Epitope tags recognized by specific binders
12365705 · 2025-07-22
Assignee
Inventors
- Steffen Frey (Gottingen, DE)
- Hansjoerg Goetzke (Hannover, DE)
- Davilla Luis Felipe Opazo (Goettingen, DE)
- Paal Erik Gustav Stenmark (Jaerfaella, SE)
- Carranza Markel Martinez (Stockholm, SE)
Cpc classification
C07K14/705
CHEMISTRY; METALLURGY
C07K2317/569
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
C07K2319/40
CHEMISTRY; METALLURGY
C07K7/04
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/80
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K16/44
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention provides peptides useful as epitope tags, which may be fused to a polypeptide of interest, as well as antibodies that specifically bind to these peptides. The peptides and/or antibodies can be used for detecting, immobilizing, isolating or purifying a molecule that is conjugated to such a peptide and/or antibody.
Claims
1. A single domain antibody that is capable of binding a peptide having the sequence SRLEEELRRRLTE (SEQ ID NO: 04), wherein the antibody comprises CDR1, CDR2, and CDR3 sequences selected from the group consisting of: (a) a CDR1 sequence having the sequence of GVTISALNAMAMG (SEQ ID NO: 115), a CDR2 sequence having the sequence of AVSERGNAM (SEQ ID NO: 116), and a CDR3 sequence having the sequence of LEDRVDSFHDY (SEQ ID NO: 117); and (b) a CDR1 sequence having the sequence of GVTISALNAMAMG (SEQ ID NO: 115), a CDR2 sequence having the sequence of AVSSRGNAM (SEQ ID NO: 119), and a CDR3 sequence having the sequence of LEDRVDSFHDY (SEQ ID NO: 117).
2. The antibody of claim 1, comprising a camelid single variable domain of a heavy chain (VHH) sequence having at least 95%, sequence identity to TABLE-US-00012 (SEQIDNO:133) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRV MVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYC HVLEDRVDSFHDYWGQGTQVTVSS;or (SEQIDNO:134) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGEERV MVAAVSSRGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYC HVLEDRVDSFHDYWGQGTQVTVSS.
3. The antibody of claim 1, wherein the antibody is conjugated to a detectable label, an affinity tag, or a solid support.
4. The antibody of claim 1, wherein the antibody is in a complex with a fusion protein that comprises (a) a peptide P having the sequence of SRLEEELRRRLTE (SEQ ID NO: 04); and (b) a polypeptide.
5. The antibody of claim 1, wherein the antibody comprises: the CDR1 sequence GVTISALNAMAMG (SEQ ID NO: 115), the CDR2 sequence AVSERGNAM (SEQ ID NO: 116), and the CDR3 sequence LEDRVDSFHDY (SEQ ID NO: 117).
6. The antibody of claim 1, wherein the antibody comprises: the CDR1 sequence GVTISALNAMAMG (SEQ ID NO: 115), the CDR2 sequence AVSSRGNAM (SEQ ID NO: 119), and the CDR3 sequence LEDRVDSFHDY (SEQ ID NO: 127).
7. The antibody of claim 1, comprising a camelid single variable domain of a heavy chain (VHH) sequence having the sequence of TABLE-US-00013 (SEQIDNO:133) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRV MVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYC HVLEDRVDSFHDYWGQGTQVTVSS;or (SEQIDNO:134) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGEERV MVAAVSSRGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYC HVLEDRVDSFHDYWGQGTQVTVSS.
8. The single domain antibody of claim 1, wherein the antibody binds the peptide having the sequence SRLEEELRRRLTE (SEQ ID NO: 04) with a K.sub.D of 10.sup.6 M or lower.
9. The single domain antibody of claim 1, wherein the antibody binds the peptide having the sequence SRLEEELRRRLTE (SEQ ID NO: 04) with a K.sub.D of 30 nM or lower.
10. A single domain antibody comprising the VHH sequence selected from the group consisting of: TABLE-US-00014 (a) (SEQIDNO:133) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRV MVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYC HVLEDRVDSFHDYWGQGTQVTVSS;and (b) (SEQIDNO:134) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGEERV MVAAVSSRGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYC HVLEDRVDSFHDYWGQGTQVTVSS.
11. The antibody of claim 10, comprising the VHH sequence of TABLE-US-00015 (SEQIDNO:133) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRV MVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYC HVLEDRVDSFHDYWGQGTQVTVSS.
12. The antibody of claim 10, comprising the VHH sequence of TABLE-US-00016 (SEQIDNO:134) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGEERV MVAAVSSRGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYC HVLEDRVDSFHDYWGQGTQVTVSS.
13. The antibody of claim 10, wherein the antibody is conjugated to a detectable label, an affinity tag, or a solid support.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13) Total human PBMCs were left untreated (before sorting) or isolated using an ALFA Selector.sup.PE resin loaded with an ALFA-tagged anti-human CD62L nanobody (after sorting). A sketch of the affinity purification strategy is shown in (a). Cells were stained with an anti-CD62L antibody and analyzed by flow cytometry (b). The same cells as in (b) were stained with antibodies directed against CD3, CD19 and CD62L, and analyzed by flow cytometry (c). A forward scatter/side scatter gate was set on lymphocytes in all analyses.
DETAILED DESCRIPTION
(14) In order to overcome some of the shortcomings of the state of the art, the inventors of the present application created a small epitope tag recognized by a high-affinity nanobody. Such system may allow analysis of a protein's function in multiple aspects comprising but not limited to the analysis of its localization, analysis of its interaction partners by purification from lysates or in-vivo manipulations including induced protein mislocalization or depletion using a minimal set of recombinant constructs and cell lines without unintended interference with the protein of interest's physiological function.
(15) In view of the limitations on the current epitope tags, the inventors of the present application decided to address the problem and find the features that an ideal epitope tag system should posses. A truly versatile tag should be small to minimize the potential side effect (Kocaoglu, 0. & Carlson, E. E. Progress and prospects for small-molecule probes of bacterial imaging. Nat Chem Biol 12, 472-478 (2016)). It is preferably monomeric in order to minimize artifactual oligomerization of the tagged proteins. It should also be electroneutral to avoid adding net charges to the tagged proteins; at the same time it should be soluble (Esposito, D. & Chatterjee, D. K. Enhancement of soluble protein expression through the use of fusion tags. Curr. Opin. Biotechnol. 17, 353-358 (2006)). An ideal tag should not affect the native structure, topology or localization of the tagged protein (Stadler, C. et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 10, 315-323 (2013); Hoffmann, C. et al. A FlAsH-based FRET approach to determine G protein-coupled receptor activation in living cells. Nat Methods 2, 171-176 (2005)). In addition, the tag should be well expressed in eukaryotic and prokaryotic hosts and should be resistant towards proteolytic degradation. Ideally, it should be resistant to fixation and its sequence should be absent in common model organisms to avoid non-intended detection of endogenous host proteins.
(16) Similar than for an ideal epitope tag, its corresponding binder should also have several characteristic to make the tag detection ideal. For example, the binder should be small in order to have easy access to crowded regions and provide the best binding affinity for the different applications. Current sophisticated applications (e.g. live in-vivo imaging) need a specific and genetically accessible probe with high affinity to the tag, which should be able to autonomously fold in vivo in various host organisms. For biochemical applications, however, the preferred binder should preferentially have intermediate affinity in order to allow for a competitive elution of the immuno-precipitated material under native conditions. When assessing commonly used epitope tags existing thus far, one applying the state of the art will ultimately need to sacrifice at least one of the mentioned features (see Table 1 below). To manufacture an epitope tag with ultimate versatility fulfilling all of the mentioned boundary conditions, the inventors of the present application have recognized
(17) TABLE-US-00001 TABLE 1 Properties of common epitope tag systems Epitope tag of the present invention comprising the core sequence of FLAG-tag.sup.10 HA-tag.sup.11 myc-tag.sup.12 Twin-Strep-tag.sup.8 polyHis-tag.sup.9 Spot-tag.sup.13 SEQ ID NO: 4 Properties Size (amino 8 9 10 28 3-10 12 13-15 of acids) tag Mass (kDa) 1.1 1.1 1.2 2.9 0.4-1.4 1.4 ~1.8 Charge at 3 2 3 0.2 0.3-1 1.1 0 pH 7.0 pKi 3.5 0 3.5 8.4 14 12.1 8.1 Physical size 2.2 2.5 2.8 >6 0.8-2.8 3.3 2.0 (nm) Water + poor + + poor + + solubility Structured in +.sup.14 solution Stable (+).sup.15 (+).sup.16 + + + + + Fixation + + + + resistant.sup.7 Unique within + (+).sup.2 ().sup.3 ().sup.5 + model organisms Possible N, M, C N, M, C N, M, C N, C N, C N, C N, M, C localizations.sup.18 Properties Name M1, M2, F-7, 9E10 StrepTactin- Ni.sup.2+/Co2.sup.+.sub.
(18) With this clear objective inventors of the present application designed the epitope tags described herein. The epitope tags of the invention preferably consist about 8 to 25 amino acids and are collectively called ALFA tags.
(19) The inventors of the application decided to take a de-novo approach for generating a new epitope tag. The epitope tag according to the invention is a small, monomeric epitope tag of preferably 15aa with minimal size. The sequence is preferably uncharged and hydrophilic at physiological pH and most preferably, it is devoid of residues prone to be modified by amine-reactive fixatives and cross-linkers. The size stands in contrast to larger tags, such as, e.g., a FLAG tag trimer, which is commonly used in a 3 tandem in order to increase avidity, or even larger fluorescent protein. Further, the epitope tag of the present invention has no counterpart in eukaryotic or prokaryotic sequence databanks, which minimizes the risk of cross-binding to native structures. This stands e.g. in contrast to the SPOT-Tag, which is described in WO 2017/085086 A1.
(20) A further advantage of the epitope tag of the invention is that it is compatible to common amine-reactive fixatives (paraformaldehyde (PFA), glutaraldehyde (GA)), unlike e.g. the Myc tag. It is also compatible with methanol fixation. A further advantage of the epitope tag of the present invention is that it is not restricted in terms of localization (N, C or in between proteins), unlike the EPEA tag, which is described in WO 2011/147890 A1.
(21) Without wishing to be bound by theory, it is believed that the epitope tag according to the invention forms a stable alpha-helical structure. Formation of a stable alpha helix is believed to be advantageous over differently folded, non-folded or non-stably folded structures, because certain antibodies, such as single domain antibodies (sdAb) or nanobodies are believed to prefer defined three-dimensional surfaces for binding. In the past, it has been very hard to generate single domain antibodies binding to natively unfolded peptides, which resulted in sdAb with weak to moderate binding affinities only. The inventors of the present application therefore focused on providing epitope tags that are believed to form small alpha-helices that are stably folded in solution, because such structures are the smallest entities forming stable secondary structures as a monomer. Without wishing to be bound by theory, it is believed that the alpha-helical structure efficiently and spontaneously refolds even after exposure to harsh chemical treatment. Further it is believed that due to its helical structure, the tag is smaller than most unstructured linear epitope tags. In addition, the epitope tags of the invention can be placed at the N- or C-terminus of a target protein or even in between two folded protein domains without compromising proper targeting and folding of target proteins.
(22) Finding the ideal binder(s), however, proved to be challenging. While conventional antibodies would indeed fulfill most requirements, their large size makes them suboptimal for the current super-resolution microscopy (Fornasiero, E. F. & Opazo, F. Super-resolution imaging for cell biologists: Concepts, applications, current challenges and developments. Bioessays 37, 436-451 (2015); Mikhaylova, M. et al. Resolving bundled microtubules using anti-tubulin nanobodies. Nat Commun 6, 7933 (2015) and cannot be encoded genetically to target intracellular targets in living cells. The inventors of the present application therefore chose to develop a camelid single-domain antibody (sdAb, also know as nanobody (Muyldermans, S. Nanobodies: Natural Single-Domain Antibodies. Annu Rev Biochem (2013). doi:10.1146/annurev-biochem-063011-092449) fulfilling the set criteria. For this, a novel in-house selection method called Celline allowed the inventors to generate alpaca-derived sdAb with exceedingly high affinity in a very timely manner. The antibodies of the invention in combination with the epitope tags of the invention proved to be ideal for imaging and intracellular detection of ALFA.sup.ST-tagged target proteins and allowed very efficient and clean immuno-precipitations.
