FLOW PATH STRUCTURE, FLOW PATH STRUCTURE UNIT, AND METHOD FOR PRODUCING LIPID PARTICLE
20250235834 ยท 2025-07-24
Inventors
- Mitsuaki KATO (Kawasaki Kanagawa, JP)
- Masato Akita (Kawasaki Kanagawa, JP)
- Mitsuko ISHIHARA (Setagaya Tokyo, JP)
Cpc classification
B01F25/4323
PERFORMING OPERATIONS; TRANSPORTING
B01F25/4337
PERFORMING OPERATIONS; TRANSPORTING
B01F25/4331
PERFORMING OPERATIONS; TRANSPORTING
B01F25/10
PERFORMING OPERATIONS; TRANSPORTING
B01F33/3045
PERFORMING OPERATIONS; TRANSPORTING
International classification
B01F25/432
PERFORMING OPERATIONS; TRANSPORTING
B01F25/10
PERFORMING OPERATIONS; TRANSPORTING
B01F25/433
PERFORMING OPERATIONS; TRANSPORTING
Abstract
A flow path structure according to an embodiment includes three groups of flow paths connected by branch and merging portions. The first group connects to the second group via a branch portion, and the second group connects to the third group via a merging portion. The branch portion has openings on both the first and second group sides, while the merging portion has openings on both the second and third group sides. If the first group has N flow paths and the second group has M flow paths (where M is N or more), the total opening area of the second group's branch openings is at most M/N times that of the first group's branch openings. Additionally, at least one merging opening in the second group is equal to or smaller than at least one merging opening in the third group.
Claims
1. A flow path structure comprising: a first flow path group including one or more flow paths; a second flow path group connected to the first flow path group via a branch portion, the second flow path group including two or more flow paths; a third flow path group connected to the second flow path group via a merging portion, the third flow path group including one or more flow paths; the branch portion including a first flow path group side branch opening connected to an end of the flow path included in the first flow path group, the end being close to the second flow path group, and a second flow path group side branch opening connected to an end of the flow path included in the second flow path group, the end being close to the first flow path group; and the merging portion including a second flow path group side branch opening connected to an end of the second flow path group, the end being close to the third flow path group, and a third flow path group side branch opening connected to an end of the third flow path group, the end being close to the second flow path group, wherein when the first flow path group includes N flow paths, the second flow path group includes M flow paths, and M is N or more, a sum of opening areas of the second flow path group side branch openings is equal to or less than M/N times a sum of opening areas of the first flow path group side branch openings, and an opening area of at least one of the second flow path group side merging openings is equal to or smaller than an opening area of at least one of the third flow path group side merging openings.
2. The flow path structure according to claim 1, wherein an opening area of at least one of the second flow path group side branch openings is equal to or smaller than an opening area of at least one of the first flow path group side branch openings.
3. The flow path structure according to claim 1, wherein at least some of the flow paths included in the second flow path group has a structure in which a shape of a cross section perpendicular to a tube axis direction of the flow path continuously changes.
4. The flow path structure according to claim 3, wherein at least some of the flow paths included in the second flow path group has a structure in which a flow path depth continuously changes.
5. The flow path structure according to claim 3, wherein at least some of the flow paths included in the second flow path group has a structure in which a flow path width continuously changes.
6. The flow path structure according to claim 1, wherein a top surface of flow paths included in the first flow path group, the second flow path group, and the third flow path group is included in a single plane.
7. The flow path structure according to claim 1, wherein at least a part of top surfaces of the flow paths included in the first flow path group, the second flow path group, and the third flow path group is included in a first plane, and among bottom surfaces of the flow paths included in the first flow path group, the second flow path group, and the third flow path group, a bottom surface facing a top surface that is not included in at least the first plane is included in a second plane different from the first plane.
8. The flow path structure according to claim 1, wherein in at least one of the flow paths included in the second flow path group, an opening area of the second flow path group side merging opening is smaller than an opening area of the second flow path group side branch opening.
9. The flow path structure according to claim 8, wherein in at least one of the flow paths included in the second flow path group, an opening area of the second flow path group side merging opening is larger than an opening area of the second flow path group side branch opening.
10. The flow path structure according to claim 1, wherein a flow path width and a flow path depth of the second flow path group side merging opening are 5 m or more.
11. The flow path structure according to claim 1, wherein the second flow path group has an approximately point symmetric shape with a midpoint between the branch portion and the merging portion as a center point.
12. The flow path structure according to claim 1, wherein a depth of a flow path included in the flow path structure is equal to or less than a width of the flow path.
13. The flow path structure according to claim 1, wherein an opening area of the flow path included in the flow path structure is 100 mm.sup.2 or less.
14. The flow path structure according to claim 1, further comprising: an inlet capable of allowing two or more types of fluids to flow into at least one flow path included in the first flow path group.
15. The flow path structure according to claim 1, wherein at least some of the flow paths included in the first flow path group or at least some of the flow paths included in the third flow path group has a structure in which a shape of a cross section perpendicular to a tube axis direction of the flow path continuously changes as approaching the first branch portion.
16. A flow path structure comprising: a first flow path; a second flow path connected to the first flow path via a branch portion; a third flow path connected to the first flow path via the branch portion; a fourth flow path connected to the second flow path and the third flow path via a merging portion; the branch portion including a first branch opening connected to an end of the first flow path, the end being close to the second flow path and the third flow path, a second branch opening connected to an end of the second flow path, the end being close to the first flow path, and a third branch opening connected to an end of the third flow path, the end being close to the first flow path; and the merging portion including a second merging opening connected to an end of the second flow path, the end being close to the fourth flow path, a third merging opening connected to an end of the third flow path, the end being close to the fourth flow path, and a fourth merging opening connected to an end of the fourth flow path, the end being close to the second flow path and the third flow path, wherein a sum of opening areas of the second branch opening and the third branch opening is equal to or less than twice a sum of opening areas of the first branch opening, and an opening area of at least one of the second merging opening and the third merging opening is equal to or smaller than an opening area of the fourth merging opening.
17. A fluid structure unit comprising: a plurality of flow path structures according to claim 1.
18. A method for producing a lipid particle encapsulating a drug using the flow path structure according to claim 1, the method comprising: a step of causing a first solution containing a lipid of a material of the lipid particle to flow into an organic solvent from a first inflow port positioned on an upstream side of the first flow path group and causing a second solution containing the drug to flow into an aqueous solvent from a second inflow port positioned on an upstream side of the first flow path group to mix the first solution and the second solution to obtain a mixed solution; and a step of particulating the lipid and generating the lipid particle encapsulating the drug by reducing the concentration of the organic solvent in the mixed solution.
