on a synthetic scaffold configured to facilitate cell egress from the non-haematopoietic tissue sample. Alternatively, the methods can be applied to a cell population (e.g. γδ T cells) obtained from the gastrointestinal tract (e.g. colon or gut), mammary gland, lung, prostate, liver, spleen, pancreas, uterus, vagina and other cutaneous, mucosal or serous membranes.
[0151] In an alternative embodiment, the sample is a haematopoietic sample or fraction thereof (i.e. the cell population is obtained from a haematopoietic sample or a fraction thereof). References herein to “haematopoietic sample” or “haematopoietic tissue sample” include blood (such as peripheral blood or umbilical cord blood), bone marrow, lymphoid tissue, lymph node tissue, thymus tissue, and fractions or enriched portions thereof. The sample is preferably blood including peripheral blood or umbilical cord blood or fractions thereof, including buffy coat cells, leukapheresis products, peripheral blood mononuclear cells (PBMCs) and lowdensity mononuclear cells (LDMCs). In some embodiments the sample is human blood or a fraction thereof. The cells may be obtained from a sample of blood using techniques known in the art such as density gradient centrifugation. For example, whole blood may be layered onto an equal volume of FICOLL-HYPAQUE followed by centrifugation at 400xg for 15-30 minutes at room temperature. The interface material will contain low density mononuclear cells which can be collected and washed in culture medium and centrifuged at 200xg for 10 minutes at room temperature.
[0152] The cell population may be obtained from a cancer tissue sample (i.e. the γδ T cells may also be resident in cancer tissue samples), e.g. tumours of the gut, breast or prostate. In some embodiments, the cell population may be from human cancer tissue samples (e.g. solid tumour tissues). In other embodiments, the cell population may be from a sample other than human cancer tissue (e.g. a tissue without a substantial number of tumour cells). For example, the cell population may be from a region of skin (e.g. healthy skin) separate from a nearby or adjacent cancer tissue. Thus, in some embodiments, the cell population is not obtained from cancer tissue (e.g. human cancer tissue).
[0153] The cell population may be obtained from human or non-human animal tissue. Therefore, the method may additionally comprise a step of obtaining a cell population from human or non-human animal tissue. In one embodiment the sample has been obtained from a human. In an alternative embodiment, the sample has been obtained from a non-human animal subject.
Expansion of γδ T Cells
[0154] In one embodiment, the modulation comprises activation of the Vγ4 T cells, in particular expansion of the Vγ4 T cells. Therefore, according to an aspect of the invention, there is provided an ex vivo method of expanding Vγ4 T cells comprising administering an anti-Vγ4 antibody or fragment thereof as defined herein to a cell population comprising Vγ4 T cells. Such expansion of Vγ4 T cells may be achieved through the selective increase in number of Vγ4 T cells and/or through the promotion of survival of Vγ4 T cells. In one embodiment, the expansion of Vγ4 T cells comprises administering an anti-TCR gamma 4 variable antibody or fragment thereof to Vγ4 T cells in a culture (i.e. in vitro or ex vivo). The Vγ4 T cells may be present in a mixed cell population, e.g. in a cell population comprising other lymphocyte cell types (e.g. αβ T cells or NK cells).
[0155] The invention therefore provides ex vivo methods for producing an enriched γδ T cell (e.g. Vγ4 T cell) population. The enriched population can be produced from an isolated mixed cell populations (e.g. obtained from samples taken from patients/donors) by a method comprising contacting the mixed cell population, or a purified fraction thereof, with the antibody or fragment thereof. Said antibody (or fragment thereof) selectively expands Vγ4 T cells by binding to an epitope specific to a Vγ4 chain of a γδ TCR.
[0156] Also provided is an expanded Vγ4 T cell population obtained according to the method as defined herein. According to this aspect of the invention, it will be appreciated that such an expanded population of Vγ4 T cells may be obtained and/or expanded in vitro or ex vivo. In one aspect, there is provided an expanded Vγ4 population obtained according to the method as defined herein, wherein the Vγ4 population is isolated and expanded in vitro or ex vivo.
[0157] Antibodies or fragments thereof as described herein may be used in methods of expanding γδ T cells (e.g. Vγ4 T cells). These methods may be carried out in vitro. If the expansion methods are carried out in vitro, the antibodies (or fragments thereof) may be applied to isolated γδ T cells (e.g. Vγ4 T cells) obtained as described above. In some embodiments, the γδ T cells are expanded from a cell population that has been isolated from a non-haematopoietic tissue sample. In an alternative embodiment, the γδ T cells are expanded from a cell population that has been isolated from a haematopoietic tissue sample, such as a blood sample.
[0158] Expansion of γδ T cells (e.g. Vγ4 T cells) may comprise culturing the sample in the presence of the antibody or fragment thereof as described herein, and a cytokine. Cytokines may include interleukins, lymphokines, interferons, colony stimulating factors and chemokines. In one embodiment, the cytokine is selected from the group consisting of interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-6 (IL-6), interleukin-7 (IL-7), interleukin-8 (IL-8), interleukin-9 (IL-9), interleukin-12 (IL-12), interleukin-18 (IL-18), interleukin-21 (IL-21), interleukin-33 (IL-33), insulin-like growth factor 1 (IGF-1), interleukin-1β (IL-1β), interferon-y (IFN-γ) and stromal cell-derived factor-1 (SDF-1). It will be understood that references to the cytokines as described herein, may include any compound that has the same activity as said cytokine with respect to its ability to promote similar physiological effects on Vγ4 T cells in culture and includes, but is not limited to, mimetics, or any functional equivalent thereof.
[0159] In one embodiment, said cytokine is a common cytokine receptor gamma-chain (yc) family of cytokines. In a further embodiment, the yc-cytokine is selected from: IL-2, IL-4, IL-7, IL-9, IL-12, IL-15, IL-21 or mixtures thereof.
[0160] The cytokine (e.g. an interleukin) used may be of human or animal origin, preferably of human origin. It may be a wild-type protein or any biologically active fragment or variant, that is, to say, capable of binding its receptor. Such binding may induce activation of γδ T cells in the conditions of a method according to the invention. More preferably, the cytokines may be in soluble form, fused or complexed with another molecule, such as for example a peptide, polypeptide or biologically active protein. Preferably, a human recombinant cytokine is used. More preferably, the range of interleukin concentration could vary between 1-10000 U/ml, even more preferably between 100-1000 U/ml.
[0161] In a further embodiment, the cytokine is a chemokine. It will be further appreciated that the chemokine will vary and be selected depending on the sample used to obtain the γδ T cells.
[0162] In one embodiment, the method comprises culturing the cell population in the presence of IL-2, IL-9 and/or IL-15. In a further embodiment, the method comprises culturing the cell population in the presence of IL-2. In a further embodiment, the method comprises culturing the cell population in the presence of IL-2 and/or IL-15 (i.e. IL 2, IL-15 or a combination thereof). In an alternative embodiment, the method comprises culturing the cell population in the presence of IL-9 and/or IL-15 (i.e. IL 9, IL-15 or a combination thereof). In one embodiment, the method comprises the cell population in the presence of IL-2, IL-9 and/or IL-15, and an additional growth factor (for example, IL-21). In other embodiments, the method comprises culturing a cell population in a medium devoid of growth factors other than IL-2 and/or IL-15. In alternative embodiments, the method comprises culturing a cell population in a medium devoid of growth factors other than IL-9 and/or IL-15. In a further embodiment, the method comprises culturing a cell population in a medium which consists of a basal medium supplemented with IL-2, IL-9 and/or IL-15. In a further embodiment, the method comprises culturing a cell population in a medium which consists of a basal medium supplemented with IL-2 and/or IL-15.
[0163] In one embodiment, the method comprises culturing the cell population in the presence of IL-15 and a factor selected from the group consisting of IL-2, IL-4, IL-21, IL-6, IL-7, IL-8, IL-9, IL-12, IL-18, IL-33, IGF-1, IL-1β, IFN-γ, human platelet lysate (HPL), and stromal cell-derived factor-1 (SDF-1).
[0164] Expansion of γδ T cells may comprise culturing the sample in the presence of at least one further T cell mitogen. The term “a T cell mitogen” (which may also be referred to as “a γδ TCR agonist”) means any agent that can stimulate T cells through TCR signalling including, but not limited to, plant lectins such as phytohemagglutinin (PHA) and concanavalin A (ConA) and lectins of non-plant origin. In one embodiment, the T cell mitogen is an anti-CD3 monoclonal antibody (mAb). Other mitogens include phorbol 12-myristate-13-acetate (TPA) and its related compounds, such as mezerein, or bacterial compounds (e.g. Staphylococcal enterotoxin A (SEA) and Streptococcal protein A). The T cell mitogen may be soluble or immobilized and more than one T cell mitogen may be used in the method of expansion.
[0165] As used herein, references to “expanded” or “expanded population of γδ T cells” includes populations of cells which are larger or contain a larger number of cells than a non-expanded population. Such populations may be large in number, small in number or a mixed population with the expansion of a proportion or particular cell type within the population. It will be appreciated that the term “expansion method” refers to processes which result in expansion or an expanded population. Thus, expansion or an expanded population may be larger in number or contain a larger number of cells compared to a population which has not had an expansion step performed or prior to any expansion step. It will be further appreciated that any numbers indicated herein to indicate expansion (e.g. fold-increase or fold-expansion) are illustrative of an increase in the number or size of a population of cells or the number of cells and are indicative of the amount of expansion.
[0166] In one embodiment, the method comprises culturing the cell population for at least 5 days (e.g. at least 6 days, at least 7 days, at least 8 days, at least 9 days, at least 10 days, at least 11 days, at least 12 days, at least 13 days, at least 14 days, at least 18 days, at least 21 days, at least 28 days, or longer, e.g. from 5 days to 40 days, from 7 days to 35 days, from 14 days to 28 days, from 14 days to 21 days or about 14 days). In a further embodiment, the method comprises culturing the cell population for at least 7 days, such as at least 11 days or at least 14 days.
[0167] In further embodiments, method comprises culturing the cell population for a duration (e.g. at least 5 days, at least 6 days, at least 7 days, at least 8 days, at least 9 days, at least 10 days, at least 11 days, at least 12 days, at least 13 days, at least 14 days, at least 18 days, at least 21 days, at least 28 days, or longer, e.g. from 5 days to 40 days, from 7 days to 35 days, from 14 days to 28 days, from 14 days to 21 days or about 14 days) in an amount effective to produce an expanded population of γδ T cells.
[0168] In one embodiment, the cell population is cultured for a period of 5 to 60 days, such as at least 7 to 45 days, 7 to 21 days, from 7 days to 18 days or 7 to 14 days. If the method includes an isolation culture period (e.g. of 1 to 40 days, such as 14 to 21 days), the isolation and expansion steps, in some embodiments, can last between 21 and 39 days.
[0169] The method may comprise regular addition of the anti-Vγ4 antibody or fragment thereof and/or growth factor during culturing. For example, the anti-Vγ4 antibody or fragment thereof and/or growth factor could be added every 2 to 5 days, more preferably every 3 to 4 days. In one embodiment, the anti-Vγ4 antibody or fragment thereof and/or growth factor is added after 7 days of culture and every 2 to 3 days thereafter.
[0170] Methods of expansion provide an expanded population of γδ T cells that is greater in number than a reference population. In some embodiments, the expanded population of γδ T cells (e.g. Vγ4 T cells) is greater in number than the isolated population of γδ T cells prior to the expansion step (e.g. at least 2-fold in number, at least 5-fold in number, at least 10-fold in number, at least 25-fold in number, at least 50-fold in number, at least 60-fold in number, at least 70-fold in number, at least 80-fold in number, at least 90-fold in number, at least 100-fold in number, at least 200-fold in number, at least 300-fold in number, at least 400-fold in number, at least 500-fold in number, at 600-fold in number, at least 1,000-fold in number, or more relative to the isolated population ofγδ T cells prior to the expansion step). In one embodiment, the expanded population of γδ T cells (e.g. Vγ4 T cells) is greater in numberthan a population cultured for the same length of time without the presence of the antibody or fragment thereof. In one embodiment, the expanded population of γδ T cells (e.g. Vγ4 T cells) is greater in number than a population cultured for the same length of time in the presence of an isotype control, such as human IgG1.
[0171] Methods of expansion provide an expanded population of Vγ4 T cells that has a higher percentage of Vγ4 T cells than a reference population. In some embodiments, the expanded population of Vγ4 T cells contains greater than about 50% Vγ4 T cells, such as greater than about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 87%, 90%, 91%, 92%, 93%, 94% or 95% Vγ4 T cells. In a further embodiment, the expanded population of Vγ4 T cells contains greater than about 60% Vγ4 T cells, such as greater than about 70% Vγ4 T cells.
[0172] Numerous basal culture media suitable for use in the proliferation of γδ T cells are available, in particular medium, such as AIM-V, Iscoves medium and RPMI-1640 (Life Technologies), EXVIVO-10, EXVIVO-15 or EXVIVO-20 (Lonza), in the presence of serum or plasma. The medium may be supplemented with other media factors as defined herein, such as serum, serum proteins and selective agents, such as antibiotics. For example, in some embodiments, RPMI-1640 medium containing 2 mM glutamine, 10% FBS, 10 mM HEPES, pH 7.2, 1% penicillin-streptomycin, sodium pyruvate (1 mM; Life Technologies), non-essential amino acids (e.g. 100 .Math.M Gly, Ala, Asn, Asp, Glu, Pro and Ser; 1X MEM non-essential amino acids (Life Technologies)), and/or 10 .Math.l/L β-mercaptoethanol. In some embodiments, the media comprises RPMI-1640 supplemented with 5% human AB serum, Sodium Pyruvate (1 mM; Life Technologies) and penicillin/streptomycin. In an alternative embodiment, AIM-V medium may be supplemented with CTS Immune serum replacement and amphotericin B. In certain embodiments, the media may be further supplemented with IL-2, IL-4, IL-9 and/or IL 15 as described herein. Conveniently, cells are cultured at 37° C. in a humidified atmosphere containing 5% CO.sub.2 in a suitable culture medium during isolation and/or expansion.
[0173] Addition of other factors in the expansion culture of γδ T cells may also be used. In one embodiment, such factors are used in the expansion which selectively promote the expansion of γδ T cells. For example, expansion may additionally comprise addition of exogenous cytokines to the expansion culture, such as interleukins. Such expansion may comprise culturing the γδ T cells in the presence of IL-2 and IL-15. Alternatively, expansion may comprise culturing the γδ T cells in the presence of IL-9 and IL-15. It will be appreciated that any expansion step is performed for a duration of time effective to produce an expanded population of γδ T cells.
[0174] Methods of expanding γδ T cells may comprise a population doubling time of less than 5 days (e.g. less than 4.5 days, less than 4.0 days, less than 3.9 days, less than 3.8 days, less than 3.7 days, less than 3.6 days, less than 3.5 days, less than 3.4 days, less than 3.3 days, less than 3.2 days, less than 3.1 days, less than 3.0 days, less than 2.9 days, less than 2.8 days, less than 2.7 days, less than 2.6 days, less than 2.5 days, less than 2.4 days, less than 2.3 days, less than 2.2 days, less than 2.1 days, less than 2.0 days, less than 46 hours, less than 42 hours, less than 38 hours, less than 35 hours, less than 32 hours).
Methods of Isolating γδ T cells
[0175] As described herein, antibodies (or fragments thereof) may be applied to γδ T cells in culture, i.e. γδ T cells, which have been obtained from a sample. In one embodiment, the cell population is isolated from a sample prior to administering the anti-Vγ4 antibody or fragment thereof. Therefore, there is provided a method of modulating (in particular, expanding) Vγ4 T cells comprising administering an anti-Vγ4 antibody or fragment thereof as defined herein to a population of γδ T cells (e.g. a cell population comprising Vγ4 T cells) isolated from a sample.
[0176] References herein to “isolation” or “isolating” of cells, in particular of γδ T cells, refer to methods or processes wherein cells are removed, separated, purified, enriched or otherwise taken out from a tissue or a pool of cells. It will be appreciated that such references include the terms “separated”, “removed”, “purified”, “enriched” and the like. Isolation of γδ T cells includes the isolation or separation of cells from an intact non-haematopoietic tissue sample or from the stromal cells of the non-haematopoietic tissue (e.g. fibroblasts or epithelial cells). Such isolation may alternatively or additionally comprise the isolation or separation of γδ T cells from other haematopoietic cells (e.g. αβ T cells or other lymphocytes). Isolation may be for a defined period of time, for example starting from the time the tissue explant or biopsy is placed in the isolation culture and ending when the cells are collected from culture, such as by centrifugation or other means for transferring the isolated cell population to expansion culture or used for other purposes, or the original tissue explant or biopsy is removed from the culture. The isolation step may be for at least about 3 days to about 45 days. In one embodiment, the isolation step is for at least about 10 days to at least 28 days. In a further embodiment, the isolation step is for at least 14 days to at least 21 days. The isolation step may therefore be for at least 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days, 28 days, 29 days, 30 days, 31 days, 32 days, about 35 days, about 40 days, or about 45 days. It can be appreciated that although cell proliferation may not be substantial during this isolation step, it is not necessarily absent. Indeed for someone skilled in the art it is recognized that isolated cells may also start to divide to generate a plurality of such cells within the isolation vessel containing the sample.
[0177] Thus, references herein to “isolated γδ T cells”, “isolated γδ T cell population” or “isolated population of γδ T cells” will be appreciated to refer to γδ cells that have been isolated, separated, removed, purified or enriched from the sample, such as a non-haematopoietic tissue sample of origin, such that the cells are out of substantial contact with cells contained within the intact (non-haematopoietic tissue) sample. References herein to “isolated Vγ4 T cells”, “isolated Vγ4 T cell population”, “isolated population of Vγ4 T cells”, “separated Vγ4 T cells”, “separated Vγ4 T cell population” or “separated population of Vγ4 T cells” will be appreciated to refer to Vγ4 T cells that have been isolated, separated, removed, purified or enriched from the sample, such as a non-haematopoietic tissue sample of origin, such that the cells are out of substantial contact with cells contained within the intact (non-haematopoietic tissue) sample.