(23) The present invention also provides high-affinity antibodies for the epitope tag of the invention. Some of the antibodies are monovalent sdAb-based binders. Monovalent binding stands in contrast to epitope tags that are bound by conventional antibodies. While the SPOT-Tag is bound by an sdAb, the SPOT-Tag-binding sdAb is employed as a dimer for some applications of the SPOT-Tag in order to increase avidity. Utilization of monovalent antibodies has the advantage that cluster formation can be prevented. It is further believed that due to the alpha-helical structure of the epitope tag, the inventors of the present invention were able to generate single domain antibodies that bind to the epitope tag of the invention with a K.sub.d in the range of about 10 pM, which is approximately a 1000-fold higher affinity than comparable epitope tag/sdAb systems, as e.g. described in WO 2017/085086 A1 or WO 2011/147890 A1.
(24) For some of the epitope tags of the present invention, such as SEQ ID NOs:05-07, it was virtually impossible to efficiently separate the antibody comprising the sequence of SEQ ID NO:133 from the tag under native conditions. In some cases, this might be limiting for the application of SEQ ID NOs:05-07 for purification of native proteins and their interacting partners. Solving the crystal structure of the high affinity complex of the antibody of SEQ ID NO: 133 and the peptide of SEQ ID NO: 179 allowed the inventors to map the interaction determinants in detail and to engineer a new versions of the single-domain antibody that allows a competitive elution of ALFA.sup.ST_tagged target proteins and interacting partners under native conditions. An exemplary antibody for this purpose comprises the amino acid sequence of SEQ ID NO: 134.
(25) The epitope tag and antibody system presented here is suited for an exceptionally broad range of applications ranging from biotechnology to cell biology. A single tag can therefore simultaneously replace a great variety of traditional epitope tags.
(26) The present invention therefore relates to a fusion protein comprising (a) a peptide comprising the sequence of X1-X2-X3-X4-X5-X6-X7-X8-X9-R-L-X12-X13 (SEQ ID NO: 01), wherein X1 is G or S or T or P, X2 is R or G or A or E or P, X3 is L or V, X4 is E or Q, X5 is E or Q, X6 is E or Q, X7 is L or I or V, X8 is R or A or Q or E, X9 is R or A or Q or E, X12 is S or T or D or E or P or A or no amino acid, and wherein X13 is E or K or P or S or A or D or no amino acid; and (b) a polypeptide. In the fusion protein of the invention, the peptide may serve the purpose of an epitope tag.
(27) The term peptide as used herein refers to a linear series of amino acids connected one to the other preferably by peptide bonds between the alpha-amino and carboxy groups of adjacent residues. As used herein the term amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics, with proteogenic amino acids being preferred. A proteinogenic amino acid is an amino acid that can be incorporated biosynthetically into proteins during translation. Currently, there are 22 known genetically encoded (proteinogenic) amino acids, 20 in the standard genetic code and an additional 2 that can be incorporated by special translation mechanisms. The peptide as used herein preferably comprises no more than about 50 amino acids.
(28) The term polypeptide as used herein usually refers to a peptide having at least about 30, at least about 40, or at least about 50 amino acids. The term protein as used herein comprises one or more polypeptides.
(29) The term fusion protein as used herein refers to a polypeptide or protein comprising two or more subunits. At least one of the subunits is preferably a protein or polypeptide, and at least one of the subunits is preferably a peptide. Within the fusion protein, these subunits may be linked by covalent or non-covalent linkage. Preferably, the fusion protein is a translational fusion between the two or more subunits. The translational fusion may be generated by genetically engineering the coding nucleotide sequence for one subunit in a reading frame with the coding nucleotide sequence of a further subunit. Subunits may be interspersed by a linker.
(30) If one or more of the subunits is part of a protein (complex) that consists of more than one polypeptide chain, the term fusion protein may also refer to the protein comprising the fused sequences and all other polypeptide chain(s) of the protein (complex).
(31) As used herein, an epitope tag refers to a stretch of amino acids to which a specific antibody or proteinaceous molecule with antibody-like function can be raised. Such an epitope tag may allow for specifically identifying and/or tracking of the tagged polypeptide or protein that may be present in a living organism or cultured cells. Detection of the tagged molecule can be achieved using a number of different techniques. Examples of such techniques include: immunohistochemistry, immunoprecipitation, flow cytometry, immunofluorescence microscopy, electron microscopy, ELISA, immunoblotting (Western blot), and affinity chromatography. The epitope tag adds a known epitope (antibody binding site) on the subject polypeptide, to provide binding of a known and often high-affinity antibody. An epitope tag may also be used for isolation and/or purification of the tagged molecule, e.g. by pull-down applications.
(32) In the fusion protein of the invention, the peptide, i.e. the epitope tag, may be located at any position of the fusion protein. The peptide may be fused to the N-terminus or the C-terminus of the polypeptide. Alternatively, the peptide may be fused to the polypeptide at a position between the N-terminus and the C-terminus of the polypeptide. As an illustrative example, the peptide may be fused in between two domains of the polypeptide.
(33) The polypeptide comprised in the fusion protein may have a stable fold that is independent from the presence or absence of the peptide. This means that the peptide preferably does not alter or interfere with the native structure of the polypeptide.
(34) The peptide itself has preferably an alpha-helical structure. A solved crystal structure of an antibody having the sequence of SEQ ID NO: 133 in complex with the ALFA.sup.ST peptide comprising the sequence of Ac-PSRLEEELRRRLTEP-Amide (SEQ ID NO: 179) shows that the epitope tag binds to the nanobody as a stably folded alpha helix. The structure is believed to explain the extraordinarily tight binding. An alpha helical structure as used herein refers to a secondary structure in the form of an alpha helix. It is preferred that the alpha helical secondary structure of the peptide is independent from a fusion partner. This means that the peptide is preferably capable of forming an alpha helical secondary structure in physiological buffers if the peptide is in form of an isolated peptide and also if the peptide is part of the fusion protein.
(35) The peptide may be specifically recognized by a camelid VHH domain comprising the CDR sequences GVTISALNAMAMG (SEQ ID NO: 115), AVSERGNAM (SEQ ID NO: 116), and LEDRVDSFHDY (SEQ ID NO: 117). The peptide may further be specifically recognized by other antibodies described herein.
(36) In the fusion protein of the invention, the peptide may be fused to the polypeptide either by direct fusion or through a linker. A linker as used herein joins together two or more subunits of a fusion protein as described herein. The linkage can be covalent. A preferred covalent linkage is via a peptide bond, such as a peptide bond between amino acids. A preferred linker is a peptide linker. Said linker preferably comprises one or more amino acids, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acids. Preferred peptide linkers include glycine-serine (GS) linkers, glycosylated GS linkers, and proline-alanine-serine polymer (PAS) linkers. A GS linker may be a (G.sub.4S).sub.3 linker as described in SEQ ID NO: 159.
(37) The polypeptide comprised in the fusion protein of the invention may comprise at least one protein domain. A protein domain as used herein refers to a part of a given protein sequence and (tertiary) structure that can function and/or exist independently of the rest of the protein chain. The protein domain preferably forms a compact three-dimensional structure and often can be independently stable and folded. A protein domain may further form a functional unit. The polypeptide comprised in the fusion protein may comprise more than one protein domain, such as 2, 3, 4, or even more protein domains. A preferred location for the peptide may be outside of the protein domain. This can be N-terminal or C-terminal of the at least one protein domain of the polypeptide, or in between two protein domains of the polypeptide. The polypeptide comprised in the fusion protein of the invention may be a globular protein, and membrane protein, a fibrous protein, or a natively unfolded protein, or a subunit or domain of the globular protein, membrane protein, fibrous protein, or natively unfolded protein.
(38) The peptide comprised in the fusion protein of the invention may have a length of about 8 to about 25 amino acids, preferably about 10 to about 18 amino acids, preferably about 12 to about 17 amino acids, preferably 12 to 15 amino acids. The polypeptide comprised in the fusion protein of the invention may have a length of at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, or 100 amino acids. The polypeptide may be polypeptide or protein that naturally occurs in a cell that expresses the fusion protein of the invention.
(39) The fusion protein of the invention may comprise a peptide comprising the sequence of X1-X2-L-E-X5-E-X7-R-R-R-L-X12-X13 (SEQ ID NO: 02), wherein X1 is G or S or P or T, X2 is R or G or P, X5 is E or Q, X7 is L or I, X12 is S or T or P or A or D or E, and wherein X13 is P or A or S or A or D or E or no amino acid. This sequence defines the core structure of the peptide and may further comprise up to two additional amino acids at the N terminus and up to two additional amino acids at the C terminus. Such additional amino acids at the ends of the core structure of the peptide usually do not necessarily influence the secondary structure of the of the peptide or specific binding of the peptide to an antibody specific for the peptide, but may serve as linker structures in the fusion protein. Accordingly, type and number of the additional amino acids may depend on the location of the peptide in the fusion protein and may vary depending on whether the peptide is located N-terminal or C-terminal or somewhere in between of the polypeptide. A peptide comprising the sequence of SEQ ID NO: 02 may have a T.sub.1/2 of at least about 2 min for dissociation from a single domain antibody comprising the sequence of SEQ ID NO: 133, e.g. when measured in an assay as essentially described in Example 1. The peptide may have a K.sub.d of about 30 nM or less for the binding to the single domain antibody comprising the sequence of SEQ ID NO: 133.
(40) The peptide comprised in the fusion protein of the invention may comprise N-terminal of X1 the amino acids Xa-Xb, wherein Xa is D or S or G or M or P or no amino acid and Xb is S or D or P or M or R or G no amino acid.
(41) The peptide comprised in the fusion protein of the invention may comprise C-terminal of X13 the amino acids Xy-Xz, wherein Xy is G or S or P or D or A or E or K or no amino acid, and Xz is S or P or no amino acid.
(42) The fusion protein of the invention may comprise a peptide comprising as a core structure the sequence of X1-X2-L-E-X5-E-L-R-R-R-L-X12-X13 (SEQ ID NO: 03), wherein X1 is S or T, X2 is R or G, X5 is E or Q, X12 is T or D or E, and wherein X13 is A or D or E or no amino acid. Such a peptide may have a T1/2 of at least about 100 min for dissociation from a single domain antibody comprising the sequence of SEQ ID NO: 133, e.g. when measured in an assay as essentially described in Example 1. The peptide may have a K.sub.d of about 1 nM or less for the binding to the single domain antibody comprising the sequence of SEQ ID NO: 133. Such a peptide may comprise the sequence of S-R-L-E-E-E-L-R-R-R-L-T-E (SEQ ID NO: 04) or a variant thereof, wherein the variant has as compared to (SEQ ID NO: 04) 1 to 5 mutations selected from the group consisting of: S1.fwdarw.T, R2.fwdarw.G, E5.fwdarw.Q, T12.fwdarw.D, and T12.fwdarw.E, E13.fwdarw.A, E13.fwdarw.D, and deletion of E13. The variant may have as compared to SEQ ID NO: 04 following mutations: (a) S1.fwdarw.T and E13.fwdarw.A; (b) R2.fwdarw.G; (c) R2.fwdarw.G and E5.fwdarw.Q; (d) R2.fwdarw.G, E5.fwdarw.Q and E13.fwdarw.A; (e) R2.fwdarw.G, E5.fwdarw.Q, and T12.fwdarw.D, and E13.fwdarw.A; (f) R2.fwdarw.G, E5.fwdarw.Q, and T12.fwdarw.E, and E13.fwdarw.A; (g) T12.fwdarw.D and E13.fwdarw.A; (h) T12.fwdarw.E and E13.fwdarw.A; (i) and E13.fwdarw.A; (j) and E13.fwdarw.D; or (k) deletion of E13.