Description
DESCRIPTION OF THE DRAWINGS
[0004]
[0005]
[0006]
[0007]
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
DETAILED DESCRIPTION
[0029] A flow path structure according to an embodiment includes: a first flow path group, a second flow path group, a third flow path group, a branch portion, and a merging portion. The first flow path group includes one or more flow paths. The second flow path group is connected to the first flow path group via the branch portion, and includes two or more flow paths. The third flow path group is connected to the second flow path group via the merging portion, and includes one or more flow paths. The branch portion includes a first flow path group side branch opening connected to an end of the flow path included in the first flow path group, the end being close to the second flow path group, and a second flow path group side branch opening connected to an end of the flow path included in the second flow path group, the end being close to the first flow path group. The merging portion includes a second flow path group side merging opening connected to an end of the second flow path group, the end being close to the third flow path group, and a third flow path group side merging opening connected to an end of the third flow path group, the end being close to the second flow path group. Further, when the first flow path group includes N flow paths, the second flow path group includes M flow paths, and M is N or more, a sum of opening areas of the second flow path group side branch openings is equal to or less than M/N times a sum of opening areas of the first flow path group side branch openings, and an opening area of at least one of the second flow path group side merging openings is equal to or smaller than an opening area of at least one of the third flow path group side merging openings.
[0030] Embodiments will be described below with reference to the accompanying drawings. In each embodiment, substantially the same constituent parts will be given the same reference numerals, and some descriptions thereof will be omitted. The drawings are schematic, and the relationship between the thickness of each part and the planar dimension, the ratio of the thickness of each part, and the like may differ from the actual one.
[0031] When a fluid flows through the flow path structure, the direction of the main flow in the flow path is as shown by the arrow in
[0032] Furthermore, in the present specification, the term fluid is not limited to liquid, but may also be gas.
[0033] Furthermore, in the present specification, the term flow path refers to a space formed inside the flow path structure through which the fluid can flow. The flow path has openings on the upstream side and the downstream side of the fluid. The flow path has a wall surface made of a base material such as resin, glass, ceramics, or metal, and the top surface or the bottom surface of the flow path is sealed by the base material of the flow path structure.
First Embodiment
[0034]
[0035] In the present specification, unless otherwise specified, in
[0036] The flow path widths and the flow path depths of the first flow path 1, the second flow path 2, the third flow path 3, and the fourth flow path 4 are appropriately determined in consideration of various conditions such as the type and flow velocity of the fluid supplied to the flow path structure 100. For example, there is a Reynolds number Re as a numerical value in consideration of the shape of the flow path structure 100, the type of fluid, the flow velocity, and the like. The Reynolds number Re is a dimensionless numerical value defined by the following Formula (1) using [kg/m.sup.3]: density of the fluid, V [m/s]: velocity of the fluid, L [m]: representative length, and [Pas]: viscosity of the fluid.
[0037] In the calculation of the Reynolds number of the flow path according to the present embodiment, the hydraulic diameter d.sub.H is set as the representative length L. The hydraulic diameter d.sub.H is defined by the following Formula (2), where A is a flow path cross-sectional area and P is a flow path cross-sectional edge length.
[0038] The representative length L in obtaining the Reynolds number of the fluid flowing in the flow path is often the hydraulic diameter d.sub.H, but the flow path depth, the flow path width, the average value thereof, or the like may be used as the representative length.
[0039] In order to generate and sustain a swirling flow, the Reynolds number calculated from the above Formula (1) is preferably 10 or more in the flow path structure 100. In addition, the Reynolds number is preferably less than 2300 in the flow path structure 100 in order to generate a uniform swirling flow and avoid generation of a turbulent flow in the flow path. In particular, when the flow path width and the flow path depth of the first flow path 1 are defined as a reference width and a reference depth, respectively, the Reynolds number in a section having at least one of the reference width and the reference depth in the flow path is preferably 10 or more. In addition, the Reynolds number is preferably less than 2300 at the third branch opening 53 and the second merging opening 62 where the area of the flow path cross section perpendicular to the tube axis direction in the flow path is the smallest in the drawing. In order to further promote the generation of a uniform swirling flow and further prevent the generation of a turbulent flow in the flow path, it is more preferable that the Reynolds number be approximately 50 or more and 1000 or less in the entire flow path structure 100.
[0040] Hereinafter, each part of the flow path structure 100 in the present embodiment will be described in detail.
[0041] The first flow path 1 shown in
[0042] The branch portion 5 shown in
[0043] The second branch opening 52 refers to an end of the second flow path, an end of the branch portion, and a boundary between the second flow path and the branch portion. The third branch opening 53 is an end of the third flow path, an end of the branch portion, and a boundary between the third flow path and the branch portion. In the present embodiment, an example is shown in which the flow path width changes across the first branch opening 51, and the second branch opening 52 and the third branch opening 53 are adjacent to each other. As shown in the present example, the cross sections of the second flow path 2 having the second branch opening 52 as an end and the third flow path 3 having the third branch opening 3 as an end do not overlap each other. In the present example, on the inside of the branch portion 5, the cross-sectional area of the flow path decreases from the branch portion 5 side to the first flow path 1. A location where the reduction stops is referred to as the first branch opening 51. Similarly, on the inside of the branch portion 5, a location where the reduction of the cross-sectional area from the branch portion 5 side to the second flow path 2 stops is referred to as the second branch opening 52, and a location where the reduction of the cross-sectional area from the branch portion 5 side to the third flow path 3 stops is referred to as the third branch opening 53. Further, the plane including the first branch opening 51 defines the first branch opening 51 as being perpendicular to the tube axis direction in the first flow path 1. Similarly, the plane including the second branch opening 52 is perpendicular to the tube axis direction in the second flow path 2, and the plane including the third branch opening 53 is perpendicular to the tube axis direction in the third flow path 3. That is, the branch portion 5 corresponds to a shaded region 5 in
[0044]
[0045] As shown in
[0046] An opening area of at least one of the second merging opening 62 and the third merging opening 63 is equal to or smaller than an opening area of the fourth merging opening 64. In the present embodiment, an opening area S62 of the second merging opening 62 is equal to or smaller than an opening area S64 of the fourth merging opening 64. S62 is smaller than S64 and an opening area S63 of the third merging opening 63. Further, in the vicinity of the second merging opening 62, the flow path depth of the second flow path 2 is shallower than the flow path depths of the third flow path 3 and the fourth flow path 4. Further, the normal direction of the second merging opening 62 is different from the tube axis direction of the third flow path 3 and fourth flow path 4. With this structure, the fluid flowing from the second flow path 2 into the merging portion 6 collides with at least a part of the wall surface of the merging portion 6 and the wall surfaces of the third flow path 3 and the fourth flow path 4, and accordingly, a vortex having a velocity component substantially perpendicular to the wall surface colliding with the fluid flowing from the second flow path 2 into the merging portion 6 and a velocity component in the flow path depth direction is generated, and further, the fluid is merged with the fluid supplied from the third flow path 3 to form a swirling flow (swirl) 13 in which the tube axis direction and the rotation axis of the fourth flow path are parallel to each other. As described above, in the merging portion 6, the end of at least one flow path on the upstream side is made shallow, and a difference is made between the normal direction of the end surface of the flow path made shallow and the tube axis direction of the flow path on the downstream side, and accordingly, a swirling flow can be generated.