[0178] Non-haematopoietic tissue resident lymphocytes can be harvested and separated from stromal cells, such as dermal fibroblasts, e.g. by firm pipetting. The lymphocyte harvest may further be washed through a 40 .Math.m nylon mesh in order to retain fibroblast aggregates that may have become loose during the process. Lymphocytes may also be isolated using fluorescent or magnetic associated cell sorting using, for example, CD45 antibodies.
[0179] Isolation of γδ T cells may comprise culturing the sample in the presence of at least one cytokine. For example, the method may comprise culturing the sample in the presence of at least agent, such as a chemokine. It will be further appreciated that chemokines will be selected depending on the γδ T cells being isolated. Furthermore, the chemokines will vary and be selected depending on the sample used for isolation of the γδ T cells.
[0180] Isolation of γδ T cells may comprise further culturing the sample in the presence of at least one cytokine. Said cytokine may be different to the cytokine used in the initial culture.
[0181] Isolation methods may comprise culturing the sample. References herein to “culturing” include the addition of the sample, including isolated, separated, removed, purified or enriched cells from the sample, to media comprising growth factors and/or essential nutrients required and/or preferred by the cells and/or sample. It will be appreciated that such culture conditions may be adapted according to the cells or cell population to be isolated from the sample or may be adapted according to the cells or cell population to be isolated and expanded from the sample.
[0182] In certain embodiments, culturing of the sample is for a duration of time sufficient for the isolation of γδ T cells from the sample. In certain embodiments, the duration of culture is at least 14 days. In certain embodiments, the duration of culture is less than 45 days, such as less than 30 days, such as less than 25 days. In a further embodiment, the duration of culture is between 14 days and 35 days, such as between 14 days and 21 days. In a yet further embodiment, the duration of culture is about 21 days.
[0183] In particular embodiments, the γδ T are collected from the culture after culturing of the sample. Collection of the γδ T cells may include the physical collection of γδ T cells from the culture, isolation of the γδ T cells from other lymphocytes (e.g. αβ T cells and/or NK cells) or isolation and/or separation of the γδ T cells from other cells present in the sample, e.g. stromal cells such as fibroblasts. In one embodiment, γδ T cells are collected by mechanical means (e.g. pipetting). In a further embodiment, γδ T cells are collected by means of magnetic separation and/or labelling.
[0184] In a yet further embodiment, the γδ T cells are collected by flow cytometric techniques such as FACS. Thus, in certain embodiments, the γδ T cells are collected by means of specific labelling the γδ T cells. It will be appreciated that such collection of γδ T cells may include the physical removal from the culture of the sample, transfer to a separate culture vessel or to separate or different culture conditions.
[0185] It will be appreciated that such collecting of γδ T cells is performed after a duration of time sufficient to achieve an isolated population of γδ T cells from the sample. In certain embodiments, the γδ T cells are collected after at least one week, at least 10 days, at least 11 days, at least 12 days, at least 13 days or at least 14 days of culturing of the sample. Suitably, the γδ T cells are collected after 40 days or less, such as 38 days or less, 36 days or less, 34 days or less, 32 days or less, 30 days or less, 28 days or less, 26 days or less or 24 days or less. In one embodiment, the γδ T cells are collected after at least 14 days of culturing of the sample. In a further embodiment, the γδ T cells are collected after 14 to 21 days of culturing of the sample.
[0186] In one embodiment, the sample is cultured in media which is substantially free of serum (e.g. serum-free media or media containing a serum-replacement (SR)). Thus, in one embodiment, the sample is cultured in serum-free media. Such serum free medium may also include serum replacement medium, where the serum replacement is based on chemically defined components to avoid the use of human or animal derived serum. In one embodiment, the media contains no animal-derived products. In an alternative embodiment, the sample is cultured in media which contains serum (e.g. human AB serum or fetal bovine serum (FBS)).
[0187] Culture media may additionally include other ingredients that can assist in the growth and expansion of the γδ T cells. Examples of other ingredients that may be added, include, but are not limited to, plasma or serum, purified proteins such as albumin, a lipid source such as low density lipoprotein (LDL), vitamins, amino acids, steroids and any other supplements supporting or promoting cell growth and/or survival.
Antibodies or Fragments Thereof
[0188] Provided herein are antibodies or fragments thereof, which specifically bind to a variable gamma 4 (Vγ4) chain of a γδ T cell receptor (TCR). In particular, the antibody or fragment thereof does not bind to (or cross react with) a variable gamma 2 (Vγ2) chain of a γδ TCR. It should be understood that this is with reference to a Vγ4 chain and a Vγ2 from the same species. Preferably, the species is Homo sapiens (human) and therefore the antibody or fragment thereof, may specifically bind to a human gamma variable 4 (Vγ4) chain of a γδ T cell receptor (TCR) and not to a human gamma variable 2 (Vγ2) chain of a γδ TCR. For instance, the human Vγ4 chain may have a sequence according to amino acids 1-99 of SEQ ID NO. 1 and/or the human Vγ2 chain may have a sequence according to SEQ ID NO. 335. In other species, the antibody or fragment thereof, specifically binds to the species-specific ortholog of the human gamma variable 4 (Vγ4) chain of a γδ T cell receptor (TCR) and not to the species-specific ortholog of the human gamma variable 2 (Vγ2) chain of a γδ TCR. Thus, the antibody or fragment thereof may specifically bind to a human gamma variable 4 (Vγ4) chain of a γδ T cell receptor (TCR) having a sequence corresponding to amino acids 1-99 of SEQ ID NO. 1 or non-human ortholog thereof and not to a human gamma variable 2 (Vγ2) chain of a γδ TCR having a sequence corresponding to SEQ ID NO. 335 or non-human ortholog thereof. Ortholog in this context may mean a gamma chain sequence with the highest sequence similarity to the reference sequence, or preferably one which possesses the same function (e.g. interaction with orthologous cognate ligands in vivo). For instance, in mouse, the protein designated under the Heilig & Tonegave nomenclature as Vγ7 is functionally most closely related to human Vγ4 (Barros et al. (2016) Cell, 167:203-218.e17).
[0189] This development is profound. In humans, for example, the Vγ4 and Vγ2 chains share 91% sequence identity (they only differ by nine amino acids). Therefore this has made it difficult to obtain antibodies which bind to (human) Vγ4 and not to (human) Vγ2 and it was not expected in the art to be possible to produce such antibodies.
[0190] When referring to an antibody or fragment thereof which specifically binds to a Vγ4 chain of a γδ TCR, this generally means that binding of the antibody or fragment thereof to the Vγ4 chain is statistically significantly increased relative to a negative control antibody and/or a negative control antigen (e.g. as measured via binding in an ELISA assay, optionally a DELFIA ELISA assay, or SPR). The level detected in respect of the negative control antibody and/or negative control antigen may be considered the background level for the assay used, representing “noise” in the assay system as would be well-understood by the skilled person. In particular embodiments, signal levels above a pre-determined threshold relative to the background level may be considered to represent detection of binding (e.g. about 1-fold, 2-fold, 3-fold, 4-fold, 5-fold or more above the background level). For instance, in a DELFIA ELISA assay a signal level 5-fold or more above the background level may be considered to indicate binding of the antibody to the antigen. The skilled person is well able to determine a suitable threshold based on the assay system being used. Conversely, when referring to an antibody or fragment thereof which does not bind to (or cross react with) a Vγ2 chain of a γδ TCR, this generally means that binding of the antibody or fragment thereof to the Vγ2 chain is not statistically significantly increased relative to a negative control antibody and/or a negative control antigen (e.g. as measured via binding in an ELISA assay, optionally a DELFIA ELISA assay, or SPR). This is demonstrated, for example, in
[0191] In one embodiment, the antibody or fragment thereof is an scFv, Fab, Fab′, F(ab′)2, Fv, variable domain (e.g. VH or VL), diabody, minibody or monoclonal antibody. In a particular embodiment, the antibody or fragment thereof is an scFv. In another particular embodiment, the antibody is a monoclonal antibody.
[0192] Antibodies described herein can be of any class, e.g. IgG, IgA, IgM, IgE, IgD, or isotypes thereof, and can comprise a kappa or lambda light chain. In one embodiment, the antibody is an IgG antibody, for example, at least one of isotypes, IgG1, IgG2, IgG3 or IgG4. In on embodiment, the antibody is an IgG1. In a further embodiment, the antibody may be in a format, such as an IgG format, that has been modified to confer desired properties, such as having the Fc mutated to reduce effector function, extend half life, alter ADCC, or improve hinge stability. Such modifications are well known in the art and exemplary embodiments are described herein. For instance, an antibody or fragment thereof may comprise an IgG1 constant domain comprising an amino acid sequence according to SEQ ID NO: 332 or 333.
[0193] In one embodiment, the antibody or fragment thereof is human. Thus, the antibody or fragment thereof may be derived from a human immunoglobulin (Ig) sequence. The CDR, framework and/or constant region of the antibody (or fragment thereof) may be derived from a human Ig sequence, in particular a human IgG sequence. The CDR, framework and/or constant region may be substantially identical for a human Ig sequence, in particular a human IgG sequence. An advantage of using human antibodies is that they have low or no immunogenicity in humans.
[0194] An antibody or fragment thereof can also be chimeric, for example a mouse-human antibody chimera.
[0195] Alternatively, the antibody or fragment thereof is derived from a non-human species, such as a mouse. Such non-human antibodies can be modified to increase their similarity to antibody variants produced naturally in humans, thus the antibody or fragment thereof can be partially or fully humanised. Therefore, in one embodiment, the antibody or fragment thereof is humanised.
Antibodies Targeted to Epitopes
[0196] Provided herein are antibodies (or fragments thereof) which bind to an epitope of the Vγ4 chain of a γδ TCR. Binding of the epitope on the Vγ4 chain may optionally have an effect on γδ TCR activity, such as activation or inhibition. The antibodies (or fragments thereof) may have a blocking effect by prevention of the binding or interaction of another antibody or molecule. The antibodies are specific for the Vγ4 chain of a γδ TCR, and do not bind epitopes of other antigens, such as the Vγ2 chain of a γδ TCR or the Vγ8 chain of a γδ TCR, as defined herein.
[0197] In one embodiment, the epitope may be an activating epitope of a γδ T cell. An “activating” epitope can include, for example, modulation of a TCR-associated function, such as TCR downregulation, degranulation of the cell, cytoxicity, proliferation, mobilisation, increased survival or resistance to exhaustion, intracellular signaling, cytokine or growth factor secretion, phenotypic change, or a change in gene expression. For example, the binding of the activating epitope may stimulate expansion (i.e. proliferation) of the γδ T cell population, preferably the Vγ4+ T cell population. Accordingly, these antibodies can be used to modulate γδ T cell activation, and, thereby, to modulate the immune response. Therefore, in one embodiment, binding of the activating epitope downregulates the γδ TCR. In an additional or alternative embodiment, binding of the activating epitope activates degranulation of the γδ T cell. In a further additional or alternative embodiment, binding of the activating epitope activates the γδ T cell to kill target cells (e.g. cancer cells).
[0198] In one embodiment, the antibodies or fragments thereof block Vγ4 and prevent TCR binding (e.g. through steric hinderance). By blocking Vγ4, the antibody may prevent TCR activation and/or signalling. The epitope may therefore be an inhibitory epitope of a γδ T cell. An “inhibitory” epitope can include, for example, blocking TCR function, thereby inhibiting TCR activation.
[0199] The epitope is preferably comprised of at least one extracellular, soluble, hydrophilic, external or cytoplasmic portion of the Vγ4 chain of a γδ TCR.
[0200] In particular embodiments, the epitope does not comprise an epitope found in a non-germline encoded region of the Vγ4 chain of the γδ TCR, in particular CDR3 of the Vγ4 chain. In a preferred embodiment, the epitope is within a framework region of the Vγ4 chain of the γδ TCR, which may be the hypervariable 4 region of framework region 3. It will be appreciated that such binding allows for the unique recognition of the Vγ4 chain in general without the restriction to the sequences of the TCR which are highly variable between Vγ4 chains (in particular CDR3). As such, it will be appreciated that any Vγ4 chain-comprising γδ TCR may be recognised using the antibodies or fragments thereof as defined herein, irrespective of the specificity of the γδ TCR.
[0201] It is possible that the γδ receptor can bind a variety of modulating ligands independently and via spatially distinct domains. Consistent with such multi-modal ligand binding, recent studies by Melandri et al. (2018) Nat. Immunol. 19: 1352-1365 have shown that human TCR binding to the endogenous BTNL3 ligand is via a discrete domain located N-terminal of CDR3 on the y4 chain. The authors highlight that because BTNL3 binding is mediated via this specific germline region of the TCR, the more C-terminal, somatically recombined CDR3 loop remains free to bind other ligands independently. Furthermore, this sub-region of framework region 3 (FR3) (which may also be referred to as ‘hypervariable region 4’ (HV4)) differs from the human y2 chain by four amino acids. However, no specific anti-Vγ4 antibodies were disclosed in Melandri et al. nor was it suggested how such antibodies could be derived. Indeed, the prevailing view was that this would not be possible due to the significant sequence homology shared between the human Vγ4 and Vγ2 chains (91% sequence identity).
[0202] An antibody which binds within the HV4 region may allow the CDR3 region of the y4 chain to still bind, with the added advantage of providing a binder which is specific to y4 over y2. Furthermore, as the HV4 is germline-encoded, some antibodies targeting this region may recognise all Vγ4 chains, while other antibodies that recognise Vγ4 may be specific for certain Vγ4 chains.
[0203] The disclosure now provides antibodies and fragments thereof which may specifically bind to the HV4 region of the Vγ4 chain. Therefore, in one embodiment, the antibody or fragment thereof binds to an epitope of the HV4 region of the Vγ4 chain. The HV4 region comprises amino acids 67 to 82 of SEQ ID NO: 1. Therefore, in one embodiment, the epitope comprises one or more amino acid residues within amino acid region 67-82 of SEQ ID NO: 1, e.g. the portion of the Vγ4 chain which is not part of the CDR1, CDR2 and/or CDR3 sequences. In so doing, the antibody or fragment thereof may modulate the interaction between the Vγ4+ TCR and BTNL3/8. In one embodiment, the epitope does not comprise amino acid residues within amino acid region 96-106 (CDR3) of SEQ ID NO: 1. In one embodiment, the epitope does not comprise amino acid residues within amino acid region 50-57 (CDR2) of SEQ ID NO: 1. In one embodiment, the epitope does not comprise amino acid residues within amino acid region 27-32 (CDR1) of SEQ ID NO: 1.
[0204] In particular embodiments, the antibody or fragment thereof may, upon binding to one or more of amino acids 67 to 82 of SEQ ID NO: 1, activate the Vγ4+ TCR
[0205] In a similar manner to the well characterised αβ T cells, γδ T cells utilize a distinct set of somatically rearranged variable (V), diversity (D) (for β and δ only), joining (J), and constant (C) genes, although γδ T cells contain fewer V, D, and J segments than αβ T cells. In one embodiment, the epitope bound by the antibodies (or fragments thereof) does not comprise an epitope found in the J region of the Vγ4 chain. The antibody or fragment may therefore only bind in the V region of the Vγ4 chain. Thus, in one embodiment, the epitope consists of an epitope in the V region of the γδ TCR (e.g. amino acid residues 1-99 of SEQ ID NO: 1).
[0206] Reference to the epitope are made in relation to the Vγ4 sequence described in Luoma et al. (2013) Immunity 39: 1032-1042, and RCSB Protein Data Bank entry: 4MNH, shown as SEQ ID NO: 1:
TABLE-US-00002 SSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISP GKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDEKYYKKLFGSGTTLVVTEDLKNVFPPEVAV FEPSEAEISHTQKATLVCLATGFYPDHVELSVVVVVNGKEVHSGVCTDPQPLKEQPALNDSRYAL SSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADSRGGLEVL FQ (SEQ ID NO: 1)
[0207] SEQ ID NO: 1 represents a soluble TCR comprising a V region (also referred to as the variable domain) and a J region. The V region comprises amino acid residues 1-99, the J region comprises amino acid residues 102-116 and the constant region from TCRβ comprises amino acid residues 117-256. Within the V region, CDR1 is defined as amino acid residues 27 to 32 of SEQ ID NO: 1, CDR2 is defined as amino acid residues 50 to 57 of SEQ ID NO: 1, and CDR3 is defined as amino acid residues 96 to 106 of SEQ ID NO: 1.
[0208] The inventors have identified that amino acids K76 (i.e. lysine at position 76) and M80 (i.e. methionine at position 80) of SEQ ID NO: 1 may be particularly important for binding to the HV4 region of the (human) Vγ4 chain (Example 6). Thus, the epitope may comprise, or consist of, K76 and/or M80 of SEQ ID NO: 1.
[0209] The inventors have further identified that amino acids within the amino acid region 71-79 of SEQ ID NO: 1 may be particularly important for binding to the HV4 region of the (human) Vγ4 chain. Thus, in a further embodiment, the epitope comprises one or more amino acid residues within amino acid region 71-79 of SEQ ID NO: 1.
[0210] In one embodiment, the epitope comprises one or more, such as two, three, four, five, six, seven, eight, nine, ten or more amino acid residues within the described region.
[0211] In one embodiment, the epitope comprises one or more (such as 5 or more, such as 10 or more) amino acid residues within amino acid region 67-82 of SEQ ID NO: 1. In a further embodiment the epitope comprises one or more (such as 3 or more, such as 5 or more) amino acid residues within amino acid region 71-79 of SEQ ID NO: 1.
[0212] It will be further understood that said antibody (or fragment thereof) does not need to bind to all amino acids within the defined range. Such epitopes may be referred to as linear epitopes. For example, an antibody which binds to an epitope comprising amino acid residues within amino acid region 67-82 of SEQ ID NO: 1, may only bind with one or more of the amino acid residues in said range, e.g. the amino acid residues at each end of the range (i.e. amino acids 67 and 82), optionally including amino acids within the range (i.e. amino acids 71, 73, 75, 76 and 79).