(43) A peptide comprising as a core structure the sequence SEQ ID NO: 03 may comprise N-terminal of X1 the amino acids Xa-Xb, wherein Xa is S or G or M or P or no amino acid, and Xb is R or G or S or P or M or no amino acid. Xa-Xb may be selected from the group consisting of P, M-P, G-R, P-G, P-S, S-P, G-P, S-P, M, and M-S, preferably P or M-P. Such a peptide may also comprise C-terminal of X13 the amino acids Xy-Xz, wherein is P or D or A or no amino acid, and Xz is P or S or no amino acid. Xy-Xz may be selected from the group consisting of no amino acid, P, D-P, A, and A-S, preferably no amino acid or P. The peptide may comprise a combination of Xa-Xb and Xy-Xz selected from the group consisting of: (a) M-P and P; (b) P and P; and (c) P and no amino acid.
(44) A peptide comprised in the fusion protein of the invention may have the core structure of SEQ ID NO: 03 and may comprise a sequence selected from the group consisting of:
(45) TABLE-US-00002 (a) (SEQIDNO:05) MPSRLEEELRRRLTEP; (b) (SEQIDNO:06) PSRLEEELRRRLTEP; (c) (SEQIDNO:07) PSRLEEELRRRLTE; (d) (SEQIDNO:08) GRSRLEEELRRRLTA; (e) (SEQIDNO:09) PGSRLEEELRRRLTAP; (f) (SEQIDNO:10) PSTRLEEELRRRLTAP; (g) (SEQIDNO:11) SPSRLEEELRRRLTAP; (h) (SEQIDNO:12) SPSRLEEELRRRLDAP; (i) (SEQIDNO:13) SPSRLEEELRRRLEAP; (j) (SEQIDNO:14) SPSRLEEELRRRLTDP; (k) (SEQIDNO:15) SPSRLEEELRRRLTEP; (l) (SEQIDNO:16) SPSRLEEELRRRLTADP; (m) (SEQIDNO:17) SPSGLEEELRRRLTEP; (n) (SEQIDNO:18) GPSRLEEELRRRLT; (o) (SEQIDNO:19) GPSRLEEELRRRLTA; (p) (SEQIDNO:20) GPSRLEEELRRRLTAA; (q) (SEQIDNO:21) GPSRLEEELRRRLTAAS; (r) (SEQIDNO:22) SPSGLEQELRRRLTAP; (s) (SEQIDNO:23) SPSGLEQELRRRLDAP; (t) (SEQIDNO:24) SPSGLEQELRRRLEAP; (u) (SEQIDNO:25) SPSGLEQELRRRLTEP; (v) (SEQIDNO:26) GPSRLEEELRRRLTAP; (w) (SEQIDNO:27) GPSRLEEELRRRLTEP; (x) (SEQIDNO:28) GPSRLEEELRRRLTE; (y) (SEQIDNO:29) MSRLEEELRRRLTEP; and (z) (SEQIDNO:30) MSSRLEEELRRRLTEP.
(46) The fusion protein of the invention may comprise a peptide comprising as a core structure the sequence of X1-X2-L-E-X5-E-X7-R-R-R-L-X12-X13 (SEQ ID NO: 31), wherein X1 is G or S or P, X2 is R or G, X5 is E or Q, X7 is L or I, X12 is S or T or P or A, and X13 is P or A or S or no amino acid. Such a peptide may have a T.sub.1/2 from about 2.5 min to about 30 min for dissociation from a single domain antibody comprising the sequence of SEQ ID NO: 133, e.g. when measured in an assay as essentially described in Example 1. The peptide may have a K.sub.d of about 3-40 nM or less for the binding to the single domain antibody comprising the sequence of SEQ ID NO: 133.
(47) Such a peptide may comprise the sequence of G-R-L-E-E-E-L-R-R-R-L-S(SEQ ID NO: 32) or a variant thereof, wherein the variant has as compared to (SEQ ID NO: 32) 1 to 6 mutations selected from the group consisting of: G1.fwdarw.S, G1.fwdarw.P, R2.fwdarw.G, E5.fwdarw.Q, L7.fwdarw.I, S12.fwdarw.T, S12.fwdarw.P, and S12.fwdarw.A, addition of P13, addition of A13, and addition of S13. The variant may have as compared to SEQ ID NO: 32 following mutations: (a) G1.fwdarw.S, R2.fwdarw.G, E5.fwdarw.Q, and addition of P13; (b) R2.fwdarw.G, E5.fwdarw.Q, S12.fwdarw.T, and addition of A13; (c) G1.fwdarw.P, R2.fwdarw.G, E5.fwdarw.Q, S12.fwdarw.T, and addition of A13; (d) G1.fwdarw.S, R2.fwdarw.G, E5.fwdarw.Q, S12.fwdarw.T, and addition of P13; (e) G1.fwdarw.S, R2.fwdarw.G, S12.fwdarw.T, and addition of A13; (f) G1.fwdarw.S, R2.fwdarw.G, E5.fwdarw.Q, and S12.fwdarw.T; (g) G1.fwdarw.S, R2.fwdarw.G, E5.fwdarw.Q, S12.fwdarw.T, and addition of A13; (h) G1.fwdarw.S and S12.fwdarw.P, and addition of P13; (i) G1.fwdarw.S, R2.fwdarw.G, E5.fwdarw.Q, S12.fwdarw.T, and addition of P13; (j) E5.fwdarw.Q L7.fwdarw.I, and addition of P13; (k) addition of P13; or (1) S12.fwdarw.A.
(48) A peptide comprising as a core structure the sequence SEQ ID NO: 31 may comprise N-terminal of X1 the amino acids Xa-Xb, wherein Xa is M or S or P or D or G or no amino acid, and Xb is S or D or P or no amino acid. Xa-Xb may be selected from the group consisting of M-S, S-D, P-D, P-S, D-S, S-P, and G-P, preferably M-S. Such a peptide may also comprise C-terminal of X13 the amino acids Xy-Xz, wherein Xy is G or P or A or E or K or S or no amino acid, and Xz is P or S or no amino acid. Xy-Xz may be selected from the group consisting of no amino acid, G, P, A, E-P, A-S, K, and S, preferably no amino acid. The peptide may comprise a combination of Xa-Xb and Xy-Xz that is M-S and no amino acid.
(49) A peptide comprised in the fusion protein of the invention may have the core structure of SEQ ID NO: 31 and may comprise a sequence selected from the group consisting of:
(50) TABLE-US-00003 (a) (SEQIDNO:32) GRLEEELRRRLS; (b) (SEQIDNO:33) MSGRLEEELRRRLSP; (c) (SEQIDNO:34) SDSGLEQELRRRLSPG; (d) (SEQIDNO:35) PDGGLEQELRRRLTAP; (e) (SEQIDNO:36) PSGGLEQELRRRLTAP; (f) (SEQIDNO:37) DSPGLEQELRRRLTAP; (g) (SEQIDNO:38) PDSGLEQELRRRLTPA; (h) (SEQIDNO:39) SPSGLEEELRRRLTAEP; (i) (SEQIDNO:40) GPSGLEQELRRRLT; (j) (SEQIDNO:41) GPSGLEQELRRRLTAAS; (k) (SEQIDNO:42) SPSRLEEELRRRLPSK; (l) (SEQIDNO:43) SPSGLEQELRRRLTPS; (m) (SEQIDNO:44) SPGRLEQEIRRRLSPS; (n) (SEQIDNO:45) PSGRLEEELRRRLSPS; (o) (SEQIDNO:46) PSGRLEEELRRRLS; (p) (SEQIDNO:47) PSGRLEEELRRRLA; and (q) (SEQIDNO:48) PSGRLEEELRRRLSP.
(51) The fusion protein of the invention may comprise a peptide comprising as a core structure the sequence of X1-X2-L-E-X5-E-L-R-R-R-L-X12-X13 (SEQ ID NO: 49), wherein X1 is S or G or P, X2 is R or G or P, X5 is E or Q, X12 is S or T or D or E, and X13 is P or A or D or no amino acid. Such a peptide may have a T1/2 from about 20 min to about 100 min for dissociation from a single domain antibody comprising the sequence of SEQ ID NO: 133, e.g. when measured in an assay as essentially described in Example 1. The peptide may have a K.sub.d of about 1-5 nM or less for the binding to the single domain antibody comprising the sequence of SEQ ID NO: 133.
(52) A peptide comprising as a core structure the sequence SEQ ID NO: 49 may comprise N-terminal of X1 the amino acids Xa-Xb, wherein Xa is P or D or S or G or no amino acid, and Xb is D or S or P or no amino acid. Such a peptide may also comprise C-terminal of X13 the amino acids Xy-Xz, wherein Xy is G or P or E or D or S or no amino acid, and Xz is P or no amino acid.
(53) A peptide comprised in the fusion protein of the invention may have the core structure of SEQ ID NO: 49 and may comprise a sequence selected from the group consisting of:
(54) TABLE-US-00004 (a) (SEQIDNO:50) PDSGLEQELRRRLSPG; (b) (SEQIDNO:51) PDSGLEQELRRRLTAP; (c) (SEQIDNO:52) PSSGLEQELRRRLTAP; (d) (SEQIDNO:53) DPSGLEQELRRRLTAP; (e) (SEQIDNO:54) DSGPLEQELRRRLTAP; (f) (SEQIDNO:55) SPSRLEEELRRRLTAEP; (g) (SEQIDNO:56) SPSGLEEELRRRLTAP; (h) (SEQIDNO:57) SPSGLEEELRRRLDAP; (i) (SEQIDNO:58) SPSGLEEELRRRLEAP; (j) (SEQIDNO:59) SPSGLEEELRRRLTDP; (k) (SEQIDNO:60) SPSGLEEELRRRLTADP; (l) (SEQIDNO:169) GPSGLEQELRRRLTA; (m) (SEQIDNO:170) SPSGLEQELRRRLTDP; (n) (SEQIDNO:171) SPSGLEQELRRRLTADP; (o) (SEQIDNO:172) SPSGLEQELRRRLTAEP; (p) (SEQIDNO:173) DSPGLEQELRRRLTAP; and (q) (SEQIDNO:174) SPSGLEQELRRRLSPS.
(55) The fusion protein of the invention may comprise a peptide comprising as a core structure the sequence of X1-X2-X3-X4-X5-X6-X7-X8-X9-R-L-X12-X13 (SEQ ID NO: 61), wherein X1 is G or S, X2 is R or G or A or E, X3 is L or V, X4 is E or Q, X5 is E or Q, X6 is E or Q, X7 is L or I or V, X8 is R or A or Q or E, X9 is R or A or Q or E, X12 is S or T or L or no amino acid, and X13 is K or P or S or no amino acid. Such a peptide may have a T.sub.1/2 from about 2 min to about 10 min for dissociation from a single domain antibody comprising the sequence of SEQ ID NO: 133, e.g. when measured in an assay as essentially described in Example 1. The peptide may have a Kd of about 10-50 nM or less for the binding to the single domain antibody comprising the sequence of SEQ ID NO: 133.
(56) A peptide comprising as a core structure the sequence SEQ ID NO: 61 may comprise N-terminal of X1 the amino acids Xa-Xb, wherein Xa is D or S or G or M or no amino acid and Xb is S or D or P or M or no amino acid. Such a peptide may also comprise C-terminal of X13 the amino acids Xy-Xz, wherein Xy is G or S or P or no amino acid, Xz is S or no amino acid.