[0047]
[0048] The third flow path 3 in the present embodiment is substantially symmetric with respect to the second flow path 2. For example, in the second flow path 2, the opening area S62 of the second merging opening 62 is smaller than the opening area S52 of the second branch opening 52, and the cross-sectional area of the second flow path 2 decreases from upstream to downstream, whereas in the third flow path 3, the opening area S63 of the third merging opening 63 is larger than the opening area S53 of the third branch opening 53, and the cross-sectional area of the third flow path 3 increases from upstream to downstream. In addition, a value obtained by dividing S62 by S52 is preferably 0.5 times or more and 2.0 times or less, and more preferably 0.8 times or more and 1.2 times or less a value obtained by dividing S53 by S63. Further, it is most preferable that a value obtained by dividing S62 by S52 be equal to a value obtained by dividing S53 by S63.
[0049] In the flow path structure 100 according to the present embodiment, S52 is 0.5 times or more and 2.0 times or less of S63, or/and S53 is preferably 0.5 times or more and 2.0 times or less of S62, S52 is 0.8 times or more and 1.2 times or less of S63, or/and S53 is more preferably 0.8 times or more and 1.2 times or less of S62. In addition, it is most preferable that S52 and S63 be equal, and/or S53 and S62 be equal. In the present embodiment, S53 is equal to S62, and S63 is equal to S52.
[0050] In this manner, by making the structures of each end of the second flow path 2 and the third flow path 3 symmetric, it is possible to bring the flow rates of the fluids flowing through the second flow path and the third flow path 3 close to each other. The larger the flow rate difference between the second flow path 2 and the third flow path 3, the more difficult it is to mix quickly, and there is a possibility that it is difficult to adjust the pressure in the flow path with the smaller flow rate. Therefore, from the viewpoint of the robustness of the product, it is preferable to distribute the flow approximately equally.
[0051] Note that, since the precision of die molding or cutting, which is a preferable method for producing the flow path structure 100, is generally 5 m, in consideration of the precision in flow path machining, the flow path depth d6 is desirably 10 m or more.
[0052] In order to generate a uniform swirling flow and avoid the occurrence of a turbulent flow and cavitation in the flow path, it is preferable to avoid excessively reducing the flow path depth d6 and excessively reducing the opening area of the second merging opening 62. In order to avoid the generation of a turbulent flow, it is preferable to set the opening area such that the Reynolds number is less than 2300. Further, from the viewpoint of suppressing cavitation and avoiding clogging due to bubbles or the like in the flow path, the flow path width and the flow path depth of the first to third branch openings (51, 52, 53) and the second to fourth merging openings (62, 63, 64) are preferably 5 m or more.
[0053] At least a part of the second flow path 2 and the third flow path 3 has a structure in which the shape of a cross section perpendicular to the tube axis direction of the flow path continuously changes. For example, in the present embodiment, the shape of the cross section perpendicular to the tube axis direction of the second flow path 2 continuously changes from the second branch opening 52 toward the second merging opening 62, and the shape of the cross section perpendicular to the tube axis direction of the third flow path 3 continuously changes from the third branch opening 53 toward the third merging opening 63. Here, continuously change means that the shape of the flow path changes smoothly and the shape of the cross section does not suddenly change. In the second flow path 2 and the third flow path 3, it is preferable that the area of the flow path cross section continuously change from the upstream side to the downstream side, the shape of the flow path smoothly change, and the cross-sectional area do not suddenly change. According to the present embodiment, since the flow path width is constant, at least a part of the second flow path 2 has a structure in which the flow path depth continuously changes. Here, continuously change means that the shape of the flow path smoothly changes and the flow path depth does not suddenly change. In general, vortices accompanied by a reverse flow formed by a fluid that cannot follow the main flow may be generated on the downstream side at a location where the area of the flow path cross section suddenly increases, and on the upstream side at a location where the area of the flow path cross section suddenly decreases. Therefore, by designing the second flow path 2 and the third flow path 3 such that the area of the flow path cross section does not suddenly change from the upstream side to the downstream side, it is possible to suppress the generation of vortices accompanied by a reverse flow in the second flow path and the third flow path 3. In the second flow path 2 and the third flow path 3 shown in
[0054] As described above, by limiting the upper limit value of the divergence angle in the flow path accompanied by enlargement or reduction of the cross-sectional area, it is possible to suppress the generation of vortices accompanied by a reverse flow due to the reverse pressure gradient.
[0055]
[0056] In
[0057] It is preferable that the second flow path 2 and the third flow path 3, including the intermediate flow paths other than each end of the second flow path 2 and the third flow path 3, have an approximately point symmetric shape with a midpoint between the branch portion 5 and the merging portion 6 as a center point 20. The center point 20 is the midpoint of the line segment that connects the intersection point on the branch portion 5 side and the intersection point on the branching portion 6 side of the extension lines of the tube axes of each of the second flow path 2 and the third flow path 3 when viewed from a cross section parallel to the paper surface of
[0058] Above, an example was described in which the tube axis direction of the second flow path 2 and the third flow path 3, the angle between the bottom surface and the top surface, and the cross-sectional area of the flow path change uniformly over the entire area of the second flow path 2. In this manner, by making changes in the entire area of the second flow path 2 and the third flow path 3 and increasing the region where the tube axis direction and the cross-sectional area change, it is possible to suppress the rate of change in the tube axis direction of the flow path, the angle between the bottom surface and the top surface, and the cross-sectional area of the flow path. Therefore, from the viewpoint of suppressing vortices accompanied by a reverse flow in the second flow path 2 and the third flow path 3, it is preferable to make changes in the entire area of the second flow path 2 and the third flow path 3. However, the tube axis direction of the flow path, the angle between the bottom surface and the top surface, and the cross-sectional area of the flow path do not necessarily need to make changes in the entire area of the second flow path 2 and the third flow path 3.
[0059] The flow path width of the fourth flow path 4 in the present embodiment is constant. The end on the upstream side of the fourth flow path 4 and the merging portion 6 are connected to each other via the fourth merging opening 64. The opening on the downstream side of the fourth flow path 4 may be connected to a flow path structure other than the flow path structure 100.
[0060] In the fourth flow path 4, the swirling flow 13 is formed (
[0061] By using such a flow path structure 100 for mixing fluids, it is possible to effectively mix fluids due to the swirling flow generated within the flow path. For example, when a solvent is mixed with a solution and stirred, the solution becomes diluted compared to the state before mixing. At this time, more uniform dilution can be achieved by effectively mixing and even stirring the fluids.
[0062] In the present embodiment, the case where both the reference flow path width and the reference flow path depth are 0.3 mm has been described as an example, but the dimensions of the flow path do not have to be of this order. The opening area of the flow path included in the flow path structure 100 is preferably 100 mm.sup.2 or less, but from the viewpoint of reducing pressure loss, suppressing cavitation, and avoiding clogging due to bubbles in the flow path, the flow path width and the flow path depth are preferably 5 m or more.
[0063] In addition, in the present embodiment, from the viewpoint of ensuring the strength of the mold for mass-producing the flow path, when the flow path depth is defined as L and the flow path width is defined as W, it is preferable that the ratio L/W be 1 or less.