[0213] For instance, the inventors have found that amino acid residues 71, 73, 75, 76 and 79 of SEQ ID NO: 1 may form the epitope to which the anti-Vγ4 antibody or fragment thereof binds (Example 8). Thus, in one embodiment, the epitope comprises at least one of amino acid residues 71, 73, 75, 76 and 79 of SEQ ID NO: 1. In further embodiments, the epitope comprises one, two, three, four or five (in particular four or five) amino acids selected from amino acid residues 71, 73, 75, 76 and 79 of SEQ ID NO: 1.
[0214] In a further embodiment, the epitope consists of one or more amino acid residues within amino acid regions: 67-82 of SEQ ID NO: 1. In a further embodiment, the epitope consists of one or more amino acid residues within amino acid regions: 71-79 of SEQ ID NO: 1.
[0215] In a further embodiment, the epitope comprises amino acid residues: 71-79 of SEQ ID NO: 1, or suitably consists of amino acid residues: 71-79 of SEQ ID NO: 1. In a yet further embodiment, the epitope comprises amino acid residues: 71, 73, 75, 76 and 79 of SEQ ID NO: 1, or suitably consists of amino acid residues: 71, 73, 75, 76 and 79 of SEQ ID NO: 1.
[0216] Various techniques are known in the art to establish which epitope is bound by an antibody. Exemplary techniques include, for example, routine cross-blocking assays, alanine scanning mutational analysis, peptide blot analysis, peptide cleavage analysis crystallographic studies and NMR analysis. In addition, methods such as epitope excision, epitope extraction and chemical modification of antigens can be employed. Another method that can be used to identify the amino acids within a polypeptide with which an antibody interacts is hydrogen/deuterium exchange detected by mass spectrometry (as described in Example 8). In general terms, the hydrogen/deuterium exchange method involves deuterium-labelling the protein of interest, followed by binding the antibody to the deuterium-labelled protein. Next, the protein/antibody complex is transferred to water and exchangeable protons within amino acids that are protected by the antibody complex undergo deuterium-to-hydrogen back-exchange at a slower rate than exchangeable protons within amino acids that are not part of the interface. As a result, amino acids that form part of the protein/antibody interface may retain deuterium and therefore exhibit relatively higher mass compared to amino acids not included in the interface. After dissociation of the antibody, the target protein is subjected to protease cleavage and mass spectrometry analysis, thereby revealing the deuterium-labelled residues which correspond to the specific amino acids with which the antibody interacts.
[0217] In addition, or as an alternative, antigen chimerization & mutagenesis studies can be used to identify the amino acids within a polypeptide with which an antibody interacts (as described in Example 6). In general terms, this method involves creating a series of one or more chimeric antigens wherein the amino acid sequence of a first reference antigen may be systematically altered based on the amino acid sequence of a second reference antigen in order to substitute one or more of the amino acids in the first reference antigen with respective amino acids from the second reference antigen. “Respective amino acids” in this context means amino acids in equivalent positions within the sequence of the first reference antigen and second reference antigen upon sequence alignment thereof. Binding of the test antibody to each of the first reference antigen, second reference antigen and/or series of one or more chimeric antigens is then measured. Loss/gain of binding to each antigen can then be attributed to specific amino acid changes made relative to the first reference sequence and/or second reference sequence. It may be already known whether or not the antibody is capable of binding or not to the first reference antigen and/or the second reference antigen. For instance, as described in Example 6, the first reference antigen may be a human Vγ4 chain and the second reference antigen may be a human Vγ2 chain, with the series of chimeric antigens made by replacing one or more of the amino acids in the Vγ4 chain sequence with the respective one or more amino acids in the V.sub.γ2 chain sequence.
Antibody Sequences
[0218] The anti-Vγ4 antibodies, or fragments thereof, may be described with reference to their CDR sequences.
[0219] Therefore, in one embodiment, the anti-Vγ4 antibody or fragment thereof, which comprises one or more of: [0220] a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-47, preferably with SEQ ID NO: 10 and/or 33; [0221] a CDR2 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 48-70 and SEQUENCES: A1-A23 (of
[0223] In one embodiment, the anti-Vγ4 antibody or fragment thereof comprises a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-47. In one embodiment, the antibody or fragment thereof comprises a CDR2 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 48-70 and SEQUENCES: A1-A23 (of
[0224] In some embodiments, the anti-Vγ4 antibody or fragment thereof may comprise one or more of: [0225] a heavy chain CDR3 (HCDR3) comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-24, preferably with SEQ ID NO: 10; [0226] a heavy chain CDR2 (HCDR2) comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 48-70, preferably with SEQ ID NO: 56 ; and/or [0227] a heavy chain CDR1 (HCDR1) comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 71-93, preferably with SEQ ID NO: 79.
[0228] Alternatively, or in addition to, the anti-Vγ4 antibody or fragment thereof may comprise one or more of: [0229] a light chain CDR3 (LCDR3) comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 25-47, preferably with SEQ ID NO: 33; [0230] a light chain CDR2 (LCDR2) comprising a sequence having at least 80% sequence identity with any one of SEQUENCES: A1-A23 (of
[0232] In one embodiment, the antibody or fragment thereof comprises a CDR3 comprising a sequence having at least 85%, 90%, 95%, 97%, 98% or 99% sequence identity with any one of SEQ ID NOs: 2-47. In one embodiment, the antibody or fragment thereof comprises a CDR2 comprising a sequence having at least 85%, 90%, 95%, 97%, 98% or 99% sequence identity with any one of SEQ ID NOs: 48-70 and SEQUENCES: A1-A23 (of
[0233] In one embodiment, the antibody or fragment thereof comprises a CDR3 consisting of a sequence having at least 85%, 90%, 95%, 97%, 98% or 99% sequence identity with any one of SEQ ID NOs: 2-47. In one embodiment, the antibody or fragment thereof comprises a CDR2 consisting of a sequence having at least 85%, 90%, 95%, 97%, 98% or 99% sequence identity with any one of SEQ ID NOs: 48-70 and SEQUENCES: A1-A23 (of
[0234] In one embodiment, the antibody or fragment thereof comprises a VH region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-24 and/or a VL region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 25-47. In one embodiment, the antibody or fragment thereof comprises a VH region comprising a CDR3 consisting of a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-24 and/or a VL region comprising a CDR3 consisting of a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 25-47.
[0235] In one embodiment, the antibody or fragment thereof comprises a VH region comprising a CDR3 comprising a sequence having at least 90% sequence identity with any one of SEQ ID NOs: 2-24 and/or a VL region comprising a CDR3 comprising a sequence having at least 90% sequence identity with anyone of SEQ ID NOs: 25-47. In one embodiment, the antibody or fragment thereof comprises a VH region comprising a CDR3 consisting of a sequence having at least 90% sequence identity with any one of SEQ ID NOs: 2-24 and/or a VL region comprising a CDR3 consisting of a sequence having at least 90% sequence identity with any one of SEQ ID NOs: 25-47.
[0236] In one embodiment, the antibody or fragment thereof comprises a VH region comprising a CDR3 comprising a sequence having at least 95% sequence identity with any one of SEQ ID NOs: 2-24 and/or a VL region comprising a CDR3 comprising a sequence having at least 95% sequence identity with any one of SEQ ID NOs: 25-47. In one embodiment, the antibody or fragment thereof comprises a VH region comprising a CDR3 consisting of a sequence having at least 95% sequence identity with any one of SEQ ID NOs: 2-24 and/or a VL region comprising a CDR3 consisting of a sequence having at least 95% sequence identity with any one of SEQ ID NOs: 25-47.
[0237] In one embodiment, the antibody or fragment thereof comprises a VH region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-24 and a VL region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 25-47. In one embodiment, the antibody or fragment thereof comprises a VH region comprising a CDR3 consisting of a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-24 and a VL region comprising a CDR3 consisting of a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 25-47.
[0238] Embodiments which refer herein to “at least 80%” or “80% or greater”, will be understood to include all values equal to or greater than 80%, such as 85%, 90%, 95%, 97%, 98%, 99% or 100% sequence identity. In one embodiment, the antibody or fragment comprises at least 85%, such as at least 90%, at least 95%, at least 97%, at least 98% or at least 99% sequence identity to the specified sequence.
[0239] Instead of percentage sequence identity, the embodiments may also be defined with one or more amino acid changes, for examples one or more additions, substitutions and/or deletions. In one embodiment, the sequence may comprise up to five amino acid changes, such as up to three amino acid changes, in particular up to two amino acid changes. For example, the sequence may comprise up to five amino acid substitutions, such as up to three amino acid substitutions, in particular up to one or two amino acid substitutions. For example, CDR3 of the antibody or fragment thereof may comprise or more suitably consist of a sequence having no more than 2, more suitably no more than 1 substitution(s) compared to any one of SEQ ID NOs: 2-47.
[0240] Suitably any residues of CDR1, CDR2 or CDR3 differing from their corresponding residues in SEQ ID NO: 2-116 and SEQUENCES: A1-A23 are conservative substitutions with respect to their corresponding residues. For example, any residues of CDR3 differing from their corresponding residues in SEQ ID NOs: 2-47 are conservative substitutions with respect to their corresponding residues.
[0241] In one embodiment, the antibody or fragment thereof comprises: [0242] (i) a VH region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-24; [0243] (ii) a VH region comprising a CDR2 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 48-70; [0244] (iii) a VH region comprising a CDR1 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 71-93; [0245] (iv) a VL region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 25-47; [0246] (v) a VL region comprising a CDR2 comprising a sequence having at least 80% sequence identity with any one of SEQUENCES: A1-A23 (of
[0248] In one embodiment, the antibody or fragment thereof comprises a heavy chain with: [0249] (i) a VH region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-24; [0250] (ii) a VH region comprising a CDR2 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 48-70; and [0251] (iii) a VH region comprising a CDR1 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 71-93.
[0252] In one embodiment, the antibody or fragment thereof comprises a light chain with: [0253] (i) a VL region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 25-47; [0254] (ii) a VL region comprising a CDR2 comprising a sequence having at least 80% sequence identity with any one of SEQUENCES: A1-A23 (of
[0256] In one embodiment, the antibody or fragment thereof comprises (or consists of) a VH region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-24, such as SEQ ID NOs: 10, 4, 14, 15, 17, 19 or 23. In one embodiment, the antibody or fragment thereof comprises (or consists of) a VH region comprising a CDR2 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 48-70, such as SEQ ID NOs: 56, 50, 60, 61, 63, 65 or 69. In one embodiment, the antibody or fragment thereof comprises (or consists of) a VH region comprising a CDR1 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 71-93, such as SEQ ID NOs: 79, 73, 83, 84, 86, 88 or 92.
[0257] In one embodiment, the VH region comprises a CDR3 comprising a sequence of SEQ ID NO: 10, a CDR2 comprising a sequence of SEQ ID NO: 56, and a CDR1 comprising a sequence of SEQ ID NO: 79. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 10, the CDR2 consists of a sequence of SEQ ID NO: 56, and the CDR1 consists of a sequence of SEQ ID NO: 79.
[0258] In one embodiment, the VH region comprises a CDR3 comprising a sequence of SEQ ID NO: 4, a CDR2 comprising a sequence of SEQ ID NO: 50, and a CDR1 comprising a sequence of SEQ ID NO: 73. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 4, the CDR2 consists of a sequence of SEQ ID NO: 50, and the CDR1 consists of a sequence of SEQ ID NO: 73.
[0259] In one embodiment, the VH region comprises a CDR3 comprising a sequence of SEQ ID NO: 14, a CDR2 comprising a sequence of SEQ ID NO: 60, and a CDR1 comprising a sequence of SEQ ID NO: 83. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 14, the CDR2 consists of a sequence of SEQ ID NO: 60, and the CDR1 consists of a sequence of SEQ ID NO: 83.
[0260] In one embodiment, the VH region comprises a CDR3 comprising a sequence of SEQ ID NO: 15, a CDR2 comprising a sequence of SEQ ID NO: 61, and a CDR1 comprising a sequence of SEQ ID NO: 84. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 15, the CDR2 consists of a sequence of SEQ ID NO: 61, and the CDR1 consists of a sequence of SEQ ID NO: 84.
[0261] In one embodiment, the VH region comprises a CDR3 comprising a sequence of SEQ ID NO: 17, a CDR2 comprising a sequence of SEQ ID NO: 63, and a CDR1 comprising a sequence of SEQ ID NO: 86. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 17, the CDR2 consists of a sequence of SEQ ID NO: 63, and the CDR1 consists of a sequence of SEQ ID NO: 86.
[0262] In one embodiment, the VH region comprises a CDR3 comprising a sequence of SEQ ID NO: 19, a CDR2 comprising a sequence of SEQ ID NO: 65, and a CDR1 comprising a sequence of SEQ ID NO: 88. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 19, the CDR2 consists of a sequence of SEQ ID NO: 65, and the CDR1 consists of a sequence of SEQ ID NO: 88.
[0263] In one embodiment, the VH region comprises a CDR3 comprising a sequence of SEQ ID NO: 23, a CDR2 comprising a sequence of SEQ ID NO: 69, and a CDR1 comprising a sequence of SEQ ID NO: 92. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 23, the CDR2 consists of a sequence of SEQ ID NO: 69, and the CDR1 consists of a sequence of SEQ ID NO: 92.
[0264] In one embodiment, the antibody or fragment thereof comprises (or consists of) a VL region comprising a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 25-47, such as SEQ ID NOs: 33, 27, 37, 38, 40, 42 or 46. In one embodiment, the antibody or fragment thereof comprises (or consists of) a VL region comprising a CDR2 comprising a sequence having at least 80% sequence identity with any one of SEQUENCES: A1-A23 (of
[0265] In one embodiment, the VL region comprises a CDR3 comprising a sequence of SEQ ID NO: 33, a CDR2 comprising a sequence of SEQUENCE: A9, and a CDR1 comprising a sequence of SEQ ID NO: 102. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 33, the CDR2 consists of a sequence of SEQUENCE: A9, and the CDR1 consists of a sequence of SEQ ID NO: 102.
[0266] In one embodiment, the VL region comprises a CDR3 comprising a sequence of SEQ ID NO: 27, a CDR2 comprising a sequence of SEQUENCE: A3, and a CDR1 comprising a sequence of SEQ ID NO: 96. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 27, the CDR2 consists of a sequence of SEQUENCE: A3, and the CDR1 consists of a sequence of SEQ ID NO: 96.
[0267] In one embodiment, the VL region comprises a CDR3 comprising a sequence of SEQ ID NO: 37, a CDR2 comprising a sequence of SEQUENCE: A13, and a CDR1 comprising a sequence of SEQ ID NO: 106. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 37, the CDR2 consists of a sequence of SEQUENCE: A13, and the CDR1 consists of a sequence of SEQ ID NO: 106.
[0268] In one embodiment, the VL region comprises a CDR3 comprising a sequence of SEQ ID NO: 38, a CDR2 comprising a sequence of SEQUENCE: A14, and a CDR1 comprising a sequence of SEQ ID NO: 107. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 38, the CDR2 consists of a sequence of SEQUENCE: A14, and the CDR1 consists of a sequence of SEQ ID NO: 107.
[0269] In one embodiment, the VL region comprises a CDR3 comprising a sequence of SEQ ID NO: 40, a CDR2 comprising a sequence of SEQUENCE: A16, and a CDR1 comprising a sequence of SEQ ID NO: 109. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 40, the CDR2 consists of a sequence of SEQUENCE: A16, and the CDR1 consists of a sequence of SEQ ID NO: 109.
[0270] In one embodiment, the VL region comprises a CDR3 comprising a sequence of SEQ ID NO: 42, a CDR2 comprising a sequence of SEQUENCE: A18, and a CDR1 comprising a sequence of SEQ ID NO: 111. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 42, the CDR2 consists of a sequence of SEQUENCE: A18, and the CDR1 consists of a sequence of SEQ ID NO: 111.
[0271] In one embodiment, the VL region comprises a CDR3 comprising a sequence of SEQ ID NO: 46, a CDR2 comprising a sequence of SEQUENCE: A22, and a CDR1 comprising a sequence of SEQ ID NO: 115. In one embodiment, the CDR3 consists of a sequence of SEQ ID NO: 46, the CDR2 consists of a sequence of SEQUENCE: A22, and the CDR1 consists of a sequence of SEQ ID NO: 115.
[0272] In one embodiment, the antibody or fragment thereof comprises one or more CDR sequences as described in
[0273] Thus, the anti-Vγ4 antibody or fragment thereof may comprise one or more of: [0274] (a) a VH comprising a HCDR1 having SEQ ID NO: 79, a HCDR2 having SEQ ID NO: 56 and a HCDR3 having SEQ ID NO: 10, optionally wherein the VH comprises or consists of SEQ ID NO: 125; and [0275] a VL comprising a LCDR1 having SEQ ID NO: 102, a LCDR2 having SEQUENCE A9 (of
[0320] Suitably the VH and VL regions recited above each comprise four framework regions (FR1-FR4). In one embodiment, the antibody or fragment thereof comprises a framework region (e.g. FR1, FR2, FR3 and/or FR4) comprising a sequence having at least 80% sequence identity with the framework region in any one of SEQ ID NOs: 117-162. In one embodiment, the antibody or fragment thereof comprises a framework region (e.g. FR1, FR2, FR3 and/or FR4) comprising a sequence having at least 90%, such as at least 95%, 97% or 99% sequence identity with the framework region in any one of SEQ ID NOs: 117-162. In one embodiment, the antibody or fragment thereof comprises a framework region (e.g. FR1, FR2, FR3 and/or FR4) comprising a sequence in any one of SEQ ID NOs: 117-162. In one embodiment, the antibody or fragment thereof comprises a framework region (e.g. FR1, FR2, FR3 and/or FR4) consisting of a sequence in any one of SEQ ID NOs: 117-162.
[0321] The antibodies described herein may be defined by their full light chain and/or heavy chain variable sequences. Therefore, in one embodiment, the anti-Vγ4 antibody or fragment thereof comprises an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 117-162. In one embodiment, the anti-Vγ4 antibody or fragment thereof consists of an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 117-162.