(57) A peptide comprised in the fusion protein of the invention may have the core structure of SEQ ID NO: 61 and may comprise a sequence selected from the group consisting of:
(58) TABLE-US-00005 (a) (SEQIDNO:32) GRLEEELRRRLS; (b) (SEQIDNO:33) MSGRLEEELRRRLSP; (c) (SEQIDNO:62) DSGRLEEELRRRLSKG; (d) (SEQIDNO:63) DSGRLEEELRRRLSPG; (e) (SEQIDNO:64) SDSGLEEELRRRLSPG; (f) (SEQIDNO:65) SDSGVEEELRRRLSPG; (g) (SEQIDNO:66) SDSAVEEELRRRLSPG; (h) (SEQIDNO:67) SDSGLQEELRRRLSPG; (i) (SEQIDNO:68) SDSGLEEQLRRRLSPG; (j) (SEQIDNO:69) SDSGLEEEIRRRLSPG; (k) (SEQIDNO:70) SDSGLEEEVRRRLSPG; (l) (SEQIDNO:71) DSGELEEELRRRLSPG; (m) (SEQIDNO:72) DSGRLEQELRRRLSPG; (n) (SEQIDNO:73) DSGRLEEEIRRRLSPG; (o) (SEQIDNO:74) DSGRLEQEIRRRLSPG; (p) (SEQIDNO:75) DSGRLEQEIARRLSPG; (q) (SEQIDNO:76) DSGRLEQEIQRRLSPG; (r) (SEQIDNO:77) DSGRLEQEIERRLSPG; (w) (SEQIDNO:78) DSGRLEQEIRARLSPG; (t) (SEQIDNO:79) DSGRLEQEIRQRLSPG; (u) (SEQIDNO:80) DSGRLEQEIRERLSPG; (v) (SEQIDNO:81) GPSRLEEELRRRL; (w) (SEQIDNO:82) MSGLEQELRRRLTPS; (x) (SEQIDNO:83) MSGRLEEELRRRLSPS; (y) (SEQIDNO:84) SPSAVEEELRRRLSPS; (z) (SEQIDNO:85) GPSAVEEELRRRLS; (aa) (SEQIDNO:86) MPSGLEQELRRRLTPS; (bb) (SEQIDNO:87) MSSGLEQELRRRLTPS; (cc) (SEQIDNO:88) MPSGRLEEELRRRLSPS; (dd) (SEQIDNO:89) MSGRLEEELRRRLSP.
(59) The fusion protein of the invention may in complex with a binding partner that specifically binds to the peptide comprised in the fusion protein. Such a specific binding partner may be an antibody disclosed herein.
(60) The fusion protein of the invention may comprise an antibody moiety. The antibody moiety may be a single domain antibody. Such antibody moiety may specifically bind to a target. Such a target may be a cell. For example, the specific target may comprise or be a structure on a cell surface, such as a cell surface receptor. A preferred target is CD62L.
(61) The present invention further provides an antibody that specifically binds to the peptide comprised in the fusion protein of the invention. Such an antibody may be a monovalent antibody. In preferred embodiments, an antibody of the invention comprises or consists of a camelid VHH domain. In preferred embodiments, an antibody of the invention is a single domain antibody, such as a camelid single domain antibody.
(62) The term antibody generally refers to a proteinaceous binding molecule with immunoglobulin-like functions. Typical examples of an antibody are, but are not limited to, immunoglobulins, as well as derivatives or functional fragments thereof which still retain the binding specificity. Techniques for the production of antibodies are well known in the art. The term antibody also includes immunoglobulins (Ig's) of different classes (i.e. IgA, IgG, IgM, IgD, IgE, IgY etc.) and subclasses (such as IgG1, IgG2 etc.), even if recombinantly produced in foreign hosts using techniques known to those skilled in the arts. Illustrative examples of an antibody are full length immunoglobulins, F.sub.ab fragments, F(ab).sub.2, F.sub.V fragments, single-chain F.sub.V fragments (scF.sub.V), diabodies or domain antibodies (Holt U et al., Trends Biotechnol. 21(11), 2003, 484-490). Domain antibodies may be single domain antibodies, single variable domain antibodies or immunoglobulin single variable domain having only one variable domain, which may be VH or VL, that specifically bind an antigen or epitope independently of other V regions or domains. A particularly preferred single domain antibody is a VHH domain of a heavy chain only antibody. Such an immunoglobulin single variable domain may not only encompass an isolated antibody single variable domain polypeptide, but also a larger polypeptide that includes or consists of one or more monomers of an antibody single variable domain polypeptide sequence. It is understood that a single domain antibody may comprise a VHH domain and a fusion partner, such as a protein or peptide tag. The definition of the term antibody thus also includes embodiments such as chimeric, single chain and humanized antibodies. The term antibody may also include fragments of antibodies.
(63) Single domain antibodies are antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies. Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, goat, rabbit, or cattle. According to the invention, a single domain antibody as used herein is preferably derived from a naturally occurring antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 94/04678 for example. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH to distinguish it from the conventional VH of four chain immunoglobulins. Such a VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, dromedary, llama, vicua, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain. As an illustrative example, it is known that sharks produce heavy chain antibodies naturally devoid of light chains (commonly named IgNAR), which also comprise a VHH domain. In addition, VHHs may be obtained from synthetic libraries. All such VHHs are within the scope of the invention.
(64) VHHs, according to the present invention, and as known to the skilled addressee are preferably heavy chain variable domains derived from immunoglobulins naturally devoid of light chains such as those derived from Camelidae as described in WO 94/04678 (and referred to hereinafter as VHH domains or nanobodies). VHH molecules are about 10 smaller than IgG molecules. They are single polypeptides and very stable, resisting extreme pH and temperature conditions. Moreover, they are highly resistant to the action of proteases, which is not the case for conventional antibodies. Furthermore, in vitro expression of VHHs or expression in prokaryotic or eukaryotic organisms suited for recombinant protein expression produces high yield, properly folded functional VHHs. It is understood that single domain antibody according to the invention is preferably a VHH.
(65) An antibody according to the invention may carry one or more domains that have a sequence with at least about 60%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 92%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% sequence identity with a corresponding naturally occurring domain of an immunoglobulin naturally devoid of light chains. It is noted in this regard, the term about or approximately as used herein means within a deviation of 20%, such as within a deviation of 10% or within 5% of a given value or range.
(66) Percent (%) sequence identity with respect to amino acid sequences disclosed herein is defined as the percentage of amino acid residues in a candidate sequence that are pair-wise identical with the amino acid residues in a reference sequence, i.e. an antibody molecule of the present disclosure, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publically available computer software such as BLAST, ALIGN, or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximum alignment over the full length of the sequences being compared. The same is true for nucleotide sequences disclosed herein.
(67) The term variable refers to the portions of the immunoglobulin domains that exhibit variability in their sequence and that are involved in determining the specificity and binding affinity of a particular antibody (i.e., the variable domain(s)). Variability is not evenly distributed throughout the variable domains of antibodies; it is concentrated in sub-domains of each of the heavy and light chain variable regions. These sub-domains are called hypervariable regions, HVR, or HV, or complementarity determining regions (CDRs). The more conserved (i.e., non-hypervariable) portions of the variable domains are called the framework regions (FR). The variable domains of naturally occurring heavy and light chains each include four FR regions, largely adopting a -sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the -sheet structure. The hypervariable regions in each chain are held together in close proximity by the FR and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site (see Kabat et al., see below). Generally, naturally occurring immunoglobulins include six CDRs (see below); three in the VH (H1, H2, H3), and three in the VL (L1, L2, L3). In naturally occurring immunoglobulins, H3 and L3 display the most diversity of the six CDRs, and H3 in particular is believed to play a unique role in conferring fine specificity to immunoglobulins. Immunoglobulins naturally devoid of light chains, however, include three CDRs that are in the VHH region. The constant domains are not directly involved in antigen binding, but exhibit various effector functions, such as, for example, antibody-dependent, cell-mediated cytotoxicity and complement activation.
(68) Each VHH, VH and VL has three CDRs and four FRs, arranged from amino-terminus (N-terminus) to carboxy-terminus (C-terminus) in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and/or light chains contain a binding domain that interacts with an epitope of an antigen. The term immunoglobulin may refer to protein that may two heavy chains without light chains, such as e.g. an antibody devoid of light chains, or an antigen-binding portion thereof. An immunoglobulin may also include at least two heavy (H) chains and two light (L) chains linked by disulfide bonds, or an antigen-binding portion thereof.
(69) An immunoglobulin when used herein, may be a dimeric glycosylated protein composed of two heavy chains such as a camelid heavy chain only IgG (hcIgG) or a shark IgNAR. An immunoglobulin as used herein may also be a tetrameric glycosylated protein composed of two light (L) chains of approximately 25 kDa each and two heavy (H) chains of approximately 50 kDa each.
(70) When used in connection with a protein or peptide, the term amino acid or amino acid residue typically refers to an -amino carboxylic acid having its art recognized definition such as an amino acid selected from the group consisting of: L-alanine (Ala or A); L-arginine (Arg or R); L-asparagine (Asn or N); L-aspartic acid (Asp or D); L-cysteine (Cys or C); L-glutamine (Gln or Q); L-glutamic acid (Glu or E); glycine (Gly or G); L-histidine (His or H); L-isoleucine (Ile or I): L-leucine (Leu or L); L-lysine (Lys or K); L-methionine (Met or M); L-phenylalanine (Phe or F); L-proline (Pro or P); L-serine (Ser or S); L-threonine (Thr or T); L-tryptophan (Trp or W); L-tyrosine (Tyr or Y); and L-valine (Val or V), although modified, synthetic, or rare amino acids such as e.g. taurine, ornithine, selenocysteine, homocystine, hydroxyproline, thioproline, iodo-tyrosine, 3-nitro-tyrosine, ornithine, citrulline, canavanine, 5-hydroxytryptophane, carnosine, cycloleucine, 3,4-dihydroxy phenylalanine, N-acetylcysteine, prolinol, allylglycine or acetidine-2-carboxylic acid may be used as desired. Generally, amino acids can be grouped as having a nonpolar side chain (e.g., Ala, Cys, Ile, Leu, Met, Phe, Pro, Val); a negatively charged side chain (e.g., Asp, Glu); a positively charged sidechain (e.g., Arg, His, Lys); or an uncharged polar side chain (e.g., Asn, Cys, Gln, Gly, His, Met, Phe, Ser, Thr, Trp, and Tyr).
(71) A target according to the invention is any substance of biological or chemical origin to which an antibody of the invention is capable to detect directly or indirectly. Targets may be, for example, proteins, peptides, nucleic acids, oligonucleic acids, saccharides, polysaccharides, glycoproteins. Examples include, but are not limited to therapeutic targets, diagnostic targets, receptors, receptor ligands, viral coat proteins, immune system proteins, hormones, enzymes, antigens, cell signaling proteins, or a fragment thereof. Targets may be native protein or a fragment thereof, a homologous sequence thereof, a functional portion thereof, or a functional portion of a homologous sequence.
(72) The term epitope, also known as the antigenic determinant, refers to the portion of an antigen to which an antibody specifically binds, thereby forming a complex. Thus, the term epitope includes any molecule or protein determinant capable of specific binding to an immunoglobulin or T-cell receptor. The binding site(s) (paratope) of an antibody molecule described herein may specifically bind to/interact with conformational or continuous epitopes, which are unique for the target structure. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Epitope determinants may include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three dimensional structural characteristics, and/or specific charge characteristics. With regard to polypeptide antigens a conformational or discontinuous epitope is characterized by the presence of two or more discrete amino acid residues, separated in the primary sequence, but assembling to a consistent structure on the surface of the molecule when the polypeptide folds into the native protein/antigen (Sela, M., Science (1969) 166, 1365-1374; Laver, W. G., et al. Cell (1990) 61, 553-556). The two or more discrete amino acid residues contributing to the epitope may be present on separate sections of one or more polypeptide chain(s). These residues come together on the surface of the molecule when the polypeptide chain(s) fold(s) into a three-dimensional structure to constitute the epitope. In contrast, a continuous or linear epitope consists of two or more discrete amino acid residues, which are present in a single linear segment of a polypeptide chain. As an illustrative example, a context-dependent CD3 epitope refers to the conformation of said epitope. Such a context-dependent epitope, localized on the epsilon chain of CD3, can only develop its correct conformation if it is embedded within the rest of the epsilon chain and held in the right position by heterodimerization of the epsilon chain with either CD3 gamma or delta chain. In contrast thereto, a context-independent CD3 epitope may be an N-terminal 1-27 amino acid residue polypeptide or a functional fragment thereof of CD3 epsilon. Generally, epitopes can be linear in nature or can be a discontinuous epitope. Thus, as used herein, the term conformational epitope refers to a discontinuous epitope formed by a spatial relationship between amino acids of an antigen other than an unbroken series of amino acids. The term epitope also includes an antigenic determinant of a hapten, which is known as a small molecule that can serve as an antigen by displaying one or more immunologically recognized epitopes upon binding to larger matter such as a larger molecule e.g. a protein.