[0064] Note that the flow path side surface of the flow path structure 100 shown in
[0065]
(First Modification)
[0066]
(Second Modification)
[0067] In the first embodiment, an example has been described in which the flow path structure 100 uniformly changes the tube axis direction of the flow path, the angle formed by the bottom surface and the top surface, and the cross-sectional area of the flow path in the entire region of the second flow path 2 or the third flow path 3 in the entire range from the branch portion 5 to the merging portion 6, but the region where the tube axis direction of the flow path, the angle formed by the bottom surface and the top surface, and the cross-sectional area of the flow path change may not be the entire region. In addition, in the second flow path 2 and the third flow path 3, the rate of change in the tube axis direction of the flow path, the angle formed by the bottom surface and the top surface, or the cross-sectional area of the flow path may not be constant. In the present modification, the flow path structure 100 having a region where the angle formed by the bottom surface and the top surface does not change in the second flow path 2 and the third flow path 3 will be described.
(Third Modification)
[0068]
(Fourth Modification)
[0069]
[0070] Although not shown, when another flow path structure 100 is further provided on the downstream side of the flow path structure and used, the fourth flow path 4 in the drawing is connected to the branch portion 5 of another flow path structure. At this time, assuming that a region of the fourth flow path 4 far from the merging portion 6 in the drawing is defined as a region 4b, and a region between the region 4b and the merging portion 6 in the drawing is defined as a region 4a, the cross-sectional area of the region 4b increases from the region 4a toward the branch portion 5 of another flow path structure. A divergence angle 9 of the region 4b is preferably 10 or less similarly to 8, but 8 and 9 do not necessarily have to be the same value.
(Fifth Modification)
[0071]
(Sixth Modification)
[0072]
(Seventh Modification)
[0073]
[0074] The merging portion 6 according to the present embodiment does not necessarily have a substantially line symmetric shape with the tube axis direction of the first flow path 1 as an axis. For example, in
[0075] With such a configuration, it is possible to alleviate the collision of the flow flowing out from the third flow path 3 with the side surface of the merging portion 6 and to suppress the generation of the vortex accompanied by a reverse flow.
Second Embodiment
[0076]
(First Modification)
[0077]
Third Embodiment
[0078] In the first and second embodiments, an example has been described in which one first flow path 1 is provided on the upstream side of the branch portion 5, two flow paths of the second flow path 2 and the third flow path 3 are provided on the downstream side of the branch portion 5, and one fourth flow path 4 is provided on the downstream side of the merging portion 6, but the number of flow paths is not limited thereto.
[0079] In a case where Sj/Si is larger than 1, it is possible to suppress vortices accompanied by a reverse flow as the Sj/Si approaches 1, but there is a possibility that an excessive pressure loss occurs in a pipe in which the cross-sectional area is narrowed in an attempt to approach 1. In addition, when there are foreign matters, there is a possibility of causing blockage. Therefore, by experiment or simulation, while Sj/Si is changed to a smaller value of, for example, 1.0(M/N), 0.9(M/N), 0.8(M/N) . . . as Si and Sj are brought closer to each other, a condition having Sj/Si closest to 1 may be set among setting conditions under which desired indices, such as the suppression degree of vortices accompanied by a reverse flow, the mixing degree, the dilution degree, the product quality (particle size distribution and encapsulated substance concentration), the precision in flow path machining, the pressure loss, or the robustness against foreign matters, are determined to be appropriate based on the experiment result.
[0080] The opening area of at least one of the second flow path group side branch openings 52b is equal to or smaller than the opening area of at least one of the first flow path group side branch openings 51b.
[0081] Since the second flow path group side merging opening 62b is a boundary between each flow path included in the second flow path group 20 and the merging portion 6b, there are as many second flow path group side merging openings 62b as the number (M) of the flow paths included in the second flow path group 20. Similarly, since the third flow path group side merging opening 63b is a boundary between each flow path included in the third flow path group 30 and the merging portion 6b, there are as many third flow path group side merging openings 63b as the number (O) of the flow paths included in the third flow path group 30. In the j-th opening area Sj of the second flow path group side merging opening 62b and the k-th opening area Sk of the third flow path group side merging opening 63b, at least one of Sj may be smaller than at least one of Sk.
[0082] The flow path included in the second flow path group 20 is a flow path that connects the branch portion 5b and the merging portion 6b to each other. In at least one flow path included in the second flow path group 20, the opening area of the second flow path group side merging opening 62b is smaller than the opening area of the second flow path group side branch opening 52b, and the cross-sectional area of the flow path decreases from upstream to downstream.
[0083] In addition, at least some of the flow paths included in the second flow path group 20 has a structure in which the shape of the cross section perpendicular to the tube axis direction of the flow path continuously changes. For example, a structure in which the flow path depth continuously changes or a structure in which the flow path width continuously changes may be used.
[0084] The top surfaces of the flow paths included in the first flow path group 10, the second flow path group 20, and the third flow path group 30 are preferably included in a single plane. By designing the top surface to be included in a single plane, as shown in
[0085] In at least one of the flow paths included in the second flow path group 20, the opening area of the second flow path group side merging opening 62b is preferably smaller than the opening area of the second flow path group side branch opening 52b, and in at least another one of the flow paths included in the second flow path group 20, the opening area of the second flow path group side branch opening 62b is preferably larger than the opening area of the second flow path group side branch opening 52b. That is, the second flow path group 20 preferably includes a flow path of which the flow path cross-sectional area increases from upstream to downstream and a flow path of which the flow path cross-sectional area decreases from upstream to downstream. As an example, a structure in which the flow path cross-sectional area of the j-th flow path included in the second flow path group 20 increases from upstream to downstream, and the flow path cross-sectional area of the (Mj+1)-th flow path included in the second flow path group 20 decreases from upstream to downstream is also preferable.
[0086] In addition, the flow path width and the flow path depth of the flow path included in the flow path structure 100b are preferably 5 m or more. At least, the flow path width and the flow path depth may be 5 m or more at a location where the flow path cross-sectional area is the smallest. That is, the flow path width and the flow path depth of the second flow path group side merging opening 62b are preferably 5 m or more. In addition, the depth of the flow path included in the flow path structure 100b is preferably equal to or less than the width of the flow path. Further, the opening area of the flow path included in the flow path structure 100b is preferably 100 mm.sup.2 or less.
[0087] In addition, it is preferable that the second flow path group 20 have a point symmetric shape with a midpoint between the branch portion 5b and the merging portion 6b as a center point. As an example, a value obtained by dividing the opening area of the opening connected to the j-th flow path included in the second flow path group 20 in the second flow path group side merging opening 62b by the opening area of the opening connected to the j-th flow path included in the second flow path group 20 in the second flow path group side branch opening 52b is preferably 0.5 times or more and 2.0 times or less, and more preferably 0.8 times or more and 1.2 times or less a value obtained by dividing the opening area of the opening connected to the (Mj+1)-th flow path included in the second flow path group 20 in the second flow path group side branch opening 52b by the opening area of the opening connected to the (Mj+1)-th flow path included in the second flow path group 20 in the second flow path group side merging opening 62b. It is most preferable that this value is 1.0 times.