[0322] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 117-139. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 117-139. In a further embodiment, the VH region comprises an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 125, 119, 129, 130, 132, 134 or 138. In a further embodiment, the VH region consists of an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 125, 119, 129, 130, 132, 134 or 138.
[0323] In one embodiment, the antibody or fragment thereof comprises a VL region comprising an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 140-162. In one embodiment, the antibody or fragment thereof comprises a VL region consisting of an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 140-162. In a further embodiment, the VL region comprises an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 148, 142, 152, 153, 155, 157 or 161. In a further embodiment, the VL region consists of an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 148, 142, 152, 153, 155, 157 or 161.
[0324] In a further embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 117-139 and a VL region comprising an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 140-162. In a further embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 117-139 and a VL region consisting of an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 140-162.
[0325] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 125 (1140_P01_G08) [G4_12]. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 125. In one embodiment, the antibody or fragment thereof comprises a VL region comprising an amino acid sequence of SEQ ID NO: 148 (1140_P01_G08) [G4_12]. In one embodiment, the antibody or fragment thereof comprises a VL region consisting of an amino acid sequence of SEQ ID NO: 148.
[0326] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 125 and a VL region comprising an amino acid sequence of SEQ ID NO: 148. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 125 and a VL region consisting of an amino acid sequence of SEQ ID NO: 148.
[0327] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 119 (1139_P01_A04) [G4_3]. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 119. In one embodiment, the antibody or fragment thereof comprises a VL region comprising an amino acid sequence of SEQ ID NO: 142 (1139_P01_A04) [G4_3]. In one embodiment, the antibody or fragment thereof comprises a VL region consisting of an amino acid sequence of SEQ ID NO: 142.
[0328] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 119 and a VL region comprising an amino acid sequence of SEQ ID NO: 142. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 119 and a VL region consisting of an amino acid sequence of SEQ ID NO: 142.
[0329] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 129 (1248_P02_D10) [G4_16]. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 129. In one embodiment, the antibody or fragment thereof comprises a VL region comprising an amino acid sequence of SEQ ID NO: 152 (1248_P02_D10) [G4_16]. In one embodiment, the antibody or fragment thereof comprises a VL region consisting of an amino acid sequence of SEQ ID NO: 152.
[0330] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 129 and a VL region comprising an amino acid sequence of SEQ ID NO: 152. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 129 and a VL region consisting of an amino acid sequence of SEQ ID NO: 152.
[0331] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 130 (1254_P01_H04) [G4_18]. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 130. In one embodiment, the antibody or fragment thereof comprises a VL region comprising an amino acid sequence of SEQ ID NO: 153 (1254_P01_H04) [G4_18]. In one embodiment, the antibody or fragment thereof comprises a VL region consisting of an amino acid sequence of SEQ ID NO: 153.
[0332] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 130 and a VL region comprising an amino acid sequence of SEQ ID NO: 153. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 130 and a VL region consisting of an amino acid sequence of SEQ ID NO: 153.
[0333] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 132 (1254_P02_G02) [G4_20]. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 132. In one embodiment, the antibody or fragment thereof comprises a VL region comprising an amino acid sequence of SEQ ID NO: 155 (1254_P02_G02) [G4_20]. In one embodiment, the antibody or fragment thereof comprises a VL region consisting of an amino acid sequence of SEQ ID NO: 155.
[0334] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 132 and a VL region comprising an amino acid sequence of SEQ ID NO: 155. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 132 and a VL region consisting of an amino acid sequence of SEQ ID NO: 155.
[0335] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 134 (1253_P03_H05) [G4_23]. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 134. In one embodiment, the antibody or fragment thereof comprises a VL region comprising an amino acid sequence of SEQ ID NO: 157 (1253_P03_H05) [G4_23]. In one embodiment, the antibody or fragment thereof comprises a VL region consisting of an amino acid sequence of SEQ ID NO: 157.
[0336] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 134 and a VL region comprising an amino acid sequence of SEQ ID NO: 157. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 134 and a VL region consisting of an amino acid sequence of SEQ ID NO: 157.
[0337] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 138 (1248_P02_C10) [G4_27]. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 138. In one embodiment, the antibody or fragment thereof comprises a VL region comprising an amino acid sequence of SEQ ID NO: 161 (1248_P02_C10) [G4_27]. In one embodiment, the antibody or fragment thereof comprises a VL region consisting of an amino acid sequence of SEQ ID NO: 161.
[0338] In one embodiment, the antibody or fragment thereof comprises a VH region comprising an amino acid sequence of SEQ ID NO: 138 and a VL region comprising an amino acid sequence of SEQ ID NO: 161. In one embodiment, the antibody or fragment thereof comprises a VH region consisting of an amino acid sequence of SEQ ID NO: 138 and a VL region consisting of an amino acid sequence of SEQ ID NO: 161.
[0339] For fragments comprising both the VH and VL regions, these may be associated either covalently (e.g. via disulphide bonds or a linker) or non-covalently. The antibody fragment described herein may comprise an scFv, i.e. a fragment comprising a VH region and a VL region joined by a linker. In one embodiment, the VH and VL region are joined by a (e.g. synthetic) polypeptide linker. The polypeptide linker may comprise a (Gly.sub.4Ser).sub.n linker, where n = from 1 to 8, e.g. 2, 3, 4, 5 or 7. The polypeptide linker may comprise a [(Gly.sub.4Ser).sub.n(Gly.sub.3AlaSer).sub.m].sub.P linker, where n = from 1 to 8, e.g. 2, 3, 4, 5 or 7, m = from 0 to 8, e.g. 0, 1, 2 or 3, and p = from 1 to 8, e.g. 1, 2 or 3. In a further embodiment, the linker comprises SEQ ID NO: 186. In a further embodiment, the linker consists of SEQ ID NO: 186.
[0340] In one embodiment, the antibody or fragment thereof comprises an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 163-185. In a further embodiment, the antibody or fragment thereof comprises an amino acid sequence of any one of SEQ ID NOs: 163-185. In a yet further embodiment, the antibody or fragment thereof comprises an amino acid sequence of SEQ ID NOs: 171, 165, 175, 176, 178, 180 or 184.
[0341] In one embodiment, the antibody or fragment thereof consists of an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 163-185. In a further embodiment, the antibody or fragment thereof consists of an amino acid sequence of any one of SEQ ID NOs: 163-185. In a yet further embodiment, the antibody or fragment thereof consists of an amino acid sequence of SEQ ID NOs: 171, 165, 175, 176, 178, 180 or 184.
[0342] As described herein, the antibodies may be in any format. In a preferred embodiment, the antibody is in an IgG1 format. Therefore, in one embodiment, the antibody or fragment thereof comprises an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 233-255. In a further embodiment, the antibody or fragment thereof comprises an amino acid sequence of any one of SEQ ID NOs: 233-255. In a yet further embodiment, the antibody or fragment thereof comprises an amino acid sequence of SEQ ID NOs: 235, 241, 245, 246 or 254.
[0343] In one embodiment, the antibody or fragment thereof consists of an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 233-255. In a further embodiment, the antibody or fragment thereof consists of an amino acid sequence of any one of SEQ ID NOs: 233-255. In a yet further embodiment, the antibody or fragment thereof consists of an amino acid sequence of SEQ ID NOs: 235, 241, 245, 246 or 254.
[0344] Alternatively, there is provided an antibody or fragment thereof which comprises or consists of a heavy chain amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 284-306 and/or a light chain amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 307-329. Thus, there is provided an antibody or fragment thereof which comprises or consists of a heavy chain amino acid sequence according to any one of SEQ ID NOs: 284-306 and/or a light chain amino acid sequence according to any one of SEQ ID NOs: 307-329. In a particular embodiment, the antibody or fragment thereof comprises or consists of a heavy chain amino acid sequence according to SEQ ID NO: 292 and a light chain amino acid sequence according to SEQ ID NO: 315 (clone G4_12). In a further embodiment, the antibody or fragment thereof comprises or consists of a heavy chain amino acid sequence according to SEQ ID NO: 286 and a light chain amino acid sequence according to SEQ ID NO: 309 (clone G4_3). In a further embodiment, the antibody or fragment thereof comprises or consists of a heavy chain amino acid sequence according to SEQ ID NO: 296 and a light chain amino acid sequence according to SEQ ID NO: 319 (clone G4_16). In a further embodiment, the antibody or fragment thereof comprises or consists of a heavy chain amino acid sequence according to SEQ ID NO: 297 and a light chain amino acid sequence according to SEQ ID NO: 320 (clone G4_18). In a further embodiment, the antibody or fragment thereof comprises or consists of a heavy chain amino acid sequence according to SEQ ID NO: 299 and a light chain amino acid sequence according to SEQ ID NO: 322 (clone G4_20). In a further embodiment, the antibody or fragment thereof comprises or consists of a heavy chain amino acid sequence according to SEQ ID NO: 301 and a light chain amino acid sequence according to SEQ ID NO: 324 (clone G4_23). In a further embodiment, the antibody or fragment thereof comprises or consists of a heavy chain amino acid sequence according to SEQ ID NO: 305 and a light chain amino acid sequence according to SEQ ID NO: 328 (clone G4_27). In other embodiments, the antibody or fragment thereof comprises or consists of: [0345] (a) a heavy chain amino acid sequence according to SEQ ID NO: 284 and a light chain amino acid sequence according to SEQ ID NO: 307 (clone G4_1); [0346] (b) a heavy chain amino acid sequence according to SEQ ID NO: 285 and a light chain amino acid sequence according to SEQ ID NO: 308 (clone G4_2); [0347] (c) a heavy chain amino acid sequence according to SEQ ID NO: 287 and a light chain amino acid sequence according to SEQ ID NO: 310 (clone G4_4); [0348] (d) a heavy chain amino acid sequence according to SEQ ID NO: 288 and a light chain amino acid sequence according to SEQ ID NO: 311 (clone G4_5); [0349] (e) a heavy chain amino acid sequence according to SEQ ID NO: 289 and a light chain amino acid sequence according to SEQ ID NO: 312 (clone G4_6); [0350] (f) a heavy chain amino acid sequence according to SEQ ID NO: 290 and a light chain amino acid sequence according to SEQ ID NO: 313 (clone G4_7); [0351] (g) a heavy chain amino acid sequence according to SEQ ID NO: 291 and a light chain amino acid sequence according to SEQ ID NO: 314 (clone G4_10); [0352] (h) a heavy chain amino acid sequence according to SEQ ID NO: 293 and a light chain amino acid sequence according to SEQ ID NO: 316 (clone G4_13); [0353] (i) a heavy chain amino acid sequence according to SEQ ID NO: 294 and a light chain amino acid sequence according to SEQ ID NO: 317 (clone G4_14); [0354] (j) a heavy chain amino acid sequence according to SEQ ID NO: 295 and a light chain amino acid sequence according to SEQ ID NO: 318 (clone G4_15); [0355] (k) a heavy chain amino acid sequence according to SEQ ID NO: 298 and a light chain amino acid sequence according to SEQ ID NO: 321 (clone G4_19); [0356] (I) a heavy chain amino acid sequence according to SEQ ID NO: 300 and a light chain amino acid sequence according to SEQ ID NO: 323 (clone G4_22); [0357] (m) a heavy chain amino acid sequence according to SEQ ID NO: 302 and a light chain amino acid sequence according to SEQ ID NO: 325 (clone G4_24); [0358] (n) a heavy chain amino acid sequence according to SEQ ID NO: 303 and a light chain amino acid sequence according to SEQ ID NO: 326 (clone G4_25); [0359] (o) a heavy chain amino acid sequence according to SEQ ID NO: 304 and a light chain amino acid sequence according to SEQ ID NO: 327 (clone G4_26); or [0360] (p) a heavy chain amino acid sequence according to SEQ ID NO: 306 and a light chain amino acid sequence according to SEQ ID NO: 329 (clone G4_28).
Competing Antibodies
[0361] In one embodiment, the antibody or fragment thereof which specifically binds to a Vγ4 chain of a γδ TCR and not to a Vγ2 chain of a γδ TCR binds to the same, or essentially the same, epitope as, or competes with, an antibody or fragment thereof as defined or exemplified herein. One can easily determine whether an antibody binds to the same epitope as, or competes for binding with, a reference anti-Vγ4 antibody by using routine methods known in the art. For example, to determine if a test antibody binds to the same epitope as a reference anti-Vγ4 antibody described herein, the reference antibody is allowed to bind to a Vγ4 protein or peptide under saturating conditions. Next, the ability of a test antibody to bind to the Vγ4 chain is assessed. If the test antibody is able to bind to Vγ4 following saturation binding with the reference anti-Vγ4 antibody, it can be concluded that the test antibody binds to a different epitope than the reference anti-Vγ4 antibody. On the other hand, if the test antibody is not able to bind to the Vγ4 chain following saturation binding with the reference anti-Vγ4 antibody, then the test antibody may bind to the same epitope as the epitope bound by the reference anti-Vγ4 antibody.
[0362] The present disclosure also includes anti-Vγ4 antibodies or fragments thereof that compete for binding to Vγ4 with an antibody or fragment thereof as defined herein, or an antibody having the CDR sequences of any of the exemplary antibodies described herein. For example, competitive assays can be performed with the antibodies described herein in order to determine what proteins, antibodies, and other antagonists compete for binding to the Vγ4 chain with the antibody and/or share the epitope. These assays are readily known to those of skill in the art; they evaluate competition between antagonists or ligands for a limited number of binding sites on a protein, e.g., Vγ4. The antibody (or fragment thereof) is immobilized or insolubilized before or after the competition and the sample bound to the Vγ4 chain is separated from the unbound sample, for example, by decanting (where the antibody was pre-insolubilized) or by centrifuging (where the antibody was precipitated after the competitive reaction). Also, the competitive binding may be determined by whether the function is altered by the binding or lack of binding of the antibody to the protein, e.g., whether the antibody molecule inhibits or potentiates the enzymatic activity of, for example, a label. ELISA and other functional assays may be used, as known in the art and described herein.
[0363] Two antibodies bind to the same or overlapping epitope if each competitively inhibits (blocks) binding of the other to the target antigen. That is, a 1-, 5-, 10-, 20- or 100-fold or more excess of one antibody inhibits binding of the other by at least 50% but preferably 75%, 90% or even 99% as measured in a competitive binding assay. Alternatively, two antibodies have the same epitope if essentially all amino acid mutations in the target antigen that reduce or eliminate binding of one antibody also reduce or eliminate binding of the other.
[0364] Additional routine experimentation (e.g., peptide mutation and binding analyses) can then be carried out to confirm whether the observed lack of binding of the test antibody is in fact due to binding to the same epitope as the reference antibody or if steric blocking (or another phenomenon) is responsible for the lack of observed binding. Experiments of this sort can be performed using ELISA, RIA, surface plasmon resonance, flow cytometry or any other quantitative or qualitative antibody-binding assay available in the art.
Antibody Sequence Modifications
[0365] The antibodies and fragments thereof may be modified using known methods. Sequence modifications to antibody molecules described herein can be readily incorporate by those skilled in the art. The following examples are non-limiting.
[0366] During antibody discovery and sequence recovery from phage libraries, desired antibody variable domains may be re-formatted into full length IgG by sub-cloning. To accelerate the process, variable domains are often transferred using restriction enzymes. These restriction sites may introduce additional/alternate amino acids and away from the canonical sequence (such canonical sequences may be found, for example, in the international ImMunoGeneTics [IMGT] information system, see http://www.imgt.org). These may be introduced as kappa or lambda light chain sequence modifications.
Kappa Light Chain Modifications
[0367] The kappa light chain variable sequences may be cloned using restriction sites (e.g. Nhe1-Not1) during re-formatting into full length IgG. More specifically, at the kappa light chain N-terminus, an additional Ala-Ser sequence was introduced to support cloning. Preferably, this additional AS sequence is then removed during further development such to generate the canonical N-terminal sequence. Hence, in one embodiment, kappa light chain containing antibodies described herein do not contain an AS sequence at their N-termini, i.e. SEQ ID NOs: 140-147 and 156-158 do not comprise the initial AS sequence. It will be understood that this embodiment also applies to other sequences included herein which contain this sequence.
[0368] Additional amino acid changes may be made to support cloning. For example, for the antibodies described herein, at the kappa light-chain variable-domain/constant domain border a valine-to-alanine change was introduced to support cloning when preparing full-length sequences. This resulted in a kappa constant domain modification. Specifically this results in the constant domain beginning RTAAAPS (from a Notl restriction site). Preferably, this sequence can be modified during further development to generate the canonical kappa light-chain constant regions which start with RTVAAPS. Such modifications do not change the functional properties of the antibodies. Hence, in one embodiment kappa light chain containing antibodies described herein contain a constant domain starting with the sequence RTV. Therefore, in one embodiment, sequence RTAAAPS of SEQ ID NOs: 233-240, 249-251, 307-314 and 323-325 is replaced with sequence RTVAAPS. In a preferred embodiment comprising a preferred kappa light chain constant domain allotype, the kappa light chain constant domain has an amino acid sequence according to SEQ ID NO: 330 and may be combined with any light chain variable domain disclosed herein.
Lambda Light Chain Modifications
[0369] Similar to the kappa example above, the lambda light chain variable domains may also be cloned by introducing restriction sites (e.g. Nhe1-Not1) during re-formatting into full length IgG. More specifically, at the lambda light chain N-terminus, an additional Ala-Ser sequence may be introduced to support cloning. Preferably, this additional AS sequence is then removed during further development such to generate the canonical N-terminal sequence. Hence, in one embodiment, lambda light chain containing antibodies described herein do not contain an AS sequence at their N-termini i.e. SEQ ID NOs: 148-155 and 159-162 do not comprise the initial AS sequence. It will be understood that this embodiment also applies to other sequences included herein which contain this sequence.