(73) An antibody or antibody molecule/fragment is said to specifically bind to an antigen when it recognizes its target antigen within a complex mixture of proteins and/or macromolecules. Typically, the antibody is capable of specifically interacting with and/or binding to its target but does not essentially bind to another epitope or antigen. Antibodies are said to bind to the same epitope if the antibodies cross-compete so that only one antibody can bind to the epitope at a given point of time, i.e. one antibody prevents the binding or modulating effect of the other.
(74) Typically, binding that is considered specific may also have a high affinity, e.g. when the binding affinity is higher than 10.sup.6 M (in terms of K.sub.d). In particular, the binding affinity may be about 10.sup.8 to 10.sup.11 M (K.sub.d), or of about 10.sup.9 to 10.sup.11 M or even higher. Thus, antibody molecules with an affinity in the picomolar range (with a K.sub.d of 9.910.sup.10 M to 10.sup.12 M) are also encompassed in the present invention. If necessary, nonspecific binding of a binding site can be reduced without substantially affecting specific binding by varying the binding conditions.
(75) An antibody according to the invention may be an isolated antibody molecule. The term isolated antibody molecule as used herein refers to an antibody molecule that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are matter that would interfere with uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. In some embodiments the antibody molecule is purified to greater than 95% by weight of antibody as determined by the Lowry method, such as more than 99% by weight. In some embodiments the antibody molecule is purified to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator. In some embodiments the antibody is purified to homogeneity as judged by SDS-PAGE under reducing or non-reducing conditions using Coomassie blue or, preferably, silver stain. An isolated antibody molecule may in some embodiments be present within foreign host cells with one or more component(s) of the antibody's natural environment not being present. Typically an isolated antibody is prepared by at least one purification step.
(76) Unless otherwise indicated CDRs sequences of the disclosure follow the definition by AbM used by Oxford Molecular's AbM antibody modelling software. See, generally, e.g., Protein Sequence and Structure Analysis of Antibody Variable Domains. In: Antibody Engineering Lab Manual (Ed.: Duebel, S. and Kontermann, R., Springer-Verlag, Heidelberg). Other standards for defining CDRs exist as well, such as the definition according to Maass 2007 (Journal of Immunological Methods 324 (2007) 13-25). Another standard is the definition according to Kabat CDRs, as described in Sequences of Proteins of immunological Interest, US Department of Health and Human Services (1991), eds. Kabat et al. Another standard for characterizing the antigen binding site is to refer to the hypervariable loops as described by Chothia (see, e.g., Chothia, et al. (1992); J. MoI. Biol. 227:799-817; and Tomlinson et al. (1995) EMBO J. 14:4628-4638). It is understood that embodiments described with respect to the CDR definition of AbM, can alternatively be implemented using similar described relationships such as with respect to Maass, Kabat, or Chothia definition.
(77) The valence of an antibody is generally an expression of the number of antigen-binding sites for one molecule of any given antibody or the number of antibody-binding sites for any given antigen. Most antibody molecules, and those belonging to the IgG, IgA, IgD and IgE immunoglobulin classes, have two antigen-binding sites per molecule. In general, a monovalent antibody comprises a single antigen binding site. Examples for a monovalent antibody are a single domain antibody, a VHH domain, a single Fab fragment, a Fv fragment, a scFv fragment, or a single VH or VL domain.
(78) The terms Fab, Fab region, Fab portion or Fab fragment are understood to define a polypeptide that includes a V.sub.H, a C.sub.H1, a V.sub.L, and a C.sub.L immunoglobulin domain. Fab may refer to this region in isolation, or this region in the context of an antibody molecule according to the invention, as well as a full-length immunoglobulin or immunoglobulin fragment. Typically a Fab region contains an entire light chain of an antibody. A Fab region can be taken to define an arm of an immunoglobulin molecule. It contains the epitope-binding portion of that Ig. The Fab region of a naturally occurring immunoglobulin can be obtained as a proteolytic fragment by a partial papain-digestion. A F(ab).sub.2 portion is the proteolytic fragment of a partially pepsin-digested immunoglobulin. A Fab portion is the product resulting from reducing the disulfide bonds of an F(ab).sub.2 portion. As used herein the terms Fab, Fab region, Fab portion or Fab fragment may further include a hinge region that defines the C-terminal end of the antibody arm (cf. above). This hinge region corresponds to the hinge region found C-terminally of the C.sub.H1 domain within a full length immunoglobulin at which the arms of the antibody molecule can be taken to define a Y. The term hinge region is used in the art because an immunoglobulin has some flexibility at this region.
(79) An Fv or Fv fragment consists of only the V.sub.L and V.sub.H domains of a single arm of an immunoglobulin. Thus an Fv is the minimum antibody fragment which contains a complete antigen-recognition and binding site. A two-chain Fv fragment consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. A single-chain Fv species (scFv) includes a V.sub.H and a V.sub.L domain of an immunoglobulin, with these domains being present in a single polypeptide chain in which they are covalently linked to each other by a flexible peptide linker. Typically, in a scFv fragment the variable domains of the light and heavy chain associate in a dimeric structure analogous to that in a two-chain Fv species. In single chain Fv fragments, it is possible to either have the variable domain of the light chain arranged at the N-terminus of the single polypeptide chain, followed by the linker and the variable domain of the heavy chain arranged at the C-terminus of the polypeptide chain or vice versa, having the variable domain of the heavy chain arranged on the N-terminus and the variable domain of the light chain at the C-terminus with the peptide linker arranged in between. The peptide linker can be any flexible linker known in the art, for example, made from glycine and serine residues. It is also possible to additionally stabilize the domain association between the V.sub.H and the V.sub.L domain by introducing disulfide bonds into conserved framework regions (see Reiter et al. Stabilization of the Fv fragments in recombinant immunotoxins by disulfide bonds engineered into conserved framework regions, Biochemistry 1994, 33, 6551-5459). Such scFv fragments are also known as disulfide-stabilized scFv fragments (ds-scFv).
(80) The term Fc region or Fc fragment is used herein to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions. The Fc part mediates the effector function of antibodies, e.g. the activation of the complement system and of Fc-receptor bearing immune effector cells, such as NK cells. In human IgG molecules, the Fc region is generated by papain cleavage N-terminal to Cys226. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody molecule, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody molecule. Accordingly, a composition of intact antibodies may include antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue. Suitable native-sequence Fc regions for use in the antibodies of the invention include mammalian, e.g. human or murine, IgG1, IgG2 (IgG2A, IgG2B), IgG3 and IgG4. The Fc region contains two or three constant domains, depending on the class of the antibody. In embodiments where the immunoglobulin is an IgG the Fc region has a C.sub.H2 and a C.sub.H3 domain.
(81) An antibody according to the invention may be produced using any known and well-established expression system and recombinant cell culturing technology, for example, by expression in bacterial hosts (prokaryotic systems), or eukaryotic systems such as yeasts, fungi, insect cells or mammalian cells. An antibody molecule of the present invention may be produced in transgenic organisms such as a goat or a plant. An antibody may also be produced by chemical synthesis.
(82) An antibody of the invention may comprise the CDR1 sequence GVTISALNAMAMG (SEQ ID NO: 115) or a sequence having 1 or 2 mutations relative to said sequence, the CDR2 sequence AVSERGNAM (SEQ ID NO: 116) or a sequence having 1 or 2 mutations relative to said sequence, and the CDR3 sequence LEDRVDSFHDY (SEQ ID NO: 117) or a sequence having 1 or 2 mutations relative to said sequence. An antibody of the invention may comprise the CDR1 sequence GVTISALNAMAMG (SEQ ID NO: 118) or a sequence having 1 or 2 mutations relative to said sequence, the CDR2 sequence AVSSRGNAM (SEQ ID NO: 119) or a sequence having 1 or 2 mutations relative to said sequence, and the CDR3 sequence. An antibody of the invention may comprise the CDR1 sequence GVTVSALNAMAMG (SEQ ID NO: 121) or a sequence having 1 or 2 mutations relative to said sequence, the CDR2 sequence AVSERGNAM (SEQ ID NO: 122) or a sequence having 1 or 2 mutations relative to said sequence, and the CDR3 sequence LEDRVDSFHDY (SEQ ID NO: 123) or a sequence having 1 or 2 mutations relative to said sequence. It is understood that such an antibody preferably comprises or consists of a camelid VHH domain, such as a single domain antibody, or an antibody naturally devoid of light chains. It is further understood that an antibody in which 1 or 2 mutations have been introduced to one, two, or all three of the CDR sequences is still capable of specifically binding the peptide comprised in the fusion protein of the invention, in particular a peptide having the core structure of SEQ ID NO: 3, such as a peptide of any one of SEQ ID NOs: 05-07. In such an antibody of the invention, the E or S at amino acid position 4 of CDR2 may be mutated to G, A, L, I, S, T, V, C, M, D, N, E, Q, F, Y, H, W, K, R, or P, preferably to D, N, or H. Such an antibody of the invention may comprise the FR1 sequence EVQLX.sub.1ESGGGLVX.sub.2PGGSX.sub.3RLSCTAS, wherein X.sub.1 is Q, V, E, or L, X.sub.2 is Q or P, and X.sub.3 is L or M (SEQ ID NO: 124), or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence. Such an antibody of the invention may comprise the FR1 sequence EVQLQESGGGLVQPGGSLRLSCTAS (SEQ ID NO: 125) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence. Such an antibody of the invention may comprise the FR2 sequence WYRQX.sub.1PGEX.sub.2RVMVA, wherein X.sub.1 is A or R and X.sub.2 is R or E (SEQ ID NO: 126) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence. Such an antibody of the invention may comprise the FR2 sequence WYRQAPGERRVMVA (SEQ ID NO: 127) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence.
(83) Such an antibody of the invention may comprise the FR2 sequence WYRQAPGEERVMVA (SEQ ID NO: 128) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence. Such an antibody of the invention may comprise the FR3 sequence YRESVQGRFTVTRDFTNKMVSLQMDNLX.sub.1PEDX.sub.2AVYYCHV, wherein X1 is K or Q and X.sub.2 is T or M (SEQ ID NO: 129) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence. Such an antibody of the invention may comprise the FR3 sequence YRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV (SEQ ID NO: 130) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence. Such an antibody of the invention may comprise the FR4 sequence WGQGX.sub.1QVTVSS, wherein X.sub.1 is T or I (SEQ ID NO: 131) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence. Such an antibody of the invention may comprise the FR4 sequence WGQGTQVTVSS (SEQ ID NO: 132) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence.