[0088] In addition, in the flow path structure 100b according to the present embodiment, preferably, the opening area of the opening connected to the j-th flow path included in the second flow path group 20 in the second flow path group side branch opening 52b is 0.5 times or more and 2.0 times or less the opening area of the opening connected to the (Mj+1)-th flow path included in the second flow path group 20 in the second flow path group side branch opening 62b, or/and the opening area of the opening connected to the (Mj+1)-th flow path included in the second flow path group 20 in the second flow path group side branch opening 52b is preferably 0.5 times or more and 2.0 times or less the opening area of the opening connected to the j-th flow path included in the second flow path group 20 in the second flow path group side merging opening 62b. These values are more preferably 0.8 times or more and 1.2 times or less, and most preferably 1.0 times.
[0089] In addition, similar to the flow path structure 100 shown in
[0090] Further, a plurality of the flow path structures 100b may be used as a fluid structure unit.
[0091] Note that the flow path structure 100b may further include a configuration such as an inlet 80 that allows two or more types of fluids to flow into at least one flow path included in the first flow path group 10.
Fourth Embodiment
[0092]
[0093] Although the number of the flow path structures included in the flow path structure unit 300 shown in the drawing is three, the number of the flow path structures may be one, two, or four or more.
[0094] In addition, although an aspect in which a plurality of the flow path structures are connected to each other in series is shown in the drawing, a method for connecting the flow path structures to each other is not limited thereto, and a structure in which the flow path structures are connected to each other in parallel via the branch portion 5 or the like may be included.
[0095] In addition, since the inlet 80 in the drawing has two inflow ports, it is possible to allow two types of fluids to flow in, but the number of inflow ports and the number of types of liquids are not limited thereto. The inlet 80 may have three or more inflow ports and allow three or more types of liquids to flow in.
Fourth Embodiment
[0096] In the present embodiment, a method for producing the flow path structure (hereinafter collectively referred to as the flow path structure 100) described in the first to third embodiments will be described below with reference to
[0097] The material of the substrate 102 may be appropriately selected from resins such as acrylic, polyethylene, polypropylene, and polycarbonate, glass, ceramics, metal, and the like according to the application. For example, when the flow path structure 100 is for medical use, a cycloolefin polymer (COP) or the like is also a preferred example. Ceramics such as glass and quartz are preferable from the viewpoint of stability when reused many times, and a metal having a surface subjected to a treatment for corrosion resistance may be used when the temperature and the like are adjusted. The groove 101 can be formed by press working or cutting using a mold, for example. In the location corresponding to the shallow portion, the groove 101 may be formed or cut shallower than other parts.
[0098] As the material of the lid 103, for example, the same material as that described for the substrate 102 can be used. The lid 103 may have, for example, a plate shape. Alternatively, as shown in
[0099] It is also possible to attach a sensor terminal 105 for monitoring the state of the fluid to the film-like lid 104. Alternatively, it is also possible to impart various functions or characteristics such as high thermal conductivity or a function (not shown) of performing a specific treatment on a specific substance to the film-like lid 104.
[0100] When there is a concern that the film-like lid 104 may swell due to the internal pressure, as shown in
[0101] Thus, the flow path structure 100 can be produced by a simple procedure in which the groove 101 is formed in the substrate 102 and the lid 103 or the film-like lid 104 is joined. Therefore, for example, it is unnecessary to form grooves in both the substrate 102 and the lid 103 and to precisely align the substrate 102 and the lid 103, and thus mass productivity is extremely high.
[0102] Further, the depth of the groove 101 at the location where the flow path depth becomes smaller may be set to the same depth as the other parts, and the film-like lid 104 of which the thickness changes depending on the position may be attached to the corresponding location to form a flow path of which the flow path depth changes. That is, in the flow path formed in this manner, the flow path depth changes as the thickness of the top surface changes depending on the position. Even in such a structure, highly uniform mixing can be realized as in a structure in which the shape of the bottom surface changes depending on the position.
Fifth Embodiment
[0103] In the present embodiment, a fluid stirring method is provided. The fluid stirring method includes causing a fluid to be stirred to flow into the flow path structure 100 of the embodiment. According to the fluid stirring method, the fluid can be further mixed and stirred by using the flow path structure 100 of the embodiment.
[0104] In the case of using the flow path structure 100 of the first to fourth embodiments, the present method includes causing a fluid to flow from the first flow path 1 through the second flow path 2 or the third flow path 3 to the fourth flow path 4.
[0105] Furthermore, in the present method, the fluid flowing in the flow path may be two or more different types of fluids, and according to the flow path structure 100 of the first to fourth embodiments, these fluids can be mixed and stirred.
Sixth Embodiment
[0106] In the present embodiment, a method for producing a lipid particle 200 encapsulating a drug 202 using the flow path structure 100 of the embodiment will be described.
[0107] First, the lipid particle 200 produced by the present method will be described. As shown in
[0108]
[0109] Hereinafter, an example of a procedure of the present producing method will be described.
[0110] First, the first solution and the second solution are prepared. The first solution contains a lipid in an organic solvent. The lipid is a lipid to be a material constituting the lipid particle 200. The second solution contains the drug 202 in an aqueous solvent.
Condensation Step S1
[0111] The drug 202 is, for example, but not limited to, a nucleic acid. The nucleic acid drug 202 is, for example, a nucleic acid containing DNA, RNA, and/or other nucleotides, and may be, for example, mRNA of a specific gene, DNA encoding a gene, DNA containing a gene expression cassette containing a gene and other sequences for expressing a gene such as a promoter, a vector, or the like. When the drug 202 is a nucleic acid, the aggregation step S1 of aggregating the nucleic acid (drug 202) may be first performed.
[0112] The condensation of the nucleic acid is performed using, for example, a nucleic acid condensing peptide. The nucleic acid condensing peptide can further reduce the particle size of the lipid particle 200 by condensing the nucleic acid into a small size, and can encapsulate more nucleic acid in the lipid particle 200. As a result, less nucleic acid may remain outside the lipid particle 200 that may cause aggregation of the lipid particle 200.
[0113] A preferred nucleic acid condensing peptide is, for example, a peptide containing 45% or more cationic amino acids as a whole. A more preferred nucleic acid condensing peptide has RRRRRR (first amino acid sequence) at one end and has the sequence ROROR (second amino acid sequence) at the other end. Between the first amino acid sequence and the second amino acid sequence, 0 or 1 or more intermediate sequences consisting of RRRRRR or RORQR are included. In addition, two or more neutral amino acids are contained between two adjacent sequences among the first amino acid sequence, the second amino acid sequence, and the intermediate sequence. The neutral amino acid is, for example, G or Y. The other end may have RRRRRR (first amino acid sequence) instead of the second amino acid sequence.
[0114] The nucleic acid condensing peptide preferably has the following amino acid sequence:
TABLE-US-00001 (SEQIDNO:1) RQRQRYYRQRQRGGRRRRRR (SEQIDNO:2) RQRQRGGRRRRRR (SEQIDNO:3) RRRRRRYYRQRQRGGRRRRRR.