[0370] As another example, for the antibodies described herein at the lambda light-chain variable-domain/constant domain border a lysine-to-alanine sequence change was introduced to support cloning when preparing full-length sequences. This resulted in a lambda constant domain modification. Specifically this results in the constant domain beginning with GQPAAAPS (from a Notl restriction site). Preferably, this sequence can be modified during further development such to generate the canonical lambda light constant region which starts GQPKAAPS. Such modifications do not change the functional properties of the antibodies. Hence, in one embodiment, lambda light chain containing antibodies described herein contain a constant domain starting with the sequence GQPK. Therefore, in one embodiment, sequence GQPAAAPS of SEQ ID NOs: 241-248, 252-255, 315-322 and 326-329 is replaced with sequence GQPKAAPS. In a preferred embodiment comprising a preferred lambda light chain constant domain allotype, the lambda light chain constant domain has an amino acid sequence according to SEQ ID NO: 331 and may be combined with any light chain variable domain disclosed herein.
Lambda and Kappa Light Chain Modifications
[0371] In view of the above disclosure regarding removal of the N-terminal AS residues from the lambda and/or kappa light chain variable domains disclosed herein as SEQ ID Nos: 140-162, the anti-Vγ4 antibody or fragment may comprise a light chain variable (VL) amino acid sequence according to any one of SEQ ID NOs: 261-283, which correspond to SEQ ID NOs: 140-162 lacking the N-terminal AS residues. Therefore, any reference in this specification to a VL amino acid sequence according to one or more of SEQ ID NOs: 140-162 may be substituted with a VL amino acid sequence according to SEQ ID NOs: 261-283 respectively, and all such embodiments are hereby disclosed. By way of illustration, reference herein to a light chain variable domain according to SEQ ID NO: 148 (derived from clone G4_12) may be substituted with reference to SEQ ID NO: 269.
Heavy Chain Modifications
[0372] Typically, human variable heavy chain sequences start with either the basic glutamine (Q) or acidic glutamate (E). However both such sequences are then known to convert to the acidic amino acid residue, pyro-glutamate (pE). The Q to pE conversion results in a charge change to the antibody, whilst a E to pE conversion does not change the charge of the antibody. Hence, to avoid a variable charge-change overtime, one option is to modify a starting heavy chain sequence from Q to E in the first instance. Hence, in one embodiment, the heavy chain of antibody described herein having a Q residue at the N-terminus of the heavy chain may contain a Q to E modification at the N-terminus. In particular, the initial residue of any of SEQ ID NOs: 118, 120, 124, 126, 132, 133, 135, 137, 138 and/or 139 may be modified from Q to E. It will be understood that this embodiment also applies to other sequences included herein which contain this sequence (i.e. any embodiment incorporating these sequences, for example into full-length antibodies or fragments thereof). In some embodiments, it may be advantageous to substitute an E residue at the N-terminus of the heavy chain to a Q residue. Accordingly, in some embodiments, the E residue at the N-terminus of any one SEQ ID NOs: 117, 119, 121-123, 125, 127-131, 134 and/or 136 may be substituted with a Q residue.
[0373] Furthermore, the C-terminus of the IgG1 constant domain ends with PGK. However the terminal basic lysine (K) is then often cleaved during expression (e.g. in CHO cells). This in turn results in a charge change to the antibody through varied loss of the C-terminal lysine residue. Therefore, one option is to remove the lysine in the first instance resulting in a uniform and consistent heavy chain C-terminus sequence ending in PG. Hence, in one embodiment, the heavy chain of an antibody described herein has the terminal K removed from its C-terminus. In particular, the antibody may comprise any one of SEQ ID NOs: 233-255 or 284-306 where the terminal lysine residue has been removed.
Optional Allotype Modifications
[0374] During antibody discovery, specific human allotypes may be employed. Optionally, the antibodies can be switched to differing human allotypes during development. By way of non-limiting example, for the kappa chain there are three human allotypes designated Km1, Km1,2 and Km3 which define three Km alleles (using allotype numbering): Km1 correlates with valine153 (IMGT V45.1) and leucine 191 (IMGT L101); Km1,2 correlates with alanine 153 (IMGT A45.1) and leucine 191 (IMGT L101); and Km3 correlates with alanine 153 (IMGT A45.1) and valine 191 (IMGT V101). Optionally, one can therefore modify a sequence from one allotype to another by standard cloning approaches. For example a L191V (IMGT L101V) change will convert a Km1,2 allotype to a Km3 allotype. For further reference on such allotypes see Jefferis and Lefranc (2009) MAbs 1 (4):332-8, which is herein incorporated by reference.
[0375] Hence in one embodiment an antibody described herein contains amino acid substitutions derived from another human allotype of the same gene. In a further embodiment, the antibody contains a L191V (IMGT L101V) substitution to the kappa chain to convert the c-domain from a km1,2 to a km3 allotype.
[0376] In a preferred embodiment comprising a preferred kappa light chain constant domain allotype, the kappa light chain constant domain has an amino acid sequence according to SEQ ID NO: 330 and may be combined with any light chain variable domain disclosed herein. In an alternative preferred embodiment comprising a preferred lambda light chain constant domain allotype, the lambda light chain constant domain has an amino acid sequence according to SEQ ID NO: 331 and may be combined with any light chain variable domain disclosed herein.
Antibody Binding
[0377] The antibody or fragment thereof may bind to the Vγ4 chain of a γδ TCR with a binding affinity (KD) as measured by surface plasmon resonance of less than 3.0 × 10.sup.-7 M (i.e. 300 nM) or less than 1.5 × 10.sup.-7 M (i.e. 150 nM). In a further embodiment, the KD is 1.3 × 10.sup.-7 M (i.e. 130 nM) or less, such as 1.0 × 10.sup.-7 M (i.e. 100 nM) or less. In a yet further embodiment, the KD is less than 6.0 × 10.sup.-8 M (i.e. 60 nM), such as less than 5.0 × 10.sup.-8 M (i.e. 50 nM), less than 4.0 × 10.sup.-8 M (i.e. 40 nM), less than 3.0 × 10.sup.-8 M (i.e. 30 nM) or less than 2.0 × 10.sup.-8 M (i.e. 20 nM). In further embodiments, the KD may be 1.0 × 10.sup.-8 M (i.e. 10 nM) or less, such as 5.0 × 10.sup.-9 M (i.e. 5 nM) or less, 4.0 × 10.sup.-9 M (i.e. 4 nM) or less, 3.0 × 10.sup.-9 M (i.e. 3 nM) or less, 2.0 × 10.sup.-9 M (i.e. 2 nM) or less, or 1.0 × 10.sup.-9 M (i.e. 1 nM) or less. For example, in one embodiment the (e.g. human) anti-Vγ4 antibody binds to the Vγ4 chain of a γδ TCR with a binding affinity (KD) as measured by surface plasmon resonance of less than 1.5 × 10.sup.-7 M (i.e. 150 nM).
[0378] In one embodiment, the antibody or fragment thereof which binds to the Vγ4 chain of a γδ TCR with a binding affinity (KD) as measured by surface plasmon resonance of less than 4.0 × 10.sup.-8 M (i.e. 40 nM), less than 3.0 × 10.sup.-8 M (i.e. 30 nM) or less than 2.0 × 10.sup.-8 M (i.e. 20 nM).
[0379] In one embodiment, the binding affinity of the antibody or fragment thereof is established by coating the antibody or fragment thereof directly or indirectly (e.g. by capture with an anti-human IgG Fc) onto the surface of a sensor (e.g. an amine high capacity chip or equivalent), wherein the target bound by the antibody or fragment thereof (i.e. the Vγ4 chain of a γδ TCR) is flowed over the chip to detect binding. In alternative embodiments, the antigen may be directly or indirectly coated onto the surface of the sensor, over which test antibody or a fragment thereof is then flowed. The skilled person is well able to determine suitable test conditions. For example, suitably, a MASS-2 instrument (which may also be referred to as Sierra SPR-32) may be used at 25° C. in PBS + 0.02 % Tween 20 running buffer at 30 .Math.l/min. In other suitable embodiments, a Reichert 4SPR instrument may be used at room temperature (e.g. 25° C.) in PBS + 0.05 % Tween 20 with a flowrate of 25 .Math.l/min.
Antibody Functional Characterisation
[0380] Described herein are assays which may be used to define antibody function. For example, the antibody or fragment thereof described herein may be assessed by γδ TCR engagement, e.g. measuring downregulation of the γδ TCR upon antibody binding and/or upregulation of CD69 surface expression upon antibody binding. Surface expression of the γδ TCR or CD69 following application of the antibody or fragment thereof (optionally presented on the surface of a cell) can be measured, e.g. by flow cytometry.
[0381] The antibody or fragment thereof described herein may also be assessed by measuring γδ T cell degranulation. For example, expression of CD107a, a marker for cell degranulation, can be measured following application of the antibody or fragment thereof (optionally presented on the surface of a cell) to γδ T cells, e.g. by flow cytometry. The antibody or fragment thereof described herein may also be assessed by measuring γδ T cell-mediated killing activity (to test if the antibody has an effect on the killing activity of the γδ T cell i.e. the ability of the antibody to induce the γδ T cell to directly or indirectly kill target cells). For example, target cells may be incubated with γδ T cells in the presence of the antibody or fragment thereof (optionally presented on the surface of a cell). Following incubation, the culture may be stained with a cell viability dye to distinguish between live and dead target cells. The proportion of dead cells can then be measured, e.g. by flow cytometry.
[0382] As described herein, the antibodies or fragments thereof used in the assays may be presented on a surface, for example the surface of a cell, such as a cell comprising an Fc receptor. For example, the antibodies or fragments thereof may be presented on the surface of THP-1 cells, such as TIB-202™ cells (available from American Type Culture Collection (ATCC)). Alternatively, the antibodies or fragments thereof may be used directly in the assays.
[0383] In such functional assays, output may be measured by calculating the half maximal concentration, also referred to as “EC50” or “effective concentration at 50 percent”. The term “IC50” refers to the inhibitory concentration. Both EC50 and IC50 may be measured using methods known in the art, such as flow cytometry methods. For the avoidance of doubt, the values of EC50 in the present application are provided using IgG1 formatted antibody. Such values can be easily converted based on the molecular weight of the antibody format for equivalent values as follows:
[0384] Millilitres may be denoted as “ml” or “mL” herein and used interchangeably.
[0385] The EC50 for downregulation of the γδ TCR upon antibody (or fragment) binding may be less than 0.5 .Math.g/ml, such as less than 0.4 .Math.g/ml, 0.3 .Math.g/ml, 0.2 .Math.g/ml, 0.15 .Math.g/ml, 0.1 .Math.g/ml or 0.05 .Math.g/ml. In particular, said EC50 values are when the antibody is measured in an IgG1 format. For example, the EC50 γδ TCR downregulation value can be measured using flow cytometry.
[0386] The EC50 for γδ T cell degranulation upon antibody (or fragment) binding may be less than 0.05 .Math.g/ml, such as less than 0.04 .Math.g/ml, 0.03 .Math.g/ml, 0.02 .Math.g/ml, 0.015 .Math.g/ml, 0.01 .Math.g/ml or 0.008 .Math.g/ml. In particular, said EC50 values are when the antibody is measured in an IgG1 format. For example, the γδ T cell degranulation EC50 value can be measured by detecting CD107a expression (i.e. a marker of cell degranulation) using flow cytometry. In one embodiment, CD107a expression is measured using an anti-CD107a antibody, such as anti-human CD107a BV421 (clone H4A3) (BD Biosciences).
[0387] The EC50 for γδ T cell-mediated killing upon the antibody (or fragment) binding may be less than 0.5 .Math.g/ml, such as less than 0.4 .Math.g/ml, 0.3 .Math.g/ml, 0.2 .Math.g/ml, 0.15 .Math.g/ml, 0.1 .Math.g/ml or 0.07 .Math.g/ml. In particular, said EC50 values are when the antibody is measured in an IgG1 format. For example, the EC50 γδ T cell-mediated killing value can be measured by detecting proportion of dead cells (i.e. using a cell viability dye) using flow cytometry following incubation of the antibody, γδ T cell and target cells. In one embodiment, death of the target cell is measured using a cell viability dye is Viability Dye eFluor™ 520 (ThermoFisher).
[0388] In the assays described in these aspects, the antibody or fragment thereof may be presented on the surface of a cell, such as a THP-1 cell, for example TIB-202™ (ATCC). The THP-1 cells are optionally labelled with a dye, such as CellTracker™ Orange CMTMR (ThermoFisher).
Polynucleotides and Expression Vectors
[0389] Also provided are polynucleotides encoding the anti-Vγ4 antibodies or fragments described herein. In one embodiment, the anti-Vγ4 antibody or fragment thereof is encoded by a polynucleotide which comprises or consists of a sequence having at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 99% sequence identity with SEQ ID NOs: 187-232. In one embodiment, the anti-Vγ4 antibody or fragment thereof is encoded by an expression vector which comprises the VH region of SEQ ID NOs: 187-209. In another embodiment, the anti-Vγ4 antibody or fragment thereof is encoded by an expression vector comprises the VL region of SEQ ID NOs: 210-232. In a further embodiment, the anti-Vγ4 antibody or fragment thereof is encoded by a polynucleotide which comprises or consists of SEQ ID NOs: 187-232. In a further embodiment, there is provided a cDNA comprising said polynucleotide.
[0390] In one embodiment, the polynucleotide comprises or consists of a sequence having at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 99% sequence identity with SEQ ID NOs: 195, 189, 199, 200, 202, 204, 208, 218, 212, 222, 223, 225, 227 or 231. In one embodiment, the expression vector comprises the VH region of SEQ ID NOs: 195, 189, 199, 200, 202, 204, or 208. In another embodiment, the expression vector comprises the VL region of SEQ ID NOs: 218, 212, 222, 223, 225, 227 or 231. In a further embodiment the polynucleotide comprises or consists of SEQ ID NOs: 195, 189, 199, 200, 202, 204, 208, 218, 212, 222, 223, 225, 227 or 231, in particular SEQ ID NO: 195 and/or 218; or SEQ ID NO: 189 and/or 212. In a further embodiment, there is provided a cDNA comprising said polynucleotide.
[0391] In one embodiment, the polynucleotide comprises or consists of a sequence having at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 99% sequence identity with any one of the portions of SEQ ID NOs: 187-232 which encodes CDR1, CDR2 and/or CDR3 of the encoded immunoglobulin chain variable domain. In one embodiment, the polynucleotide comprises or consists of a sequence having at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 99% sequence identity with any one of the portions of SEQ ID NOs: 195, 189, 199, 200, 202, 204, 208, 218, 212, 222, 223, 225, 227 or 231 which encodes CDR1, CDR2 and/or CDR3 of the encoded immunoglobulin chain variable domain.
[0392] In one embodiment, the polynucleotide comprises or consists of a sequence having at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 99% sequence identity with any one of the portions of SEQ ID NOs: 187-232 which encodes FR1, FR2, FR3 and/or FR4 of the encoded immunoglobulin chain variable domain. In one embodiment, the polynucleotide comprises or consists of a sequence having at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 99% sequence identity with any one of the portions of SEQ ID NOs: 195, 189, 199, 200, 202, 204, 208, 218, 212, 222, 223, 225, 227 or 231 which encodes FR1, FR2, FR3 and/or FR4 of the encoded immunoglobulin chain variable domain.
[0393] To express the antibodies, or fragments thereof, polynucleotides encoding partial or full-length light and heavy chains, as described herein, are inserted into expression vectors such that the genes are operatively linked to transcriptional and translational control sequences (which may be termed an ‘expression cassette’ as well understood in the art). Therefore, also described is an expression vector comprising a polynucleotide sequence as defined herein. In one embodiment, the expression vector comprises the VH sequence of any one of SEQ ID NOs: 187-209, such as any one of SEQ ID NOs: 195, 189, 199, 200, 202, 204 or 208. In another embodiment, the expression vector comprises the VL region of any one of SEQ ID NOs: 210-232, such as any one of SEQ ID NOs: 218, 212, 222, 223, 225, 227 or 231. Such expression vectors or cassettes may be used in pairs, suitably pairing the heavy and light chain variable sequences according to the pairing of various amino acid sequences providing the antibodies disclosed herein. In some embodiments, the expression vectors comprise a sequence having at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 99% sequence identity or 100% identity with any one of SEQ ID NOs: 187-209 (encoding a variable heavy region) and further comprises a sequence having at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 99% sequence identity or 100% identity with any one of SEQ ID NOs: 210-232 (encoding a variable light region). Again, the sequences may be provided in specific pairs as described herein to encode the antibodies disclosed herein.
[0394] The polynucleotides and expression vectors may also be described in reference to the amino acid sequence encoded. Therefore, in one embodiment, the polynucleotide comprises or consists of a sequence encoding the amino acid sequence of any one of SEQ ID NOs: 1 to 186, 233-260.
[0395] Mutations can be made to the DNA or cDNA that encode polypeptides which are silent as to the amino acid sequence of the polypeptide, but which provide preferred codons for translation in a particular host. The preferred codons for translation of a nucleic acid in, e.g., E. coli and S. cerevisiae, as well as mammalian, specifically human, are known.
[0396] Mutation of polypeptides can be achieved for example by substitutions, additions or deletions to a nucleic acid encoding the polypeptide. The substitutions, additions or deletions to a nucleic acid encoding the polypeptide can be introduced by many methods, including for example error-prone PCR, shuffling, oligonucleotide-directed mutagenesis, assembly PCR, PCR mutagenesis, in vivo mutagenesis, cassette mutagenesis, recursive ensemble mutagenesis, exponential ensemble mutagenesis, site-specific mutagenesis, gene reassembly, artificial gene synthesis, Gene Site Saturation Mutagenesis (GSSM), synthetic ligation reassembly (SLR) or a combination of these methods. The modifications, additions or deletions to a nucleic acid can also be introduced by a method comprising recombination, recursive sequence recombination, phosphothioate-modified DNA mutagenesis, uracil-containing template mutagenesis, gapped duplex mutagenesis, point mismatch repair mutagenesis, repair-deficient host strain mutagenesis, chemical mutagenesis, radiogenic mutagenesis, deletion mutagenesis, restriction-selection mutagenesis, restriction-purification mutagenesis, ensemble mutagenesis, chimeric nucleic acid multimer creation, or a combination thereof.