(84) An antibody of the invention may comprise or consist of the VHH sequence selected from the group consisting of:
(85) TABLE-US-00006 (a) (SEQIDNO:133) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVM VAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS; (b) (SEQIDNO:134) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGEERVM VAAVSSRGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS; (c) (SEQIDNO:135) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGEERVM VAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS; (d) (SEQIDNO:136) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVM VAAVSSRGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS; (e) (SEQIDNO:137) EVQLVESGGGLVPPGGSMRLSCTASGVTVSALNAMAMGWYRQRPGERRVM VAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLQPEDMAVYYCHV LEDRVDSFHDYWGQGIQVTVSS; (f) (SEQIDNO:138) EVQLVESGGGLVPPGGSMRLSCTAPGVTVSALNAMAMGWYRQRPGERRVM VAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLQPEDMAVYYCHV LEDRVDSFHDYWGQGIQVTVSS; (g) (SEQIDNO:139) EVQLVESGGGVVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVM VAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS; (h) (SEQIDNO:140) EVQLVESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVM VAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS; (i) (SEQIDNO:141) EVQLEESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVM VAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS; and (j) (SEQIDNO:142) EVQLLESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVM VAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS; (k) (SEQIDNO:175) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVM VAAVSDRGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS; (l) (SEQIDNO:176) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVM VAAVSNRGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS; (m) (SEQIDNO:177) EVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVM VAAVSHRGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHV LEDRVDSFHDYWGQGTQVTVSS
or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to any one of said sequences.
(86) An antibody of the invention may comprise the CDR1 sequence GTMSAINALN (SEQ ID NO: 143) or a sequence having 1 or 2 mutations relative to said sequence, the CDR2 sequence AITDNGNAH (SEQ ID NO: 144) or a sequence having 1 or 2 mutations relative to said sequence, and the CDR3 sequence LEEEKLGVWVDY (SEQ ID NO: 145) or a sequence having 1 or 2 mutations relative to said sequence. An antibody of the invention may comprise the CDR1 sequence GTMSAINALN (SEQ ID NO: 146) or a sequence having 1 or 2 mutations relative to said sequence, the CDR2 sequence AITDNGNAH (SEQ ID NO: 147) or a sequence having 1 or 2 mutations relative to said sequence, and the CDR3 sequence LEEKLGAWVDY (SEQ ID NO: 148) or a sequence having 1 or 2 mutations relative to said sequence. An antibody of the invention may comprise the CDR1 sequence GTMSAINALN (SEQ ID NO: 149) or a sequence having 1 or 2 mutations relative to said sequence, the CDR2 sequence AITDNGNAH (SEQ ID NO: 150) or a sequence having 1 or 2 mutations relative to said sequence, and the CDR3 sequence LEKEKLGVWVDY (SEQ ID NO: 151) or a sequence having 1 or 2 mutations relative to said sequence. It is understood that such an antibody preferably comprises or consists of a camelid VHH domain, such as a single domain antibody, or an antibody naturally devoid of light chains. It is further understood that an antibody in which 1 or 2 mutations have been introduced to one, two, or all three of the CDR sequences is still capable of specifically binding the peptide comprised in the fusion protein of the invention, in particular a peptide having the core structure of SEQ ID NO: 3, such as a peptide of any one of SEQ ID NOs: 05-07. Such an antibody of the invention may comprise the FR1 sequence EVQLX1ESGGGLVQPGGSLTLSCAAS, wherein X1 is V or L (SEQ ID NO: 152) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence. Such an antibody of the invention may comprise the FR2 sequence WYRQX1PGKERKMVA, wherein X1 is P or A (SEQ ID NO: 153) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence. Such an antibody of the invention may comprise the FR3 sequence YADSVKGRFTISRDNARNMVFLQMNSLX1PDDTAVYYCHY, wherein X1 is K or E (SEQ ID NO: 154) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence. Such an antibody of the invention may comprise the FR4 sequence WGQGTQVTVSS (SEQ ID NO: 155) or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to said sequence.
(87) An antibody of the invention may comprise or consist of the VHH sequence selected from the group consisting of:
(88) TABLE-US-00007 (a) (SEQIDNO:156) EVQLVESGGGLVQPGGSLTLSCAASGTMSAINALNWYRQPPGKERKMVAA ITDNGNAHYADSVKGRFTISRDNARNMVFLQMNSLKPDDTAVYYCHYLEE EKLGVWVDYWGQGTQVTVSS; (b) (SEQIDNO:157) EVQLLESGGGLVQPGGSLTLSCAASGTMSAINALNWYRQAPGKERKMVAA ITDNGNAHYADSVKGRFTISRDNARNMVFLQMNSLEPDDTAVYYCHYLEE KLGAWVDYWGQGTQVTVSS; and (c) (SEQIDNO:158) EVQLVESGGGLVQPGGSLTLSCAASGTMSAINALNWYRQPPGKERKMVAA ITDNGNAHYADSVKGRFTISRDNARNMVFLQMNSLKPDDTAVYYCHYLEK EKLGVWVDYWGQGTQVTVSS; or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to any one of said sequences.
(89) The antibody of the invention may be conjugated to a detectable label. In general, such a detectable label may be any appropriate chemical substance or enzyme, which directly or indirectly generates a detectable compound or signal in a chemical, physical, optical, or enzymatic reaction. For example, a fluorescent or radioactive label can be conjugated to the antibody to generate fluorescence or X-rays as detectable signal. Alkaline phosphatase, horseradish peroxidase and -galactosidase are examples of enzyme labels (and at the same time optical labels), which catalyze the formation of chromogenic reaction products. In a preferred embodiment, the detectable label refers to detectable entities that can be used for the detection of the target of interest in microscopy, immunohistochemistry or flow cytometry. Preferably, the label does not negatively affect the characteristics of the antibody to which the label is conjugated. Examples of labels are fluorescent labels such as phycoerythrin, allophycocyanin (APC), Brilliant Violet 421, Alexa Fluor 488, coumarin or rhodamines to name only a few. There are many types of detectable labels, including a fluorescent label, a chromophore label, an isotope label, or a metal label, with a fluorescent label being preferred. The presence of a fusion protein of the invention may be detected by contacting the fusion protein with an antibody of the invention conjugated to a detectable label and detecting the signal of the detectable label. For a fluorescent label, this means detection of emitted light upon excitation of the fluorescent label. Non-exhaustive examples for suitable fluorescent labels are green emitters (Atto488, Alexa488, Cy2, etc.), orange emitters (Atto542, alexa555, Cy3, etc.), Red-far-Red emitters (Alexa633, Atto 647N, Cy5, etc.), infrared emitters (Atto700, LiCor IRDye700, LiCor IRDye800, etc.), ultra-violet absorbing fluorescent dyes (Atto390 or Alexa405). A fluorescent label may also be a fluorescent protein, such as GFP, eGFP, YFP, RFP, CFP, BFP, mCherry, or near-infrared fluorescent proteins. Non-exhaustive examples for a suitable chromophore label are alkaline phosphatase or peroxidase exposed to TMB (3,3,5,5 tetramethylbenzidine), DAB (3,3,4,4 diaminobenzidine), and 4CN (4-chloro-1-naphthol). ABTS (2,2-azino-di [3-ethyl-benzthiazoline]sulfonate), OPD (o-phenylenediamine), and to BCIP/NBT (5-bromo-4-chloro-3-indolyl-phosphate/nitroblue tetrazolium). Non-exhaustive examples for isotope labels are 13C, 15N, 19F, 27A1, 11B, 1271 or different Lanthanides isotopes. Non-exhaustive examples for a metal label are Au, Pd, Pb, Pt Ag, Hg and Os. The label may be a direct label, i.e. a label that is directly detectable. Alternatively, the label may be an indirect label, i.e. a label which is an affinity tag (or epitope tag) that can be specifically bound by another specific binding partner that is conjugated to another detectable label, such as a fluorescent or chromophore label. Examples of suitable epitope tags include, but are not limited to, FLAG-tag (sequence: DYKDDDDK, SEQ ID NO: 160), Strep-tag (sequence: WSHPQFEK, SEQ ID NO: 178), Myc-tag (sequence: EQKLISEEDL, SEQ ID NO: 161), HA-tag (sequence: YPYDVPDYA, SEQ ID NO: 162), VSV-G-tag (sequence: YTDIEMNRLGK, SEQ ID NO: 163), HSV-tag (sequence: QPELAPEDPED, SEQ ID NO: 164), V5-tag (sequence: GKPIPNPLLGLDST, SEQ ID NO: 165), SPOT-tag (sequence: PDRVRAVSHWSS, SEQ ID NO: 166), BC2 tag (sequence: PDRKAAVSHWQQ, SEQ ID NO: 167), and EPEA tag (sequence: EPEA, SEQ ID NO: 168). The antigen may also be a protein, for example, glutathione-S-transferase (GST), maltose binding protein (MBP), chitin binding protein (CBP) or thioredoxin as an antigen. The detectable label may further be a nucleic acid, such as an oligonucleotide having a recognition sequence. Such a recognition sequence may be a random sequence. This random sequence may be barcode sequence that has been incorporated into the nucleic acid molecules and can be used to identify the target molecule that has been conjugated with said nucleic acid. An antibody of the invention may be conjugated to a detectable label may also mean that the antibody itself is the detectable label. This may imply that the antibody is an affinity target that can be specifically recognized by another specific binding partner that specifically binds to the antibody. For example, such a specific binding partner may be an antibody that specifically recognizes camelid VHH domains. Such a specific binding partner may further be conjugated to a detectable label, such as a fluorescent label.
(90) An antibody of the invention may be conjugated to a solid support. The term solid support or in the context of the present invention refers to any type of carrier material that can be used for immobilization of affinity ligands such as antibodies or parts thereof and it can refer to material in particulate (e.g. beads or granules, generally used in extraction columns) or in sheet form (e.g. membranes or filters, glass or plastic slides, microtiter assay plates, dipstick, capillary fill devices or such like) which can be flat, pleated, or hollow fibers or tubes. Suitable and well-known matrices without being exhaustive: are silica (porous amorphous silica), agarose or polyacrylamide supports, or macroporous polymers. Examples include dextran, collagen, polystyrene, polypropylene, polyvinylchloride, polyacrylamide, methacrylate, celluloses, calcium alginate, controlled pore glass, aluminum, titanium and porous ceramics, synthetic polymers and co-polymers, latex, silica, agarose, metal, glass, and carbon. Alternatively, the solid surface may comprise part of a mass dependent sensor, for example, a surface plasmon resonance detector. Conveniently, an array comprising a plurality of individual affinity ligand such as antibodies or antibody fragments, which are capable of specifically binding the epitope tag of the present invention, bound or immobilized to a solid surface is provided. This array can be used to capture tagged polypeptides comprised in a solution as soon the solution is brought in contact with the immobilized affinity ligand such as antibodies or antibody fragments. A solid support can also be a magnetic bead or polymeric bead or a chromatographic stationary phase.
(91) An antibody of the invention may be in complex with an epitope it specifically binds to. Such an epitope may be a peptide that is comprised in the fusion protein of the invention. The antibody of the invention may thus be in complex with a fusion protein of the invention. The present invention therefore encompasses a fusion protein comprising an peptide that the antibody of the invention specifically binds to.
(92) The present invention also relates to a complex comprising (a) fusion protein and (b) an antibody, wherein the fusion protein is a fusion protein of the invention and/or wherein the antibody is an antibody of the invention.
(93) The present invention also relates to a nucleic acid molecule comprising a sequence encoding a fusion protein of the invention as described herein or an antibody of the invention as described herein. The nucleic acid molecule may be a DNA or an RNA molecule. The nucleic acid molecules of the invention may be part of a vector or any other kind of cloning or expression vehicle, such as a plasmid, a phagemid, a phage, a baculovirus, a cosmid or an artificial chromosome. The nucleic acid molecule, may allow expression of the fusion protein or antibody. It may include sequence elements that contain information regarding to transcriptional and/or translational regulation, and such sequences may be operably linked to the nucleotide sequence encoding the protein. An operable linkage is a linkage in which the regulatory sequence elements and the sequence to be expressed are connected in a way that enables gene expression. The precise nature of the regulatory regions necessary for gene expression may vary among species, but in general these regions include a promoter, which, in prokaryotes, contains both the promoter per se, i.e., DNA elements directing the initiation of transcription, as well as DNA elements which, when transcribed into RNA, will signal the initiation of translation. Such promoter regions normally include 5 non-coding sequences involved in initiation of transcription and translation, such as the 35/10 boxes and the Shine-Dalgarno element in prokaryotes or the TATA box, CAAT sequences, and 5-capping elements in eukaryotes. These regions can also include enhancer or repressor elements as well as translated signal and leader sequences for targeting the native protein to a specific compartment of a host cell.