[0115] Furthermore, a nucleic acid condensing peptide having the following amino acid sequence can also be used in combination with any of the nucleic acid condensing peptides described above. This peptide can further condense the nucleic acid condensate condensed with the nucleic acid condensing peptide.
TABLE-US-00002 (SEQIDNO:4) GNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY(M9)
[0116] As shown in
[0117] The condensation step S1 is not necessarily performed using a flow path, and the aggregating agent and the solution containing the nucleic acid (drug 202) in the aqueous solvent may be mixed and stirred.
[0118] From the viewpoint of achieving the above effect, it is preferable to perform the condensation step S1 when the drug 202 is a nucleic acid. However, when the drug 202 is not a nucleic acid, or when the drug is a nucleic acid but does not need to be condensed, it is not necessary to perform the condensation step S1.
Mixing Step S2
[0119] Next, the first solution and the second solution are mixed. The second solution may be prepared as described above when the drug 202 is a nucleic acid. Alternatively, when the nucleic acid that does not condense or the drug 202 that is not a nucleic acid is used, the second solution can be prepared by mixing the drug 202 with any of the aqueous solvents selected according to the type thereof. The drug 202 that is not a nucleic acid includes, for example, a protein, a peptide, an amino acid, another organic compound, an inorganic compound, or the like as an active component. The drug 202 may be, for example, a therapeutic agent or diagnostic agent for a disease. However, the drug 202 is not limited thereto, and may be any substance as long as the drug 202 can be encapsulated in the lipid particle 200.
[0120] If necessary, the drug 202 may further contain a reagent such as, for example, a pH adjusting agent, an osmotic pressure adjusting agent, and/or a drug activating agent. The pH adjusting agent is, for example, an organic acid such as citric acid and a salt thereof. The osmotic pressure adjusting agent is a sugar, an amino acid, or the like. The drug activating agent is, for example, a reagent that assists the activity of the active ingredient. These may be added after the condensation step S1 is performed.
[0121] The drug 202 may be a single substance or may contain a plurality of substances. The concentration of the drug 202 in the second solution is preferably, for example, 0.01% to 1.0% (weight).
[0122] The first solution can be produced by mixing a lipid and an organic solvent. The lipid may be, for example, a lipid of a main component of a biological membrane. The lipid may be artificially synthesized. The lipid can include, for example, a base lipid such as a phospholipid or a sphingolipid, for example, diacylphosphatidylcholine, diacylphosphatidylethanolamine, ceramide, sphingomyelin, dihydrosphingomyelin, cephalin, or cerebroside, or a combination thereof.
[0123] For example, as base lipids, [0124] it is preferable to use 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), [0125] 1,2-stearoyl-sn-glycero-3-phosphoethanolamine (DSPE), [0126] 1,2-dipalmitoyl-sn-glycero-3-phosphatidylcholine (DPPC), [0127] 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphatidylcholine (POPC), [0128] 1,2-di-O-octadecyl-3-trimethylammoniumpropane (DOTMA), [0129] 1,2-dioleoyl-3-dimethylammoniumpropane (DODAP), [0130] 1,2-dimyristoyl-3-dimethylammoniumpropane (14:0 DAP), [0131] 1,2-dipalmitoyl-3-dimethylammoniumpropane (16:0 DAP), [0132] 1,2-distearoyl-3-dimethylammoniumpropane (18:0 DAP), [0133] N-(4-carboxybenzyl)-N, N-dimethyl-2,3-bis(oleoyloxy) propane (DOBAQ), [0134] 1,2-dioleoyl-3-trimethylammoniumpropane (DOTAP), [0135] 1,2-dioleoyl-sn-glycero-3-phosphochlorin (DOPC), [0136] 1,2-dilinoleoyl-sn-glycero-3-phosphochlorin (DLPC), [0137] 1,2-dioleoyl-sn-glycero-3 phospho-L-serine (DOPS), or cholesterol, [0138] cholesterol, or a combination of any of these. In particular, it is preferable to use DOTAP and/or DOPE.
[0139] The lipid preferably further includes a first lipid compound and/or a second lipid compound that are biodegradable lipids. The first lipid compound can be represented by the formula Q-CHR.sub.2.
[0140] In the formula, [0141] Q is a nitrogen-containing aliphatic group containing two or more tertiary nitrogen atoms and no oxygen, [0142] R is each independently an aliphatic group of C.sub.12 to C.sub.24, and [0143] at least one R contains, in the main chain or side chain, a linking group LR selected from the group consisting of C(O)O, OC(O), OC(O)O, SC(O), C(O)S, C(O)NH, and NHC(O).
[0144] The first lipid compound is, for example, a lipid having a structure represented by the following formulas.
##STR00001##
##STR00002## ##STR00003## ##STR00004##
[0145] In particular, it is preferable to use a lipid compound of Formula (1-01) and/or a lipid compound of Formula (1-02).
[0146] The second lipid compound can be represented by the formula
P[XWYWZ].sub.2.
[0147] In the formula, [0148] P is an alkyleneoxy containing one or more ether bonds in the main chain, [0149] X is each independently a divalent linking group containing a tertiary amine structure, [0150] W is each independently a C.sub.1 to C.sub.6 alkylene, [0151] Y is each independently a divalent linking group selected from the group consisting of a single bond, an ether bond, a carboxylic acid ester bond, a thiocarboxylic acid ester bond, a thioester bond, an amide bond, a carbamate bond, and a urea bond, [0152] W is each independently a single bond or a C.sub.1 to C.sub.6 alkylene, and [0153] Z is each independently a fat-soluble vitamin residue, a sterol residue, or a C.sub.12 to C.sub.22 aliphatic hydrocarbon group.
[0154] The second lipid compound is, for example, a lipid having a structure represented by the following formulas.
##STR00005## ##STR00006## ##STR00007##
[0155] In particular, it is preferable to use a compound of Formula (2-01).
[0156] When the first lipid compound and the second lipid compound are contained, it is possible to increase the encapsulation amount of the drug 202 in the lipid particle 200 and to increase the introduction efficiency of the drug 202 into cells. In addition, cell death of the introduced cells can also be reduced.
[0157] The base lipid is preferably contained in an amount of 30% to approximately 80% (molar ratio) with respect to the total lipid material. Alternatively, nearly 100% may be composed of base lipids. The first and second lipid compounds are preferably contained in an amount of approximately 20% to approximately 70% (molar ratio) with respect to the total lipid material.
[0158] It is also preferable that the lipid contain a lipid that prevents aggregation of the lipid particles 200. For example, the lipid that prevents aggregation preferably further includes lipid, a PEG-modified for example, polyethylene glycol (PEG) dimyristoyl glycerol (DMG-PEG), a polyamide oligomer (U.S. Pat. No. 6,320,017) derived from an omega-amino (oligoethylene glycol) alkanoic acid monomer, monosialoganglioside, or the like. Such a lipid is preferably contained in an amount of approximately 1% to approximately 10% (molar ratio) with respect to the entire lipid material of the lipid particle 200.