[0397] In particular, artificial gene synthesis may be used. A gene encoding a polypeptide can be synthetically produced by, for example, solid-phase DNA synthesis. Entire genes may be synthesized de novo, without the need for precursor template DNA. To obtain the desired oligonucleotide, the building blocks are sequentially coupled to the growing oligonucleotide chain in the order required by the sequence of the product. Upon the completion of the chain assembly, the product is released from the solid phase to solution, deprotected, and collected. Products can be isolated by high-performance liquid chromatography (HPLC) to obtain the desired oligonucleotides in high purity.
[0398] Expression vectors include, for example, plasmids, retroviruses, cosmids, yeast artificial chromosomes (YACs) and Epstein-Barr virus (EBV) derived episomes. The polynucleotide is ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the polynucleotide. Expression and/or control sequences can include promoters, enhancers, transcription terminators, a start codon (i.e. ATG) 5′ to the coding sequence, splicing signals for introns and stop codons. The expression vector and expression control sequences are chosen to be compatible with the expression host cell used. Thus, also described is a nucleotide sequence encoding single chain variable fragments according to any one of SEQ ID NOs: 163-185, comprising a VH region and a VL region joined by a synthetic linker (encoding SEQ ID NO: 186). It will be understood that polynucleotides or expression vectors described herein may comprise the VH region, the VL region or both (optionally including the linker). Therefore, polynucleotides encoding the VH and VL regions can be inserted into separate vectors, alternatively sequences encoding both regions are inserted into the same expression vector. The polynucleotide(s) are inserted into the expression vector by standard methods (e.g., ligation of complementary restriction sites on the polynucleotide and vector, or blunt end ligation if no restriction sites are present).
[0399] A convenient vector is one that encodes a functionally complete human CH or CL immunoglobulin sequence, with appropriate restriction sites engineered so that any VH or VL sequence can be easily inserted and expressed, as described herein. The expression vector can also encode a signal peptide that facilitates secretion of the antibody (or fragment thereof) from a host cell. The polynucleotide may be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the antibody. The signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (i.e., a signal peptide from a non-immunoglobulin protein).
[0400] A host cell may comprise a first vector encoding the light chain of the antibody or fragment thereof, and a second vector encoding the heavy chain of the antibody or fragment thereof. Alternatively, the heavy and light chains may both be encoded on the same expression vector introduced into the host cell.
[0401] In one embodiment, the polynucleotide or expression vector encodes a membrane anchor or transmembrane domain fused to the antibody or fragment thereof, wherein the antibody or fragment thereof is presented on an extracellular surface of the host cell.
[0402] Transformation can be by any known method for introducing polynucleotides into a host cell. Methods for introduction of heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, transduction, encapsulation of the polynucleotide(s) in liposomes, biolistic injection and direct microinjection of the DNA into nuclei. In addition, nucleic acid molecules may be introduced into mammalian cells by viral vectors.
[0403] Mammalian cell lines available as hosts for expression are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, and a number of other cell lines. Mammalian host cells include human, mouse, rat, dog, monkey, pig, goat, bovine, horse and hamster cells. Cell lines of particular preference are selected through determining which cell lines have high expression levels. Other cell lines that may be used are insect cell lines, such as Sf9 cells, amphibian cells, bacterial cells, plant cells and fungal cells. Antigen-binding fragments of antibodies such as the scFv and Fv fragments can be isolated and expressed in E. coli using methods known in the art.
[0404] The antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown. Antibodies can be recovered from the culture medium using standard protein purification methods.
[0405] Antibodies (or fragments) described herein can be obtained and manipulated using the techniques disclosed for example in Green and Sambrook, Molecular Cloning: A Laboratory Manual (2012) 4th Edition Cold Spring Harbour Laboratory Press.
[0406] Monoclonal antibodies can be produced using hybridoma technology, by fusing a specific antibody-producing B cell with a myeloma (B cell cancer) cell that is selected for its ability to grow in tissue culture and for an absence of antibody chain synthesis.
[0407] A monoclonal antibody directed against a determined antigen can, for example, be obtained by: [0408] a) immortalizing lymphocytes obtained from the peripheral blood of an animal previously immunized with a determined antigen, with an immortal cell and preferably with myeloma cells, in order to form a hybridoma, [0409] b) culturing the immortalized cells (hybridoma) formed and recovering the cells producing the antibodies having the desired specificity.
[0410] Alternatively, the use of a hybridoma cell is not required. Antibodies capable of binding to the target antigens as described herein may be isolated from a suitable antibody library via routine practice, for example, using the phage display, yeast display, ribosomal display, or mammalian display technology known in the art. Accordingly, monoclonal antibodies can be obtained, for example, by a process comprising the steps of: [0411] a) cloning into vectors, especially into phages and more particularly filamentous bacteriophages, DNA or cDNA sequences obtained from lymphocytes especially peripheral blood lymphocytes of an animal (suitably previously immunized with determined antigens), [0412] b) transforming prokaryotic cells with the above vectors in conditions allowing the production of the antibodies, [0413] c) selecting the antibodies by subjecting them to antigen-affinity selection, [0414] d) recovering the antibodies having the desired specificity.
Pharmaceutical Compositions
[0415] According to a further aspect of the invention, there is provided a composition comprising the Vγ4 T cell population obtained by a method as defined herein. In one embodiment the Vγ4 T cell population is the expanded Vγ4 T cell population. In such embodiments, the composition may comprise the cells, optionally in combination with other excipients. Also included are compositions comprising one or more additional active agents (e.g. active agents suitable for treating the diseases mentioned herein).
[0416] Pharmaceutical compositions may include Vγ4 T cells, in particular expanded Vγ4 T cells, as described herein in combination with one or more pharmaceutically or physiologically acceptable carrier, diluents, or excipients. Such compositions may include buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminium hydroxide); and preservatives. Cryopreservation solutions which may be used in the pharmaceutical compositions of the invention include, for example, DMSO. Compositions can be formulated, e.g., for intravenous administration.
[0417] In one embodiment, the pharmaceutical composition is substantially free of, e.g., there are no detectable levels of a contaminant, e.g., of endotoxin or mycoplasma.
[0418] The preferred mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular, intrathecal). In a preferred embodiment, the composition is administered by intravenous infusion or injection. In another preferred embodiment, the composition is administered by intramuscular or subcutaneous injection.
[0419] It is within the scope of the invention to use the pharmaceutical composition of the invention in therapeutic methods for the treatment of diseases as described herein as an adjunct to, or in conjunction with, other established therapies normally used in the treatment of such diseases.
[0420] In a further aspect of the invention, the cell population, composition or pharmaceutical composition is administered sequentially, simultaneously or separately with at least one active agent.
Treatment Methods Using Cell Populations
[0421] According to a further aspect of the invention, there is provided a cell population obtained by a method as defined herein for use as a medicament. According to a further aspect of the invention, there is provided the expanded cell population as defined herein for use as a medicament. References herein to a cell population “for use” as a medicament or in therapy are limited to administration of the cell population to a subject. Such uses do not include administration of the antibody or fragment thereof direct to a patient i.e. wherein said antibody is used as the therapeutic.
[0422] In one embodiment, the cell population is for use in the treatment of cancer, an infectious disease or an inflammatory disease. In a further embodiment, the cell population is for use in the treatment of cancer.
[0423] In one embodiment, the cell population for use as a medicament comprises more than 50% Vγ4 T cells, such as more than 60%, more than 70%, more than 80%, more than 90%, more than 95% or more than 99% Vγ4 T cells. In a further embodiment, the cell population for use as a medicament consists of Vγ4 T cells.
[0424] According to a further aspect of the invention, there is provided the pharmaceutical composition comprising the cell population as defined herein for use as a medicament. In one embodiment, the pharmaceutical composition comprising the cell population is for use in therapy, particularly for use in the treatment of cancer, an infectious disease or an inflammatory disease. In a further embodiment, the pharmaceutical composition comprising the cell population is for use in the treatment of cancer.
[0425] According to a further aspect of the invention, there is provided a method of modulating an immune response in a subject in need thereof comprising administering a therapeutically effective amount of the cell population as defined herein.
[0426] According to a further aspect of the invention, there is provided a method of treating a cancer, an infectious disease or an inflammatory disease in a subject in need thereof, comprising administering a therapeutically effective amount of the cell population as defined herein. Alternatively, a therapeutically effective amount of the pharmaceutical composition comprising the cell population is administered.
[0427] According to further aspects of the invention, there is provided the use of the cell population as defined herein for the manufacture of a medicament, for example in the treatment of cancer, an infectious disease or an inflammatory disease.
Adoptive T Cell Therapy
[0428] Gamma delta T cells obtained by the expansion methods of the invention may be used as a medicament, for example for adoptive T cell therapy. This involves the transfer of γδ T cells into a patient. The therapy may be autologous, i.e. the γδ T cells may be transferred back into the same patient from which they were obtained, or the therapy may be allogeneic, i.e. the γδ T cells from one person may be transferred into a different patient. In instances involving allogeneic transfer, the γδ T cells may be substantially free of αβ T cells. For example, αβ T cells may be depleted from the γδ T cell population, e.g., after expansion, using any suitable means known in the art (e.g., by negative selection, e.g., using magnetic beads). A method of treatment may include: providing a sample (e.g. a non-haematopoietic tissue sample) obtained from a donor individual; culturing γδ T cells obtained from the sample as described herein, e.g. to produce an expanded population; and administering the population of γδ T cells to a recipient individual.
[0429] The patient or subject to be treated is preferably a human cancer patient (e.g., a human cancer patient being treated for a solid tumour) or a virus-infected patient (e.g., a CMV-infected or HIV infected patient). In some instances, the patient has and/or is being treated for a solid tumour. Because they are normally resident in non-haematopoietic tissues, tissue-resident Vγ4 T cells are also more likely to home to and be retained within tumour masses than their systemic blood-resident counterparts and adoptive transfer of these cells is likely to be more effective at targeting solid tumours and potentially other non-haematopoietic tissue-associated immunopathologies.
[0430] As γδ T cells are non-MHC restricted, they do not recognize a host into which they are transferred as foreign, which means that they are less likely to cause graft-versus-host disease. This means that they can be used “off the shelf” and transferred into any recipient, e.g., for allogeneic adoptive T cell therapy.
[0431] γδ T cells obtained by methods described herein may express NKG2D and respond to a NKG2D ligand (e.g. MICA), which is strongly associated with malignancy. They may also express a cytotoxic profile in the absence of any activation and are therefore likely to be effective at killing tumour cells. For example, the γδ T cells obtained as described herein may express one or more, preferably all of IFN-γ, TNF-α, GM-CSF, CCL4, IL-13, Granulysin, Granzyme A and B, and Perforin in the absence of any activation. IL-17A may not be expressed.
[0432] In some embodiments, a method of treatment of an individual with a tumour may include; providing a sample of said tumour obtained from a donor individual, culturing the γδ T cells obtained from the sample as described above, and; administering the population of γδ T cells to the individual with the tumour. In a further embodiment, a method of treatment of an individual with a tumour in a non-haematopoietic tissue may include; providing a sample of said non-haematopoietic tissue obtained from a donor individual, culturing the γδ T cells obtained from the sample as described above, and; administering the population of γδ T cells to the individual with the tumour.
[0433] In some instances, a therapeutically effective amount of γδ T cells obtained by the any of the methods described above can be administered in a therapeutically effective amount to a subject (e.g., for treatment of cancer, e.g. for treatment of a solid tumour). In some cases, the therapeutically effective amount of γδ T cells (e.g., Vγ4 T cells) is less than 10 × 10.sup.12 cells per dose (e.g., less than 9 × 10.sup.12 cells per dose, less than 8 × 10.sup.12 cells per dose, less than 7 × 10.sup.12 cells per dose, less than 6 × 10.sup.12 cells per dose, less than 5 × 10.sup.12 cells per dose, less than 4 × 10.sup.12 cells per dose, less than 3 × 10.sup.12 cells per dose, less than 2 × 10.sup.12 cells per dose, less than 1 × 10.sup.12 cells per dose, less than 9 × 10.sup.11 cells per dose, less than 8 × 10.sup.11 cells per dose, less than 7 × 10.sup.11 cells per dose, less than 6 × 10.sup.11 cells per dose, less than 5 × 10.sup.11 cells per dose, less than 4 × 10.sup.11 cells per dose, less than 3 × 10.sup.11 cells per dose, less than 2 × 10.sup.11 cells per dose, less than 1 × 10.sup.11 cells per dose, less than 9 × 10.sup.10 cells per dose, less than 7.5 × 10.sup.10 cells per dose, less than 5 × 10.sup.10 cells per dose, less than 2.5 × 10.sup.10 cells per dose, less than 1 × 10.sup.10 cells per dose, less than 7.5 × 10.sup.9 cells per dose, less than 5 × 10.sup.9 cells per dose, less than 2.5 × 10.sup.9 cells per dose, less than 1 × 10.sup.9 cells per dose, less than 7.5 × 10.sup.8 cells per dose, less than 5 × 10.sup.8 cells per dose, less than 2.5 × 10.sup.8 cells per dose, less than 1 × 10.sup.8 cells per dose, less than 7.5 × 10.sup.7 cells per dose, less than 5 × 10.sup.7 cells per dose, less than 2.5 × 10.sup.7 cells per dose, less than 1 × 10.sup.7 cells per dose, less than 7.5 × 10.sup.6 cells per dose, less than 5 × 10.sup.6 cells per dose, less than 2.5 × 10.sup.6 cells per dose, less than 1 × 10.sup.6 cells per dose, less than 7.5 × 10.sup.5 cells per dose, less than 5 × 10.sup.5 cells per dose, less than 2.5 × 10.sup.5 cells per dose, or less than 1 × 10.sup.5 cells per dose).
[0434] In some embodiments, the therapeutically effective amount of γδ T cells (e.g. Vγ4 T cells) is less than 10 × 10.sup.12 cells over the course of treatment (e.g., less than 9 × 10.sup.12 cells, less than 8 × 10.sup.12 cells, less than 7 × 10.sup.12 cells, less than 6 × 10.sup.12 cells, less than 5 × 10.sup.12 cells, less than 4 × 10.sup.12 cells, less than 3 × 10.sup.12 cells, less than 2 × 10.sup.12 cells, less than 1 × 10.sup.12 cells, less than 9 × 10.sup.11 cells, less than 8 × 10.sup.11 cells, less than 7 × 10.sup.11 cells, less than 6 × 10.sup.11 cells, less than 5 × 10.sup.11 cells, less than 4 × 10.sup.11 cells, less than 3 × 10.sup.11 cells, less than 2 × 10.sup.11 cells, less than 1 × 10.sup.11 cells, less than 9 × 10.sup.10 cells, less than 7.5 × 10.sup.10 cells, less than 5 × 10.sup.10 cells, less than 2.5 × 10.sup.10 cells, less than 1 × 10.sup.10 cells, less than 7.5 × 10.sup.9 cells, less than 5 × 10.sup.9 cells, less than 2.5 × 10.sup.9 cells, less than 1 × 10.sup.9 cells, less than 7.5 × 10.sup.8 cells, less than 5 × 10.sup.8 cells, less than 2.5 × 10.sup.8 cells, less than 1 × 10.sup.8 cells, less than 7.5 × 10.sup.7 cells, less than 5 × 10.sup.7 cells, less than 2.5 × 10.sup.7 cells, less than 1 × 10.sup.7 cells, less than 7.5 × 10.sup.6 cells, less than 5 × 10.sup.6 cells, less than 2.5 × 10.sup.6 cells, less than 1 × 10.sup.6 cells, less than 7.5 × 10.sup.5 cells, less than 5 × 10.sup.5 cells, less than 2.5 × 10.sup.5 cells, or less than 1 × 10.sup.5 cells over the course of treatment).
[0435] In some embodiments, a dose of γδ T cells (e.g., Vγ4 T cells) as described herein comprises about 1 × 10.sup.6, 1.1 × 10.sup.6, 2 × 10.sup.6, 3.6 × 10.sup.6, 5 × 10.sup.6, 1 × 10.sup.7, 1.8 × 10.sup.7, 2 × 10.sup.7, 5 × 10.sup.7, 1 × 10.sup.8, 2 × 10.sup.8, or 5 × 10.sup.8 cells/kg. In some embodiments, a dose of γδ T cells (e.g., Vγ4 T cells) comprises up to about 1 × 10.sup.6, 1.1 × 10.sup.6, 2 × 10.sup.6, 3.6 × 10.sup.6, 5 × 10.sup.6, 1 × 10.sup.7, 1.8 × 10.sup.7, 2 × 10.sup.7, 5 × 10.sup.7, 1 × 10.sup.8, 2 × 10.sup.8, or 5 × 10.sup.8 cells/kg. In some embodiments, a dose of yδ T cells (e.g., Vγ4 T cells) comprises about 1.1 × 10.sup.6- 1.8 × 10.sup.7 cells/kg. In some embodiments, a dose of yδ T cells (e.g., Vγ4 T cells) comprises about 1 × 10.sup.7, 2 × 10.sup.7, 5 × 10.sup.7, 1 × 10.sup.8, 2 × 10.sup.8, 5 × 10.sup.8, 1 × 10.sup.9, 2 × 10.sup.9, or 5 × 10.sup.9 cells. In some embodiments, a dose of yδ T cells (e.g., Vγ4 T cells) comprises at least about 1 × 10.sup.7, 2 × 10.sup.7, 5 × 10.sup.7, 1 × 10.sup.8, 2 × 10.sup.8, 5 × 10.sup.8, 1 × 10.sup.9, 2 × 10.sup.9, or 5 × 10.sup.9 cells. In some embodiments, a dose of γδ T cells (e.g., Vγ4 T cells) comprises up to about 1 × 10.sup.7, 2 × 10.sup.7, 5 × 10.sup.7, 1 × 10.sup.8, 2 × 10.sup.8, 5 × 10.sup.8, 1 × 10.sup.9, 2 × 10.sup.9, or 5 × 10.sup.9 cells.