(94) Such a vehicle described herein may include, aside from the regulatory sequences described herein and a nucleic acid sequence encoding a peptide or protein described herein, replication and control sequences derived from a species compatible with a host cell that is used for expression as well as selection markers conferring a selectable phenotype on transformed or transfected cells. Large numbers of suitable cloning vectors are known in the art and are commercially available. Accordingly, the present invention also relates to a vector comprising the nucleic acid molecule of the invention.
(95) Cloning or expression of nucleic acid molecule or the vector of the invention can be conducted at least partially in vivo, using host cells transformed with the nucleic acid or vector, or to which the nucleic acid molecule or vector has been transferred by other means including transduction or transfection. Transfer of DNA can be performed using standard techniques. Thus, the disclosure is also directed to a host cell containing a nucleic acid molecule or a vector as disclosed herein.
(96) A peptide of the invention is useful for several applications. These cellular applications may have in common that the peptide is used as an epitope tag. Non-limiting examples for applications, in which the peptide is useful include, but are not limited to, detection, immobilization, isolation, or purification of the fusion protein of the invention. Similarly also an antibody of the invention may be used for all applications that includes specific binding of an epitope tag. An antibody of the invention may be used for example for detection, immobilization, isolation, or purification of a fusion protein of the invention.
(97) The present invention also relates to a method of detecting a fusion protein of the invention. Detection can be optical detection, isotopic detection, or detection by electron microscopy. The method comprises contacting the fusion protein with an antibody of the invention, preferably under conditions allowing the formation of a complex between the peptide comprised in the fusion protein and the antibody. The antibody of the invention preferably carries a detectable label as defined herein. Where the detectable label is a fluorescent label, chromophore label, isotope label, or metal label attached to it, it is understood that the antibody preferably has a defined number of labels attached to it. The method may comprise the step of detecting the detectable label. The method may comprise expressing the fusion protein of the invention prior to contacting the fusion protein with the antibody.
(98) The term detection as used herein includes both, direct detection of a target (i.e. wherein the target is detected by a signal deriving from a target) and indirect detection of a target (i.e. wherein the target is detected by a signal that does not directly derive from the target, e.g. by a signal that derives from another molecule attached to the target). The term detection as used herein further includes both, qualitative and quantitative detection. The term detection may refer to determination of the presence, subcellular localization, or amount of a given molecule or structure, such as the fusion protein of the invention. The fusion protein to be detected, located and/or quantified can be detected at its intracellular location in a host cell, for example in the cell nucleus, in cell membranes or another cell compartment. The fusion protein to be detected, and/or to be quantified can also be detected in a solution comprising the tagged polypeptide or protein, for example a cell lysate obtained from a host cell or a tissue comprising the host cell.
(99) The term optical, as used herein, preferably refers to visible light but is generally not limited to it. The term may also refer to infrared, ultraviolet and other regions of the electromagnetic spectrum.
(100) As used herein, isotopic detection relates to the detection of a molecule in which one or more atoms have been replaced (i.e. labeled) with another isotope that commonly has a detectable variation. The isotopic label can be detected by multiple means, such as their mass (e.g. by mass spectrometry, matrix-assisted laser desorption/ionization (MALDI), desorption electrospray ionization (DESI), laser-ablation inductively coupled plasma mass spectrometry (LA-ICP-MS), or secondary-ion mass spectrometry (SIMS), vibrational mode (e.g. by infrared spectroscopy), gyromagnetic ratios (e.g. by nuclear magnetic resonance), or radioactive decay (e.g. an ionization chamber or autoradiographs of gels).
(101) Electron microscopy relates to a method of detection using an electron microscope. Types of electron microscopes include transmission electron microscope (TEM), scanning electron microscope (SEM), reflection electron microscope (REM), scanning transmission electron microscope (STEM), and Correlative Light and Electron Microscopy (CLEM).
(102) In a first step of a detection method, an antibody specifically binding the peptide comprised in the fusion protein of the present invention may be contacted with a sample comprising the fusion protein. The sample may be a host cell, a tissue, a solution comprising cell lysate of a host cell or any other sample that comprises the fusion protein, such as a supernatant, as obtained after centrifugation of a liquid comprising the host cell, wherein the host cell is capable of secreting the polypeptide of interest into the liquid or another specimen like a body fluid.
(103) This contacting step is preferably carried out at conditions that allow specific interaction of the antibody and the peptide it specifically binds to. Such conditions are well known to the person of skill in the art. Washing steps typically follow the contacting step of an antibody to its antigen, and the skilled person knows how and when to apply said washing steps. Upon contacting with the sample, the antibody will specifically interact with the fusion protein. This interaction can be detected, monitored and quantified by measuring or observing the reporter signal obtained from the detectable label. For example, if the detectable label is a fluorescent label, fluorescence can be measured and observed upon excitation.
(104) If the detectable label is an affinity tag (or epitope tag) that can be specifically bound by another specific binding partner that is conjugated to another detectable label, such as a fluorescent or chromophore label. In such a case, detection of the detectable label attached to the antibody of the invention may be conducted by contacting the antibody with a specific binding partner that specifically binds to the detectable label conjugated to the antibody of the invention. The specific binding partner may be labeled with a further detectable label that can preferably be distinguished from the first detectable label, such as a fluorescent or chromophore label. The specific binding partner may however be a structure, which can be recognized by another specific (labeled) binding reagent. For example, the specific binding partner that binds to the detectable label conjugated to the antibody of the invention may be a (primary) antibody, which may be specifically recognized by a (secondary) antibody, which carries a detectable label that is preferably distinguishable from the first detectable label, such as a fluorescent label. The method of detection the fusion protein of the invention may thus comprise the step of contacting the fusion protein and the antibody with a specific binding partner for the detectable label comprised in the antibody. Where a second detectable label is present, the method may comprise the step of detecting the first and/or the second detectable label.
(105) According to methods where the detectable label conjugated to the antibody of the invention is an affinity tag, the method of detecting the fusion protein may comprise, in a first step, contacting the antibody of the invention with a sample comprising or suspected to comprise the fusion protein of the invention. In a second step, a (secondary) specific binding partner can be contacted with the sample comprising the fusion protein bound to the antibody of the invention. In cases where the (secondary) specific binding partner is not conjugated to a detectable label or where the detectable label is an affinity tag, the method may further comprise the step of contacting a further specific binding partner, such as a further antibody that specifically binds to the (secondary) specific binding partner or its detectable label. The further specific binding partner may comprise a detectable label, such as a fluorescent label that can be used for detection of the fusion protein. Presence, amount and/or localization of the tagged polypeptide or protein can be detected or determined by measuring or observing a reporter signal obtained from a detectable label comprised in the (secondary) specific binding partner or further specific binding partner.
(106) An advantage of a two-step detection method using two types of binding partners is that the tag specific interaction is separated from the actual detection step. This allows that the antibody of the invention remains unchanged, as it does not need to comprise an additional detectable moiety. This may in some cases enhance its specificity or affinity compared to an antibody comprising an additional detectable label, as the detectable label could in some cases influence the interaction of the peptide comprised in the fusion protein of the invention and the antibody of the invention. Thus, the reliability and efficiency of the detection method could be enhanced in some cases. Furthermore, using the antibody of the invention simply as a capture antibody and not as a capture and detection antibody, allows separation of the capture and the detection steps if only presence and amount of the fusion protein is to be determined. Therefore, the first step using the antibody of the invention could be followed by an isolation or enrichment step, yielding the captured fusion protein of interest. The detection step could then be carried out on the isolated and/or enriched fusion protein, leading to an enhanced reliability of the obtained quantification and an easier handling of the detection step.
(107) Suitable biophysical or biomolecular detection methods for qualitatively detecting the epitope tag/antibody interaction comprise any suitable method known in the art. Such methods include, without being limited thereto, methods as applied for qualitative or quantitative assays, e.g. for Enzyme-linked Immunosorbent Assay (ELISA), ELISPOT assay, Western Blot, or immunoassays. Such methods comprise e.g. optical, radioactive or chromatographic methods, preferably when using any of the above labels, markers or linkers, more preferably fluorescence detection methods, radioactivity detection methods, Coomassie-Blue staining, silver staining or other protein staining methods, electron microscopy methods, methods for staining tissue sections by immunohistochemistry or by direct or indirect immunofluorescence, etc. Such methods may be applied either with the antibody or may involve the use of further tools, e.g. the use of a secondary binding partner, specifically binding to a part of the fusion protein, the antibody, or the complex.
(108) In some embodiments, the subcellular localization of the tagged polypeptide or protein of interest can also be determined. For example, distinct subcellular structures such as the intermediate filamentous network or an essential part of the replication machinery can be visualized and monitored.
(109) Detection of the fusion protein can also be carried out using an antibody of the invention that is an intrabody. An intrabody as used herein refers to an antibody that is located within a cell to bind to an intracellular protein. Due to the lack of a reliable mechanism for bringing an antibody into a living cell from the extracellular environment, this typically requires the expression of the antibody within the target cell. After expression, the antibody may remain in the cytoplasm, or it may have a nuclear localization signal, or it may undergo co-translational translocation across the membrane into the lumen of the endoplasmic reticulum, provided that it is retained in that compartment through a KDEL sequence. A detectable label conjugated to an intrabody may be a proteinaceous label, which can be expressed as fusion protein with the intrabody. Ideally, such a label may be optically detectable, such as by fluorescence. The detectable label may thus be a fluorescent protein.
(110) The present invention also relates to a method of isolating the fusion protein of the invention. Such a method comprises contacting the fusion protein with an antibody of the invention, preferably under conditions allowing formation of a complex between the antibody and the peptide comprised in the fusion protein. Thereby, binding of the fusion protein and the antibody is enabled. This contacting step, also referred to as capture step, may be conducted by contacting a sample, for example a solution, comprising the fusion protein with the antibody.
(111) The sample to be contacted with the tag specific antibody can be any type of sample comprising a fusion protein of the invention and can be processed to separate the polypeptide. Preferably the sample is a solution, for example a lysate of a host cell or a body fluid, comprising the fusion protein of the invention, or a supernatant, such as a supernatant obtainable by centrifugation of a liquid comprising a host cell comprising or capable of expressing fusion protein of the invention, wherein the host cell is capable of secreting or otherwise transporting the fusion protein of the invention to the liquid.
(112) The antibody used in the method of the present invention for isolation and/or purification can be used in solution or immobilized. To immobilize the antibody, the antibody can be bound to a sample carrier, solid support, or matrix. This immobilization step can occur prior to or after the binding of the antibody to the peptide comprised in the fusion protein. Methods for immobilizing antibodies and parts thereof are well-known to the person skilled in the art and any method that allows immobilization without impairing binding properties can be used.
(113) If the antibody of the present invention is not immobilized to a solid support, then the method may comprise a further step of isolating the complex, for example by using a specific binding partner for the complex, such as a secondary antibody that is specific for example for the complex or for the antibody or for a detectable label, such as an affinity tag, that is conjugated to the antibody. The secondary binding partner can be in solution or can be immobilized or immobilizable to a solid support.
(114) In an optional further step following the capture step, the solid support comprising the immobilized antibody bound to the fusion protein is washed to remove unbound and unspecifically bound constituents.
(115) Optionally, in a further step, the fusion protein can be eluted to obtain the isolated fusion protein. Elution of the fusion protein bound to the immobilized antibody can be achieved by methods known in the art. For example, the fusion protein can be eluted by competitive elution with an epitope peptide as described herein in isolated form. This isolated epitope peptide will then be in competition with the fusion protein to bind the immobilized tag-specific antibody. If the isolated peptide is added in surplus concentration, the reaction balance of the binding will be shifted to the binding of the immobilized antibody with the isolated epitope tag. This results in the release of the fusion protein. The epitope peptide used for elution may be the same epitope peptide that is comprised in the fusion protein. The epitope peptide used for elution may also be a different peptide than the epitope peptide comprised in the fusion protein. If the epitope peptide used for elution is a different one, it is preferred that the epitope peptide used for elution has a higher binding affinity to the antibody than the epitope peptide comprised in the fusion protein. Additional steps for further purifying the released polypeptide can optionally be added, such as method steps well-known to the skilled person.