[0159] The lipid may further include a lipid such as a relatively less toxic lipid for modulating toxicity, a lipid having a functional group that binds ligands to the lipid particle 200, and a lipid for suppressing leakage of an encapsulated substance such as sterol, for example, cholesterol. In particular, it is preferable to contain cholesterol.
[0160] For example, the lipid particle 200 preferably contains a compound of Formula (1-01) or Formula (1-02) and/or a compound of Formula (2-01), DOPE and/or DOTAP, cholesterol, and DMG-PEG.
[0161] The type and composition of the lipid are appropriately selected in consideration of the target acid dissociation constant (pKa) of the lipid particle 200 or the size of the lipid particle 200, the type of the encapsulated substance, stability in the cell to be introduced, and the like. For example, in order to obtain a desired composition of lipids constituting the lipid particle 200, the composition of lipids contained in the first solution may be set to the same ratio.
[0162] The organic solvent of the first solution is, for example, ethanol, methanol, isopropyl alcohol, ether, chloroform, benzene, acetone, or the like. The concentration of the lipid in the organic solvent is preferably, for example, 0.1% to 0.5% (weight).
[0163] The first solution and the second solution are mixed using the flow path structure 302 of the embodiment as shown in
[0164] When the aggregation step S1 is performed, the downstream end of the flow path 315 of the aggregation flow path structure 301 is connected to one end of the inlet 80 of the flow path structure 302 of the embodiment, and the second solution is supplied therefrom. When the condensation step S1 is not performed, a second solution inflow port (not shown) is provided at one end upstream of the inlet 80, and the second solution is supplied therefrom. The other upstream end of the inlet 80 includes, for example, a first solution inflow port 321 at the upstream end thereof, and the first solution is supplied therefrom. As a result, the first solution and the second solution are mixed to obtain a mixed solution. When the flow path structure unit 300 is provided, the mixed solution is further mixed and stirred therein. For example, when the condensation step S1 is not performed, the first solution may be caused to flow to one upstream end of the inlet 80, and the second solution may be caused to flow to the first solution inflow port 321.
Particulation Step S3
[0165] Next, in the particulation step S3, the concentration of the organic solvent in the mixed solution is reduced. For example, it is preferable to relatively reduce the organic solvent concentration by adding a large amount of the aqueous solution to the mixed solution. For example, three times the amount of the aqueous solution of the mixed solution is added to the mixed solution. As the aqueous solution, the same aqueous solvent as that used for the first solution can be used. By reducing the organic solvent concentration, the lipid can be particulated, and the lipid particle 200 encapsulating the drug 202 can be generated. As a result, a lipid particle solution containing the lipid particles 200 is obtained.
[0166] As shown in
[0167] The particulation step S3 is not necessarily performed using a flow path, and for example, an aqueous solution may be added to the mixed solution recovered in the container.
[0168] In this manner, the lipid particle 200 can be produced.
Concentration Step S4
[0169] The method for producing a lipid particle of the embodiment may further include concentrating the lipid particle solution as necessary (concentration step S4). The concentration is performed, for example, by removing a part of the solvent and/or excess lipid and the drug 202 from the lipid particle solution. The concentration can be performed, for example, by ultrafiltration. For ultrafiltration, for example, an ultrafiltration filter having a pore diameter of 2 nm to 100 nm is preferably used. For example, Amicon (registered trademark) Ultra-15 (Merck) or the like can be used as the filter. By performing the concentration step S4, a lipid particle solution having high purity and concentration can be obtained. The concentration of the lipid particles 200 in the lipid particle solution after concentration is preferably approximately 110.sup.13 particles/mL to 510.sup.13 particles/mL. However, the concentration step S4 is not necessarily performed.
[0170] As shown in
[0171] The filter 342 is provided instead of, for example, a partial wall surface of the flow path 341. Any of the ultrafiltration filters described above can be used as the filter 342.
[0172] When the lipid particle solution flows into the flow path 341, the remaining material, the extra solvent, and the like pass through the filter 342 and are discharged to the outside of the flow path 341, the lipid particles 200 remain in the flow path 341 and flow downstream, and accordingly, the lipid particle solution is concentrated. The downstream end of the flow path 341 may include a discharge port 343 for recovering the lipid particle solution after concentration, or may be connected to a tank for recovering the lipid particle solution.
[0173] The concentration step S4 is not necessarily performed using a flow path, and for example, the lipid particle solution recovered in the container may be filtered by a filter.
[0174] In addition, in the method for producing a lipid particle of the embodiment, a treatment for improving the quality of the lipid particle 200 may be further performed as necessary. The improvement in quality can be, for example, prevention of leakage of the drug 202 from the lipid particles 200, improvement in the encapsulation amount of the drug 202 in the lipid particles 200, improvement in the ratio (encapsulation rate) of the lipid particles 200 encapsulating the drug 202, reduction and prevention of aggregation of the lipid particles 200, and/or reduction in variation in the size of the lipid particles 200. For example, a treatment for cooling the lipid particle solution may be performed. Such treatment may also be performed using a flow path.
[0175] Each of the above-described flow paths is, for example, a micro flow path. The flow of the fluid in the flow path, the injection of the fluid into the flow path, the extraction of the fluid from the tank, and/or the accommodation of the lipid particle solution into the container can be performed by, for example, a pump or an extrusion mechanism configured and controlled to automatically perform these operations.
[0176] The method for producing a lipid particle of the embodiment does not necessarily need to perform the condensation step S1 and the concentration step S4 as described above, and may include at least the mixing step S2 and the particulation step S3.
[0177] According to the method for producing lipid particles of the embodiment, since the mixing step S2 is performed using the flow path structure of the embodiment, the first solution and the second solution can be uniformly and well mixed and stirred, and it is possible to produce the lipid particles 200 with higher quality. For example, effects such as improvement of the encapsulation amount of the drug 202, reduction of the average particle diameter of the lipid particles 200, and improvement of the ratio of the lipid particles 200 encapsulating the drug 202 can be obtained.
[0178] In addition, in the production of the quality particles described in the present specification, the flow path structure 100b shown in the third embodiment may be used.
[0179] Although the embodiments of the present invention have been described above, these embodiments are presented as examples, and are not intended to limit the scope of the invention. These novel embodiments can be implemented in various other aspects, and various omissions, substitutions, and changes can be made without departing from the gist of the invention. These embodiments are included in the scope and gist of the invention and are included in the invention described in the claims and the equivalent scope thereof.
[0180] In addition, in the present specification, it has been described that the tube axis direction and the direction of the main flow of the flow path structure are as indicated by arrows in
[0181] In addition, the tube axis described in the present specification may be, for example, a central axis of a flow path. However, this definition does not limit the interpretation of tube axis in a narrow sense, and should be interpreted as appropriate without impairing the gist of the invention described in the embodiment.
[0182] In addition, the embodiments and modifications described in the present specification can be combined in any manner.
[0183] Furthermore, the present disclosure includes examples according to the following supplementary notes.