[0436] In one embodiment, the subject is administered 10.sup.4 to 10.sup.6yδ T cells (e.g., Vγ4 T cells) per kg body weight of the subject. In one embodiment, the subject receives an initial administration of a population of γδ T cells (e.g., an initial administration of 10.sup.4 to 10.sup.6 γδ T cells per kg body weight of the subject, e.g., 10.sup.4 to 10.sup.5 γδ T cells per kg body weight of the subject), and one or more (e.g., 2, 3, 4, or 5) subsequent administrations of γδ T cells (e.g., one or more subsequent administration of 10.sup.4 to 10.sup.6 γδ T cells per kg body weight of the subject, e.g., 10.sup.4 to 10.sup.5 γδ T cells per kg body weight of the subject). In one embodiment, the one or more subsequent administrations are administered less than 15 days, e.g., 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 days after the previous administration, e.g., less than 4, 3, or 2 days after the previous administration. In one embodiment, the subject receives a total of about 10.sup.6 γδ T cells per kg body weight of the subject over the course of at least three administrations of a population of γδ T cells, e.g., the subject receives an initial dose of 1 × 10.sup.5 γδ T cells, a second administration of 3 × 10.sup.5 γδ T cells, and a third administration of 6 × 10.sup.5 γδ T cells, and, e.g., each administration is administered less than 4, 3, or 2 days after the previous administration.
[0437] In some embodiments, one or more additional therapeutic agents can be administered to the subject. The additional therapeutic agent may be selected from the group consisting of an immunotherapeutic agent, a cytotoxic agent, a growth inhibitory agent, a radiation therapy agent, an anti-angiogenic agent, or a combination of two or more agents thereof. The additional therapeutic agent may be administered concurrently with, prior to, or after administration of the γδ T cells. The additional therapeutic agent may be an immunotherapeutic agent, which may act on a targetwithin the subject’s body (e.g., the subject’s own immune system) and/or on the transferred γδ T cells.
[0438] The administration of the compositions may be carried out in any convenient manner. The compositions described herein may be administered to a patient transarterially, subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous injection, or intraperitoneally, e.g., by intradermal or subcutaneous injection. The compositions of γδ T cells may be injected directly into a tumour, lymph node, or site of infection.
Gene Engineering
[0439] The γδ T cells obtained by the method of the invention may also be gene engineered for enhanced therapeutic properties, such as for Chimeric Antigen Receptor T cell (CAR-T) therapy. This involves the generation of engineered T cell receptors (TCRs) to re-program the T cell with a new specificity, e.g. the specificity of a monoclonal antibody. The engineered TCR may make the T cells specific for malignant cells and therefore useful for cancer immunotherapy. For example, the T cells may recognize cancer cells expressing a tumour antigen, such as a tumour associated antigen that is not expressed by normal somatic cells from the subject tissue. Thus, the CAR-modified T cells may be used for adoptive T cell therapy of, for example, cancer patients.
Other Uses of the Antibodies or Fragments Thereof
[0440] According to a further aspect of the invention, there is provided the use of an anti-Vγ4 antibody or fragment thereof as described herein to study antigen recognition, activation, signal transduction or function of γδ T cells (in particular Vγ4 T cells). As described herein, the antibodies have been shown to be active in assays which can be used to investigate γδ T cell function. Such antibodies may also be useful for inducing the proliferation of γδ T cells, therefore may be used in methods of expanding γδ T cells (such as Vγ4 T cells).
[0441] Antibodies which bind to the Vγ4 chain can be used to detect yδ T cells. For example, the antibody may be labelled with a detectable label or reporter molecule or used as a capture ligand to selectively detect and/or isolate Vγ4 T cells in a sample. Labelled antibodies find use in many methods known in the art, for example immunohistochemistry and ELISA.
[0442] The detectable label or reporter molecule can be a radioisotope, such as .sup.3H, .sup.14C, .sup.32P, .sup.35S, or .sup.125I; a fluorescent or chemiluminescent moiety such as fluorescein isothiocyanate, or rhodamine; or an enzyme such as alkaline phosphatase, β-galactosidase, horseradish peroxidase, or luciferase. Fluorescent labels applied to antibodies of the invention may then be used in fluorescence-activated cell sorting (FACS) methods.
[0443] It will be understood that all embodiments described herein may be applied to all aspects of the invention.
CLAUSES
[0444] A set of clauses defining the invention and its preferred aspects is as follows: [0445] 1. An ex vivo method of modulating gamma variable 4 (Vγ4) T cells comprising administering an antibody or fragment thereof, which specifically binds to a Vγ4 chain of a γδ T cell receptor (TCR) and not to a gamma variable 2 (Vγ2) chain of a γδ TCR, to a cell population comprising Vγ4 T cells. [0446] 2. The method as defined in clause 1, wherein the Vγ4 chain of the γδ TCR is human Vγ4 and the Vγ2 chain of the γδ TCR is human Vγ2. [0447] 3. The method as defined in clause 1 or 2, wherein the antibody or fragment thereof binds to an epitope of the Vγ4 chain of the γδ TCR comprising one or more amino acid residues within amino acid region 67-82 of SEQ ID NO: 1. [0448] 4. The method as defined in any one of clauses 1 to 3, wherein the antibody or fragment thereof binds to an epitope of the Vγ4 chain of the γδ TCR comprising one or more amino acid residues within amino acid region 71-79 of SEQ ID NO: 1. [0449] 5. The method as defined in clause 4, wherein the epitope comprises at least one of amino acid residues 71, 73, 75, 76, 79 of SEQ ID NO: 1. [0450] 6. The method as defined in any one of clauses 1 to 5, wherein the epitope consists of one or more amino acid residues within amino acid region 67-82 of SEQ ID NO: 1. [0451] 7. The method as defined in any one of clauses 1 to 6, wherein the epitope comprises or consists of K76 and/or M80 of SEQ ID NO: 1. [0452] 8. The method as defined in any one of clauses 1 to 7, wherein the epitope is an activating epitope of a γδ T cell. [0453] 9. The method as defined in clause 8, wherein binding of the activating epitope: (i) downregulates the γδ TCR; (ii) activates degranulation of the γδ T cell; (iii) activates γδ T cell-mediated killing; and/or (iv) activates or increases Vγ4 chain-mediated cell signalling. [0454] 10. The method as defined in any one of clauses 1 to 9, wherein the antibody or fragment thereof only binds to an epitope in the V region of a Vγ4 chain of a γδ TCR. [0455] 11. The method as defined in any one of clauses 1 to 10, wherein the antibody or fragment thereof does not bind to an epitope found in CDR3 of a Vγ4 chain of a γδ TCR. [0456] 12. An ex vivo method of modulating gamma variable 4 (Vγ4) T cells comprising administering an anti-Vγ4 antibody or fragment thereof, which comprises one or more of: [0457] a CDR3 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 2-47, preferably with SEQ ID NO: 10 and/or 33; [0458] a CDR2 comprising a sequence having at least 80% sequence identity with any one of SEQ ID NOs: 48-70 and SEQUENCES: A1-A23 (of
[0585] Other features and advantages of the present invention will be apparent from the description provided herein. It should be understood, however, that the description and the specific examples while indicating preferred embodiments of the invention are given by way of illustration only, since various changes and modifications will become apparent to those skilled in the art. The invention will now be described using the following, non-limiting examples:
EXAMPLES
Example 1. Materials and Methods
Antigen Preparation
[0586] The design of the soluble γδ TCR heterodimers comprising the TCRa and TCR β constant regions used in the below Examples were generated according to Xu et al. (2011) PNAS 108: 2414-2419. Vγ or Vδ domains were fused in-frame to a TCRa or TCRβ constant region lacking the transmembrane domain, followed by a leucine zipper sequence or an Fc sequence, and a histidine tag/linker.
[0587] The expression construct was transiently transfected in mammalian EXPI HEK293 suspension cells (either as single or co-transfections for heterodimer). Secreted recombinant proteins were recovered and purified from culture supernatant by affinity chromatography. To ensure good recovery of monomer antigen, samples were further purified using preparative size exclusion chromatography (SEC). Purified antigens were analysed for purity by SDS-PAGE and aggregation state by analytical SEC.
[0588] Selected scFvs were subcloned into lgG1 frameworks using commercially available plasmids. expi293F suspension cells were transfected with said plasmids for antibody expression. For convenience, unless otherwise noted, the antibodies characterised in these Examples referto IgG1 formatted antibodies selected from phage display as scFv. However, the antibodies may be in any antibody format as previously discussed.
Antibody Purification
[0589] IgG antibodies were batch purified from supernatants using protein A chromatography. Quality of purified IgG was analysed using ELISA, SDS-PAGE and SEC-HPLC.
Antigen Binding
[0590] Phage display selection outputs were subcloned into the scFv expression vector pSANG10 (Martin et al. (2006) BMC Biotechnol. 6: 46). Soluble scFv were expressed and screened for binding in dissociation-enhanced lanthanide fluorescence immunoassay (DELFIA) on directly immobilised targets. Hits were defined as a DELFIA signal above 3000 fluorescence units.
[0591] A DELFIA ELISA binding method was also employed to assess binding of antibody supernatants or further protein-A purified antibody. In brief, MaxiSorp plates were coated with 3 .Math.g/ml of antigen BSA or L1 (DV1-GV4), L2 (DV1-GV2), L3 (DV1-GV8), or L4 (DV2-GV4) recombinant TCR antigen. Plates were then washed with PBS, blocked with PBS/skimmed milk and then test article added and incubated for 1 hour at room temperature. Thereafter, plates were washed with PBS-Tween and DELFIA Eu-N1-anti-human IgG (Perkin Elmer # 1244-330) added for 1 hour at room temperature prior to further washing, addition of DELFIA enhancement solution (Perkin Elmer #4001-0010), and reading on a Pherastar microplate reader.
[0592] D1.3 hlgG1 (described in England et al. (1999) J. Immunol. 162: 2129-2136) was used as a negative control and REA173 (Miltenyi) and TS8.2 (ThermoFisher, No. TCR1730) were used as comparator antibodies.
Antibody Studies With Recombinant JRT3-TCR Cells
[0593] The recombinant JRT3-TCR cells employed in the antibody binding, the TCR downregulation, and the CD69 upregulation studies are described previously (see Melandri et al. (2018) Nature Immunology 19(12): 1352-1365, and Willcox et al. (2019) Immunity 51(5): 813-825.e4).
[0594] For the antibody binding studies, primary staining of either 100,000 non-transduced JRT3 controls or JRT3-TCR cells were undertaken in PBS 5% FCS for 30 minutes at 4° C. with either a standard 1.0 .Math.g/ml if the amount is not indicated or the amount indicated, such as 0.08, 0.4, 2 or 10 .Math.g/ml in
[0595] For TCR downregulation / CD69 upregulation studies, 96 flat well plates were first pre-coated by adding to each well 20 .Math.g/ml secondary antibodies, specifically either anti-human IgG-Fc (for the human D1.3 and Vγ4 antibodies) or anti-mouse IgG (for murine anti-CD3e or anti-Pan TCRgd) and then incubated for 2 h at 37° C. Test antibodies as indicated were first diluted to 0.01, 0.1, 1, and 10 .Math.g/ml final concentrations. 50 .Math.l of each concentration was then added to a well of the pre-coated plate prior to overnight incubation at 4° C. Unbound antibody was then washed twice with PBS before addition of saturating PBS 5% FCS for 1 hour at 37° C. 100,000 cells per well were then plated by 400 g spinning. Cells were then incubated for 5 hours at 37° C., 5% CO.sub.2 and then transferred to a 96 well round-bottom plate for staining. Staining antibodies employed included BV421 anti-CD3ε diluted 1:400 (clone OKT-3 Biolegend); PE-Cy7 anti-γδTCR diluted 1:200 (clone IMMU510 Beckman Coulter); and A647 anti-CD69 diluted 1:200 (clone FN50 Biolegend). All staining undertaken in PBS 5% FCS for 30 minutes at 4° C.
Antibody Studies With Primary Cells (PBMC)
[0596] 24 well plates were first pre-coated by adding to each well 20 .Math.g/ml (250 .Math.l per well) anti-human IgG-Fc (Biolegend) and then incubated for 2 hours at 37° C. Unbound secondary antibody was washed twice with PBS, and isotype control (human IgG1, Biolegend) or anti-Vγ4 (clone G4_12) were first diluted to 0.1, 1, and 10 .Math.g/ml final concentrations. 250 .Math.l of each concentration was then added to a well of the pre-coated plate prior to overnight incubation at 4° C. Unbound antibodies were then washed twice with PBS before addition of saturating PBS 5% FCS for 1 hour at 37° C. 500,000 PBMC resuspended at 10.sup.6 cells per ml in complete media (RPMI supplemented with 5% heat-inactivated human AB serum [PAA laboratories], Sodium Pyruvate [1 mM] and Penicillin/Streptomycin [ThermoFisher]) were then added to each well. Cells were then incubated at 37° C., 5% CO.sub.2. IL-2 or IL-2 + IL-15 (100 U/ml and 10 ng/ml final concentrations, respectively) were added after 24 hours and fresh complete media supplemented with IL-2 or IL-2 + IL-15 was added every 2-3 days. On days 7 and 14 of the culture, cells were transferred to a 96 well round-bottom plate for staining. Staining antibodies employed included biotin anti-TCRVγ2/3/4 (Clone 23D12) diluted to 1 .Math.g/ml, PE streptavidin diluted 1:100 (Biolegend); BV421 anti-CD3ε diluted 1:400 (clone OKT-3 Biolegend); PE-Cy7 anti-TCRyδ diluted 1:200 (clone IMMU510 Beckman Coulter); FITC anti-Vδ2 (Clone B6 Biolegend); and A647 anti-Vγ4 (clone G4_18) diluted to 1 .Math.g/ml. All staining undertaken in PBS 5% FCS for 30 minutes at 4° C.
MS-Based Epitope Mapping
[0597] CovalX ‘Ultrafast Conformation/Linear Epitope Mapping’ methodology was employed. First both protein antigen L1 (DV1-GV4) plus antibody G4_3 (1139_P01_A04) were analyzed for protein integrity and aggregation level using a high-mass MALDI. In order to determine the binding epitope of the L1(DV1-GV4)/G4_3 complex with high resolution, the complexes were incubated with deuterated cross-linkers and subjected to multi-enzymatic proteolysis using trypsin, chymotrypsin, Asp-N, elastase and thermolysin. After enrichment of the cross-linked peptides, the samples were analyzed by high resolution mass spectrometry (nLC-LTQ-Orbitrap MS) and the data generated were analyzed using XQuest and Stavrox software.
γδ T Cell Binding Assay
[0598] The binding of antibodies to γδ T cells may be tested by incubating a fixed concentration of purified antibodies with 250000 γδ T cells. This incubation may be performed under blocking conditions, such as by the addition of huFc fragments or Ig to prevent unspecific binding of antibodies via the Fc receptor. Detection may be performed by addition of a secondary, fluorescent dye-conjugated antibody against human lgG1. For negative controls, cells may be prepared with a) an isotype antibody only (recombinant human IgG), b) the fluorescent dye-conjugated anti-human IgG antibody only and c) a combination of a) and b). A control well of completely unstained cells may be also prepared and analysed. As positive controls, a purified murine monoclonal lgG2 anti-human CD3 antibody may be used in two different concentrations and stained with a fluorescent dye-conjugated goat anti-mouse secondary antibody. The assay may be accepted if the lower concentration positive controls’ mean fluorescence intensity in the FITC channel was at least tenfold as high as the highest negative control.
SPR Analysis
[0599] A MASS-2 instrument with an amine high capacity chip (both from Sierra Sensors, Germany) may be used to perform SPR analysis. 15 nM IgG may be captured via protein G to an amine high capacity chip (100 nM forTS8.2). L1 (DV1-GV4) antigen may be flown over the cell at a 1:2 dilution series from 2000 nM to 15.625 nM with the following parameters: 180 s association, 600 s dissociation, flowrate 30 .Math.L/min, running buffer PBS + 0.02 % Tween 20. All experiments were performed at room temperature on MASS-2 instrument. Steady state fitting may be determined according to Langmuir 1:1 binding using software Sierra Analyzer 3.2.
γδ TCR Downregulation and Degranulation Assay
[0600] THP-1 (TIB-202™, ATCC) target cells loaded or not with test antibodies may be labelled with CellTracker™ Orange CMTMR (ThermoFisher, C2927) and incubated with γδ T cells at 2:1 ratio in the presence of CD107a antibody (Anti-human CD107a BV421 (clone H4A3) BD Biosciences 562623). After 2 hours of incubation, the surface expression of γδ TCR (to measure TCR downregulation) and expression of CD107a (to measure degranulation) on γδ T cells may be evaluated using flow cytometry.
Killing Assay
[0601] Gamma delta T cell-mediated killing activity and effect of test antibodies on the killing activity of γδ T cells may be accessed by flow cytometry. After 4 hours of in vitro co-culture at 20:1 ratio of γδ T cells and CellTracker™ Orange CMTMR (ThermoFisher, C2927) labelled THP-1 cells (loaded or not with the antibody) may be stained with Viability Dye eFluor™ 520 (ThermoFisher, 520 65-0867-14) to distinguish between live and dead target THP-1 cells. During sample acquisition, target cells may be gated on the CellTracker™ Orange CMTMR positivity and examined for cell death based on the uptake of Viability Dye. CMTMR and eFluor™ 520 double positive cells may be recognized as the dead target cells. The killing activity of γδ T cells may be presented as a % of the dead target cells.
Example 2. Antigen Design
[0602] Gamma delta (γδ) T cells are polyclonal with CDR3 polyclonality. In order to avoid a situation where generated antibodies would be selected against the CDR3 sequence (as the CDR3 sequence will differ from TCR clone to TCR clone), the antigen design involved maintaining a consistent CDR3 in different formats. This design aimed to generate antibodies recognising a sequence within the variable domain, which is germline encoded and therefore the same in all clones, thus providing antibodies which recognise a wider subset of γδ T cells.
[0603] Another important aspect of the antigen preparation process was to design antigens which are suitable for expression as a protein. The γδ TCR is a complex protein involving a heterodimer with inter-chain and intra-chain disulphide bonds. A leucine zipper (LZ) format and Fc format were used to generate soluble TCR antigens to be used in the phage display selections. Both the LZ and Fc formats expressed well and successfully displayed the TCR (particularly heterodimeric TCRs, e.g. Vδ1Vγ4).
[0604] It was found that the CDR3 sequence from a public database entry for the γδ TCR expressed well as proteins (RSCB Protein Data Bank entry: 4MNH). This was therefore selected for antigen preparation.
[0605] Antigens containing the gamma variable 4 chain were expressed in LZ formats as a heterodimer (i.e. in combination with different delta variable chains – e.g. DV1-GV4, a heterodimer composed of a delta variable 1 chain and a gamma variable 4 chain, [ termed “L1”] and DV2-GV4, a heterodimer composed of a delta variable 2 chain and a gamma variable 4 chain, [ termed “L4”]) and in Fc format either as a heterodimer or as a homodimer (i.e. in combination with another gamma variable 4 chain – GV4-GV4, a homodimer composed of two gamma variable 4 chains, [termed “Fc4/4”]). All gamma variable 4 chains of the antigens contained the 4MNH CDR3. Another series of γδ TCR antigens using similar formats were designed containing different gamma variable chains (such as gamma variable 2 and gamma variable 8) and used to deselect antibodies with non-specific or off target binding (e.g. DV1-GV2, a heterodimer composed of a delta variable 1 chain and a gamma variable 2 chain, [termed “L2”] or DV1-GV8, a heterodimer composed of a delta variable 1 chain and a gamma variable 8 chain, [termed “L3”]). These antigens were also designed to include the 4MNH CDR3 to ensure that antibodies binding in the CDR3 region were also deselected.
Example 3. Phage Display
[0606] Phage display selections were performed against libraries of human scFvs using either heterodimeric LZ TCR format in round 1 and 2, with deselections on heterodimeric LZ TCR in both rounds. Or round 1 was performed using homodimeric Fc fusion TCR with deselection on human IgG1 Fc followed by round 2 on heterodimeric LZ TCR with deselection on heterodimeric LZ TCR (see Table 1).
TABLE-US-00003 Overview phage display selections Target Round 1 selection Round 1 deselection Round 2 selection Round 2 deselection GV4 bt-L1 (DV1-GV4) L2 (DV1-GV2) bt-L4 (DV2-GV4) L2 (DV1-GV2) GV4 bt-Fc4/4 (GV4-GV4) Fc bt-L4 (DV2-GV4) L2 (DV1-GV2) bt = biotin.
[0607] Selections were performed in solution phase using 100 nM biotinylated proteins. Deselections were performed using 1 .Math.M non-biotinylated proteins.
Example 4. Antibody Selection
[0608] Hits obtained in Example 3 were sequenced (using standard methods known in the art). 130 unique clones were identified, which showed a unique combination of VH and VL CDR3. Of these 130 unique clones, 129 showed a unique VH CDR3 and 116 showed a unique VL CDR3.
[0609] Unique clones were re-arrayed and specificity was analysed by ELISA (DELFIA). A panel of 42 unique human scFv binders which bind TRGV4 but not TRGV2 or TRGV8, were identified from the selections.
[0610] Affinity ranking of the selected binders was included to aid the choice of clones going forward. A large number of binders showed affinities in the nanomolar range, reacting with 25 to 100 nM biotinylated antigen (L1). A handful of binders showed a strong reaction with 5 nM antigen, indicating possible single digit nanomolar affinities. Some binders showed no reaction with 100 nM antigen, indicating affinities in the micromolar range.
[0611] For the selection of clones to proceed with to IgG conversion, the aim was to include as many germline lineages and as many different CDR3s as possible. Further, sequence liabilities like glycosylation, integrin binding sites, CD11c/CD18 binding sites, unpaired cysteines were avoided. In addition, a variety of affinities was included. The clones chosen to be converted to IgG are shown in
[0612] Antibody binding studies were also conducted using recombinant Jurkat (JRT3-hu17) cells. Comparison of the results from the ELISA data and flow cytometry data are shown in
Example 5. Investigation of Vγ4 Antibody Binding
[0613] The capacity of the antibodies chosen in Example 4 to stain Vγ4 TCRs bearing different CDR3 sequences (hu17 vs. hu20, both Vγ4Vδ1) or delta chains (hu20γ/huPBδ, Vγ4Vδ2; LES, Vγ4Vδ5) was investigated. Results are shown in
Example 6. Epitope Mapping Using Chimeric Hu17 TCRs
[0614] hu17 is a Vγ4/Vδ1 TCR for which the paired CDR3 sequences were cloned from a BTNL3+8-reactive human colon intraepithelial lymphocyte by single-cell PCR (as described in Melandri et al. (2018) Nat. Immunol. 19: 1352-1365). Different chimeric hu17 TCR constructs were prepared as summarised in
[0615] Antibody binding was then investigated by flow cytometry against the chimeric hu17 TCRs expressed on JRT3 cells. A summary table of the reactivity of each antibody to the indicated chimeric TCR constructs is shown in
[0616] Example flow data of epitope mapping to illustrate the differential binding signals observed in this study is shown in
Example 7. Titration of Investigated Antibodies in Staining and Functional Assays
[0617] Results from titration of investigated antibodies for staining and analysis by flow cytometry to JRT3-hu17 cells (concentrations ranging from 0.08 to 10 .Math.g/mL, 5-fold dilution steps) are shown in
[0618] Functional assays were then conducted by investigating TCR turnover and CD69 upregulation by titrated antibodies versus turnover conferred by anti-CD3ε binding or anti-pan-TCRyδ antibodies. The results are shown for five of the antibodies in
TABLE-US-00004 TCR downregulation and activation of selected antibodies Antibody (.Math.g/ml) Vγ4 TCR downregulation Conferred Activation (CD69 fold-change increase) G4_3 + ++ G4_4 - - G4_7 - - G4_10 - - G4_12 +++ +++ G4_16 ++ ++ G4_18 + + G4_27 +/- -
[0619] All of the listed antibodies in Table 2 have been shown to bind to the Vγ4 chain of a γδ TCR. However, as shown in the table, some of these antibodies are capable of activating the Vγ4 TCR as measured via Vγ4 TCR downregulation and/or increased CD69 expression (indicated as ‘+’, ‘++’ or ‘+++’ with ‘+++’ meaning highest relative levels of activation), whilst other antibodies show no appreciable ability to activate the Vγ4 TCR (indicated as ‘-’).
Example 8. MS-Based Epitope Mapping
[0620] In order to determine the epitope of antigen/antibody complexes with high resolution, the protein complexes were incubated with deuterated cross-linkers and subjected to multi-enzymatic cleavage. After enrichment of the cross-linked peptides, the samples were analysed by high resolution mass spectrometry (nLC-LTQ-Orbitrap MS) and the data generated were analysed using XQuest (version 2.0) and Stavrox (version 3.6) software.
[0621] After trypsin, chymotrypsin, Asp-N, elastase and thermolysin proteolysis of the protein complex L1 (DV1-GV4)/1139_P01_A04 with deuterated d0d12, the nLC-orbitrap MS/MS analysis detected 11 cross-linked peptides between L1 (DV1-GV4) and the antibody 1139_P01_A04 (G4_3). Results of the epitope mapping results is presented in Table 3.
TABLE-US-00005 Results of epitope mapping for antigen/antibody complexes Clone ID Epitope mapping, amino acid numbering of SEQ ID NO: 1 1139_P01_A04 (G4_3) 71, 73, 75, 76, 79
[0622] This epitope mapping data correlates with the experiments above, indicating that this antibody binds within the HV4 region of the γ4 chain.
Example 9.Anti-Vγ4 Antibody Targeting and Modulation of Primary Vγ4-positive Cells
[0623] Further studies were undertaken to demonstrate anti-Vγ4 antibody targeting of primary Vγ4.sup.+ cells derived from skin, blood and gut, including cells derived from healthy and diseased patient samples.
Binding to Primary Vγ4.SUP.+ Cells Derived From Skin
[0624] Firstly, anti-Vγ4 antibodies were tested for binding to primary Vγ4.sup.+ T cells expanded from the skin of two individual donors. Skin samples were prepared by removing subcutaneous fat and a 3 mm biopsy punch used to make multiple punches. Punches were placed on carbon matrix grids and placed in the well of a G-REX6 (Wilson Wolf). Each well was filled with complete isolation medium containing AIM-V media (Gibco, Life Technologies), CTS Immune Serum Replacement (Life Technologies), IL-2 and IL-15. For the first 7 days of culture, complete isolation medium containing Amphotericin B (Life Technologies) was used (“+AMP”). Media was changed every 7 days by gently aspirating the upper media and replacing with 2X complete isolation medium (without AMP), trying not to disturb the cells at the bottom of the plate or bioreactor. Beyond three weeks in culture, the resulting egressed cells were then passaged into fresh tissue culture vessels and fresh media (e.g. AIM-V media or TexMAX media (Miltenyi)) plus recombinant IL-2, IL-4, IL-15 and IL-21 before harvest. αβT cells also present within the culture were then removed with aid of αβ T cell depletion kits and associated protocols, such as those provided by Miltenyi. For further reference see WO2020/095059.
[0625] Following isolation, γδ T cells were first stained with viability dye in the presence of Fc block for 20 minutes at 4° C. γδ T cells were then incubated with fixed concentrations of exemplary anti-Vγ4 antibodies (0.046 - 100 .Math.g/ml) or isotype control (lgG1 anti-respiratory syncytial virus (RSV) antibody) for 30 minutes at 4° C. Detection was performed by addition of a secondary, fluorescent dye-conjugated antibody against human lgG1 (IS11-12E4.23.20). Cells were then fixed and acquired on the MACSQuant16 flow cytometer. Cells were gated as single, live, lgG1 (Vγ4).sup.+. Data shown are the median fluorescent intensity (MFI) of secondary detection antibody detected bound to Vγ4.sup.+ cells.
[0626] The results are shown in
Binding to Primary Vγ4.SUP.+ Cells Derived From Peripheral Blood Mononuclear Cells (PBMCs)
[0627] In brief, human PBMCs (Lonza, product code CC-2702) were first stained with viability dye in the presence of Fc block for 20 minutes at 4° C. Cells were then incubated with 10 .Math.g/ml anti-Vγ4 antibodies or isotype control (RSV) for 30 minutes at 4° C., before being washed and stained extracellularly with anti-Vδ1 (REA173), anti-Vδ2 (REA771), anti-γδ (REA591) and anti-human lgG1 (IS11-12E4.23.20) for 20 minutes at 4° C. Cells were then fixed and acquired on the MACSQuant16 flow cytometer. Cells were gated as single, live, γδ.sup.+ Vδ2.sup.- lgG1 (Vγ4).sup.+.
[0628] The results are shown in
Binding to Primary Vγ4.SUP.+ Cells From Gut-Derived Intraepithelial Lymphocytes (IELs) Obtained From Colorectal Cancer (CRC) Patients
[0629] For this study, human CRC tumour biopsy was shipped fresh and processed upon receipt. The biopsy was cut into pieces measuring ~2 mm.sup.2 and tumour-infiltrating lymphocytes (TILs) were obtained using an adaptation of the method originally described by Kupper and Clarke (Clarke et al., 2006, J. Invest. Dermatol. 126, 1059-1070). Specifically, up to four 2 mm.sup.2 biopsies were placed on 9 mm × 9 mm × 1.5 mm Cellfoam matrices, and one matrix was placed per well on a 24-well plate. Biopsies were then cultured in 2 ml Iscove’s Modified Dulbecco’s Medium (IMDM) supplemented with 4% human plasma, β-mercaptoethanol (50 .Math.M), penicillin (100 U/ml), streptomycin (100 .Math.g/ml), gentamicin (20 .Math.g/ml), metronidazole (1 .Math.g/ml), amphotericin B (2.5 .Math.g/ml), HEPES (10 mM), Na Pyruvate (1 mM), MEM Non-Essential Amino Acids Solution (1X) and IL-15 (20 ng/ml, Miltenyi Biotech). 1 ml of medium was aspirated every 3 days and replaced with 1 ml complete medium containing 2× concentrated IL-15. TILs were harvested 10 days later, passed through a 70 .Math.M nylon cell strainer, centrifuged at 300 × g for 5 minutes and resuspended in complete medium for phenotyping. TILs were first stained with live/dead viability dye in the presence of Fc block for 20 minutes at 4° C. Cells were then incubated with 10 .Math.g/ml anti-Vγ4 antibodies or isotype control (RSV) for 30 minutes at 4° C., before being washed and stained extracellularly with anti-Vδ1 (REA173), anti-γδ (REA591) and anti-human lgG1 (IS11-12E4.23.20) for 20 minutes at 4° C. Cells were then fixed and acquired on the MACSQuant16 flow cytometer. Cells were gated as single, live, γδ.sup.+, lgG1.sup.+ (Vγ4).sup.+.
[0630] The results are shown in
Detection and TCR Downregulation of Human Gut-Derived γδ T Cells Conferred by Anti-Vγ4 Antibody
[0631] A further study was undertaken to explore modulation of human gut-derived γδ T cells conferred by an anti-Vγ4 antibody. For these studies, normal adjacent tissue (NAT) biopsies from the colon of CRC patients were shipped fresh and processed upon receipt to obtain a single cell suspension. Specifically, the tissue was chopped in pieces measuring ~2 mm.sup.2 and up to 1 g of tissue was placed into a Miltenyi C tube along with 4.7 ml RPMI with enzymes from Miltenyi’s Tumour Dissociation Kit at concentrations recommended by the manufacturer aside from Enzyme R which was used at 0.2X concentration to prevent cleavage of pertinent cell surface molecules. C-Tubes were placed on the gentleMACS™ Octo Dissociatorwith heating blocks attached. Program 37C_h_TDK_1 for the dissociation of soft tumours was selected. After 1 hour the digest was filtered through a 70 .Math.M filter and complete IMDM containing 4% human plasma was added to quench enzymatic activity. Cells were then washed twice and resuspended in complete IMDM for counting. At this point, cells were plated for stimulation with anti-Vγ4 antibodies, or were used for phenotyping.
[0632] In one series of experiments, the phenotype of Vγ4.sup.+ γδ T cells in the gut digest before stimulation with anti-Vγ4 antibodies was determined. In brief, cells were stained with live/dead viability dye in the presence of Fc block for 20 minutes at 4° C. Cells were then incubated with 10 .Math.g/ml G4_18 clone for 30 minutes at 4° C., before being washed and stained extracellularly with anti-Vδ1 (REA173), anti-γδ (REA591), anti-CD69 (REA824), anti-CD103 (Ber-Act8) and anti-human lgG1 (IS11-12E4.23.20) for 20 minutes at 4° C. Cells were then fixed and acquired on the MACSQuant16 flow cytometer. As shown in
[0633] A next series of experiments measured the impact of stimulating the cells with an anti-Vγ4 antibody. 2×10.sup.6 cells were plated per well in a 48-well plate and were stimulated with G4_12, G4_18 or RSV lgG1 isotype control antibodies in the presence of IL-15 at a concentration of 2 ng/ml. Intraepithelial lymphocytes (lELs) isolated by enzymatic digestion were analysed by flow cytometry 24 hours post mAb stimulation. Following 24 hour stimulation, cells were stained with viability dye in the presence of Fc block for 20 minutes at 4° C. Cells were then stained extracellularly for γδTCR (REA591), fixed, and acquired on a MACSQuant16 flow cytometer. Live, single cells were gated as γδTCR.sup.+.
Example 10. Further Studies Measuring the Binding Affinity (KD) to Human Vγ4 As Measured by Surface Plasmon Resonance (SPR) of Example Anti-Vγ4 Antibodies of the Invention
[0634] In addition, to the SPR binding studies described in Example 4 (method described in Example 1) in respect of scFv binders, additional studies were undertaken to measure the binding affinity of select example clones to the human Vγ4 chain when clones were expressed as full lgG1 monoclonal antibodies.
[0635] In brief, the binding affinity of the antibodies to target (i.e. the human Vγ4 chain of a γδ TCR) was established by SPR analysis using a Reichert 4SPR instrument (Reichert Technologies). Antigen (L1 (DV1-GV4)) was coupled onto a Carboxymethyl Dextran Chip (Reichert Technologies) at 10 ug/ml, which resulted in an increase from baseline of approximately 750 uRIU, respectively. Antibody was flown over the cell at a 1:2 dilution series from 500 nM to 31.25 nM with the following parameters: 180 s association, 300 s dissociation, flowrate 25 .Math.L/min, running buffer PBS + 0.05 % Tween 20. All experiments were performed at room temperature, with the samples kept at 4° C. before flowing over the chip. Steady state fitting was determined according to Langmuir 1:1 binding using software TraceDrawer (Reichert Technologies).
[0636] The results are shown in Table 4 and represent the average of 2 experiments per antibody (except where indicated).
TABLE-US-00006 Binding affinity of example antibodies for human Vγ4 Antibody clone Experiment 1: KD (nM) Experiment 2: KD (nM) Average KD (nM) G4_3 3.69 2.03 2.86 G4_12 17.8 20.2 19 G4_18 ND 19.9 19.9 G4_20 43 62.1 52.55 G4_23 109 178 143.5 G4_27 261 ND 261 *ND - not determined
[0637] A range of binding affinities was determined, as expected, thus enabling a particular antibody to be selected for a particular circumstance depending on the binding affinity required. In particular, binding affinities ranged from approximately 260 nM - 2.8 nM, as shown. This was consistent with the scFv studies described in Example 4.
Example 11. Use of Vγ4-specific Antibodies to Increase the Number of Primary Human Vγ4 T Cells
[0638] The antibody displaying the highest stimulatory activity on JRT3-hu17 cells (Clone G4_12,
[0639] SEQUENCES
TABLE-US-00007 SEQ ID NO. Description Sequence 1 Vγ4 chain of RSCB Protein Data Bank entry: 4MNH SSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDEKYYKKLFGSGTTLVVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADSRGGLEVLFQ 2-24 CDR3 heavy sequences See