[Supplementary Note 1]
[0184] A flow path structure including: [0185] a first flow path group including one or more flow paths; [0186] a second flow path group connected to the first flow path group via a branch portion, the second flow path group including two or more flow paths; [0187] a third flow path group connected to the second flow path group via a merging portion, the third flow path group including one or more flow paths; [0188] the branch portion including a first flow path group side branch opening connected to an end of the flow path included in the first flow path group, the end being close to the second flow path group, and a second flow path group side branch opening connected to an end of the flow path included in the second flow path group, the end being close to the first flow path group; and [0189] the merging portion including a second flow path group side branch opening connected to an end of the second flow path group, the end being close to the third flow path group, and a third flow path group side branch opening connected to an end of the third flow path group, the end being close to the second flow path group, wherein [0190] when the first flow path group includes N flow paths, [0191] the second flow path group includes M flow paths, and [0192] M is N or more, [0193] a sum of opening areas of the second flow path group side branch openings is equal to or less than M/N times a sum of opening areas of the first flow path group side branch openings, and [0194] an opening area of at least one of the second flow path group side merging openings is equal to or smaller than an opening area of at least one of the third flow path group side merging openings.
[Supplementary Note 2]
[0195] The flow path structure according to supplementary note 1, in which [0196] an opening area of at least one of the second flow path group side branch openings is equal to or smaller than an opening area of at least one of the first flow path group side branch openings.
[0197] [Supplementary Note 3]
[0198] The flow path structure according to supplementary note 1 or 2, in which [0199] at least some of the flow paths included in the second flow path group has a structure in which a shape of a cross section perpendicular to a tube axis direction of the flow path continuously changes.
[0200] [Supplementary Note 4]
[0201] The flow path structure according to any one of supplementary notes 1 to 3, in which [0202] at least some of the flow paths included in the second flow path group has a structure in which a flow path depth continuously changes.
[0203] [Supplementary Note 5]
[0204] The flow path structure according to any one of supplementary notes 1 to 4, in which [0205] at least some of the flow paths included in the second flow path group has a structure in which a flow path width continuously changes.
[Supplementary Note 6]
[0206] The flow path structure according to any one of supplementary notes 1 to 5, in which [0207] a top surface of flow paths included in the first flow path group, the second flow path group, and the third flow path group is included in a single plane.
[Supplementary Note 7]
[0208] The flow path structure according to any one of supplementary notes 1 to 6, in which [0209] at least a part of top surfaces of the flow paths included in the first flow path group, the second flow path group, and the third flow path group is included in a first plane, and [0210] among bottom surfaces of the flow paths included in the first flow path group, the second flow path group, and the third flow path group, a bottom surface facing a top surface that is not included in at least the first plane is included in a second plane different from the first plane.
[Supplementary Note 8]
[0211] The flow path structure according to any one of supplementary notes 1 to 7, in which [0212] in at least one of the flow paths included in the second flow path group, an opening area of the second flow path group side merging opening is smaller than an opening area of the second flow path group side branch opening.
[Supplementary Note 9]
[0213] The flow path structure according to any one of supplementary notes 1 to 8, in which [0214] in at least one of the flow paths included in the second flow path group, an opening area of the second flow path group side merging opening is larger than an opening area of the second flow path group side branch opening.
[Supplementary Note 10]
[0215] The flow path structure according to any one of supplementary notes 1 to 9, in which [0216] a flow path width and a flow path depth of the second flow path group side merging opening are 5 m or more.
[Supplementary Note 11]
[0217] The flow path structure according to any one of supplementary notes 1 to 10, in which [0218] the second flow path group has an approximately point symmetric shape with a midpoint between the branch portion and the merging portion as a center point.
[Supplementary Note 12]
[0219] The flow path structure according to any one of supplementary notes 1 to 11, in which [0220] a depth of a flow path included in the flow path structure is equal to or less than a width of the flow path.
[Supplementary Note 13]
[0221] The flow path structure according to any one of supplementary notes 1 to 12, in which [0222] an opening area of the flow path included in the flow path structure is 100 mm.sup.2 or less.
[Supplementary Note 14]
[0223] The flow path structure according to any one of supplementary notes 1 to 13, further including: [0224] an inlet capable of allowing two or more types of fluids to flow into at least one flow path included in the first flow path group.
[Supplementary Note 15]
[0225] The flow path structure according to any one of supplementary notes 1 to 16, in which [0226] at least some of the flow paths included in the first flow path group or at least some of the flow paths included in the third flow path group has a structure in which a shape of a cross section perpendicular to a tube axis direction of the flow path continuously changes as approaching the first branch portion.
[Supplementary Note 16]
[0227] A flow path structure including: [0228] a first flow path; [0229] a second flow path connected to the first flow path via a branch portion; [0230] a third flow path connected to the first flow path via the branch portion; [0231] a fourth flow path connected to the second flow path and the third flow path via a merging portion; [0232] the branch portion including a first branch opening connected to an end of the first flow path, the end being close to the second flow path and the third flow path, [0233] a second branch opening connected to an end of the second flow path, the end being close to the first flow path, and a third branch opening connected to an end of the third flow path, the end being close to the first flow path; and [0234] the merging portion including a second merging opening connected to an end of the second flow path, the end being close to the fourth flow path, a third merging opening connected to an end of the third flow path, the end being close to the fourth flow path, and a fourth merging opening connected to an end of the fourth flow path, the end being close to the second flow path and the third flow path, wherein [0235] a sum of opening areas of the second branch opening and the third branch opening is equal to or less than twice a sum of opening areas of the first branch opening, and [0236] an opening area of at least one of the second merging opening and the third merging opening is equal to or smaller than an opening area of the fourth merging opening.
[Supplementary Note 17]
[0237] A fluid structure unit including: a plurality of the flow path structures according to any one of supplementary notes 1 to 16.
[Supplementary Note 18]
[0238] A method for producing a lipid particle encapsulating a drug using the flow path structure according to any one of supplementary notes 1 to 16, the method including: [0239] a step of causing a first solution containing a lipid of a material of the lipid particle to flow into an organic solvent from a first inflow port positioned on an upstream side of the first flow path group and causing a second solution containing the drug to flow into an aqueous solvent from a second inflow port positioned on an upstream side of the first flow path group to mix the first solution and the second solution to obtain a mixed solution; and [0240] a step of particulating the lipid and generating the lipid particle encapsulating the drug by reducing the concentration of the organic solvent in the mixed solution.
[0241] The embodiments have been described above with reference to the specific examples. However, embodiments are not limited to these specific examples. That is, those obtained as those skilled in the art appropriately apply a design change to these specific examples are also included in the scope of the embodiments, as long as they present the features of the embodiments. Each component included in each of the specific examples described above and its arrangement, a material, a condition, a shape, and a size, for example, are not limited to those exemplified, and may be appropriately changed.
[0242] In addition, it is possible to combine the components included in the embodiments described above, as far as it is technically possible. Such a combination is also included in the scope of the embodiments, as long as it presents the features of the embodiments. In addition, within the scope of the idea of the embodiments, a person skilled in the art is able to conceive various modifications and corrections. It is understood that the modifications and corrections also belong to the scope of the embodiments.