(116) The fusion protein may also remain immobilized to the solid support, such as (magnetic) beads, and processed further in downstream application such as mass spectrometry, without the elution step.
(117) The fusion protein may comprise a linker with a cleavage site that can be cleaved with an appropriate means, for example a protease, to remove the peptide. Thereby the polypeptide of the fusion protein may be released from the immobilized antibody, and the polypeptide can be obtained in its native form. For this embodiment, the nucleic acid sequence encoding the fusion protein should not only comprise a sequence encoding the epitope tag but also a sequence encoding a linker with a breakable site, for example a cleavage site recognized by a protease. The release step by enzymatic cleave can replace or follow the elution step.
(118) Where the fusion protein of the invention comprises an antibody moiety, the present invention also envisions a method of isolating the target of the antibody moiety of the invention. In principle, this method can be carried out as described above for the isolation of a fusion protein. The method may comprise the additional step of contacting the fusion protein with a specific target of the antibody moiety comprised in the fusion protein. This contacting step may be conducted prior to or after contacting the fusion protein with the antibody that binds to the peptide tag comprised in the fusion protein, with the latter alternative being preferred. In a preferred method, first the antibody specific for the peptide tag is immobilized on the solid support, and then the fusion protein is immobilized via binding to the antibody that is specific to the peptide tag, followed by binding the target of the antibody moiety of the fusion protein to the fusion protein. Elution can be carried out as described above. The specific target may be a cell. For example, a cell surface receptor on the cell, such as CD62L. The antibody moiety of the fusion protein may be specific to a structure on the cell, such as CD62L. The antibody moiety of the fusion protein may be a single domain antibody.
(119) The present invention also envisions that detection and isolation of a fusion protein of the invention can be combined. Accordingly, the present invention envisions a method of detection and isolation of a fusion protein of the invention comprising a method of detection of the invention and a method of isolation and/or purification of the invention.
(120) Combination of both methods may thus be carried out by using one antibody conjugated to a detectable label for detection, and another antibody conjugated to a solid support for isolation of the same fusion protein. Both antibodies may be any antibody of the invention. This combination may have the advantage that only one tagged fusion protein has to be generated and detection and isolation carried out with the same transgenic construct/cell. Sometimes, it may be desired that both antibodies have an identical sequence or at least an identical antigen-binding site. For example, both antibodies may comprise CDR 1-3 sequences set forth in SEQ ID NOs: 115-117 or may comprise the sequence set forth SEQ ID NO: 133 or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO: 133. Sometimes, it may be desired that both antibodies have different sequences or different antigen-binding sites. Using different antibodies may have the advantage that tight binder, e.g, an antibody having a high affinity (e.g. about 1 pM to about 1 nM) to the peptide comprised in the fusion protein, can be used for detection, whereas a moderate binder, i.e. an antibody having moderate affinity (e.g. about 1 nM to about 500 nM) can be used for isolation of the fusion protein. For example, one of the antibodies may comprise CDR 1-3 sequences set forth in SEQ ID NOs: 115-117 or may comprise the sequence set forth SEQ ID NO: 133 or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO: 133 while the other antibody may comprise CDR 1-3 sequences set forth in SEQ ID NOs: 118-120 or may comprise the sequence set forth SEQ ID NO: 134 or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO: 134. The peptide comprised in the fusion protein may be a peptide having a core sequence of SEQ ID NO: 3 or 4 as described herein.
(121) Combination of both methods can also be carried out by using the same antibody and two different peptides for detection and purification. This has the advantage, that only one antibody has to be produced which, depending on the application, can be conjugated to a detectable label or a solid support. When using two different peptides, it is preferred that the peptides have different binding affinity to the antibody. The peptide that is used for detection, may have a high binding affinity of e.g. about 1 pM to 1 nM, while the peptide that is used for isolation may have a moderate binding affinity of about 1 nM to 500 nM. Using peptides having different binding affinities may have the advantage that if a moderate affinity peptide is comprised in the fusion protein for isolation, a high(er) affinity peptide can be used for elution of the fusion protein. Accordingly, one peptide may be a peptide having a core sequence of SEQ ID NO: 3 or 4 as described herein, while the other peptide may be a peptide having a core sequence of SEQ ID NO: 31 or 32 as described herein. The antibody may be any antibody of the invention, e.g. the antibody may comprise CDR 1-3 sequences set forth in SEQ ID NOs: 115-117 or may comprise the sequence set forth SEQ ID NO: 133 or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO: 133.
(122) Combination of both methods can also be carried out by using two peptides and two antibodies. The fusion protein of interest may comprise a peptide having a high affinity to a given antibody. For example, the peptide may be a peptide having a core sequence of SEQ ID NO: 3 or 4 as described herein. The antibody for detection may comprise CDR 1-3 sequences set forth in SEQ ID NOs: 115-117 or may comprise the sequence set forth SEQ ID NO: 133 or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO: 133. The antibody for isolation/purification may comprise CDR 1-3 sequences set forth in SEQ ID NOs: 118-120 or may comprise the sequence set forth SEQ ID NO: 134 or a sequence having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO: 134. The peptide used for elution may be a peptide having higher affinity to the antibody for elution than the peptide comprised in the fusion protein, such as another peptide described herein.
(123) The present invention further relates to a system comprising one peptide tag and two antibodies or two peptide tags and one antibody or two peptide tags and two antibodies as described herein.
(124) The present invention also relates to a kit. The kit may comprise components necessary to carry out a method of the present invention. A kit for detection or purification of a fusion protein may comprise a nucleic acid or a nucleic acid expression construct encoding a peptide/epitope tag as defined herein, which may be present in the fusion protein. The nucleic acid may comprise a site, such as a cleavage or recombination site, that facilitates genetically fusing a polypeptide to the peptide/epitope tag. A nucleic acid sequence encoding the peptide/epitope tag may be operably linked to sequence elements that contain information regarding to transcriptional and/or translational regulation.
(125) The kit may also comprise an antibody of the invention, optionally conjugated to a detectable label described herein, preferably an optically detectable label or an affinity tag. Alternatively or additionally, the kit may comprise a detectable moiety that can be conjugated to the antibody of the invention.
(126) The kit may also comprise buffers and reagents necessary for the isolation/purification and/or detection methods of the present invention.
(127) The kit may also comprise buffers and reagents necessary to introduce the nucleic acid or the nucleic acid expression construct comprised in the kit into a host cell.
(128) The kit may also comprise at least one (secondary) specific binding partner as described herein or a (further) specific binding partner that specifically binds the (secondary) specific binding partner as described herein.
(129) The kit may also comprise a solid support comprising the antibody of the invention immobilized or attached to the solid support. The kit may also comprise an isolated peptide as described herein suitable for competitive elution of a fusion protein bound to an antibody of the invention, or other means for elution of the fusion protein, such as a proteinase.
(130) Unless otherwise indicated, the term at least preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.
(131) The term and/or wherever used herein includes the meaning of and, or and all or any other combination of the elements connected by said term.
(132) The term about or approximately as used herein means within 20%, preferably within 10%, and more preferably within 5% of a given value or range. It includes, however, also the concrete number, e.g., about 20 includes 20.
(133) Throughout this specification and the claims which follow, unless the context requires otherwise, the word comprise, and variations such as comprises and comprising, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used herein the term comprising can be substituted with the term containing or including or sometimes when used herein with the term having.
(134) When used herein consisting of excludes any element, step, or ingredient not specified in the claim element. When used herein, consisting essentially of does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim.
(135) In each instance herein any of the terms comprising, consisting essentially of and consisting of may be replaced with either of the other two terms.
(136) It should be understood that this invention is not limited to the particular methodology, protocols, material, reagents, and substances, etc., described herein and as such can vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which is defined solely by the claims.
(137) All publications cited throughout the text of this specification (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, etc.) are hereby incorporated by reference in their entirety. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention. To the extent the material incorporated by reference contradicts or is inconsistent with this specification, the specification will supersede any such material.
EXAMPLES
Example 1: The System
(138) In search for a novel epitope tag/binder system, we designed peptides SEQ ID NOs: 05-07 that form a stable -helix in solution and are collectively referred to as ALFA.sup.ST tag. These peptides do not have a known counterpart in any eukaryotic model system, they are nearly neutral at physiological pH and do not contain any primary amines that could be a target for common fixatives. The core ALFA tag sequence (
(139) High-affinity nanobodies against ALFA.sup.ST were raised in Alpaca and selected by Celline, a novel nanobody selection method employing antigen-specific enrichment of B-cells. To create a selective affinity resin, our favorite nanobody (NbALFA.sup.ST, clone 1G5, SEQ IS NO: 133) was site-specifically coupled via a flexible linker to an agarose-based resin featuring low nonspecific protein binding. The resulting ALFA Selector.sup.ST resin was highly efficient in pulling down an ALFA.sup.ST-shGFP2 fusion protein from E. coli extracts. Surprisingly, however, all approaches to elute the bound protein under native conditions by competition with ALFA.sup.ST peptide (Ac-PSRLEEELRRRLTEP-Amide set forth in SEQ ID NO: 179) failed. Even after 90 minutes competition with 10 column volumes of 200 M peptide, >95% of the ALFA.sup.ST-shGFP2 protein remained on the resin (
(140) TABLE-US-00008 TABLE2 Sequence Position Class t.sub.1/2 dsMRLEEELRRRLSKg M n.d. n.d. (SEQIDNO:90) dsMRLEEELRRRLSPg M n.d. n.d. (SEQIDNO:91) sdSG-EEELRRRLSPg M T0 <2 min (SEQIDNO:92) sdSG--EELRRRLSPg M T0 <2 min (SEQIDNO:93) dsGRLEEELRRR-SPg M T0 <2 min (SEQIDNO:94) dsGRLEEELRR--SPg M T0 <2 min (SEQIDNO:95) dsGRLEEELR---SPg M T0 <2 min (SEQIDNO:96) sdSGLEEEARRRLSPg M T0 <2 min (SEQIDNO:97) sdSGAEEELRRRLSPg M T0 <2 min (SEQIDNO:98) dsGALEEELRRRLSPg M T0 <2 min (SEQIDNO:99) dsGALEQEIRRRLSPg M T0 <2 min (SEQIDNO:100) dsGRLEQEIRRALSPg M T0 <2 min (SEQIDNO:101) dsGRLEQEIRRQLSPg M T0 <2 min (SEQIDNO:102) dsGRLEQEIRRELSPg M T0 <2 min (SEQIDNO:103) pdSGLEQELRRRLPTa M T0 <2 min (SEQIDNO:104) dpSGLEQELRRRLPTa M T0 <2 min (SEQIDNO:105) dsPGLEQELRRRLPT.sub.a M T0 <2 min (SEQIDNO:106) dsGPLEQELRRRLPTa M T0 <2 min (SEQIDNO:107) gpSGLEQELRRRLa C T0 <2 min (SEQIDNO:108) MSAVEEELRRRLSPs N T0 <2 min (SEQIDNO:109) MSGLEQELRRRLTPs N T0 <2 min (SEQIDNO:110) MSAVEEELRRRLSPs N T0 <2 min (SEQIDNO:111) MpSAVEEELRRRLSPs N T0 <2 min (SEQIDNO:112) MsSAVEEELRRRLSPs N T0 <2 min (SEQIDNO:113) psGRLEEELRRRLP. C T0 <2 min (SEQIDNO:114) dsGRLEEELRRRLSKg M T1 2-30 min (SEQIDNO:62) dsGRLEEELRRRLSPg M T1 2-30 min (SEQIDNO:63) sdSGLEEELRRRLSPg M T1 2-30 min (SEQIDNO:64) sdSGVEEELRRRLSPg M T1 2-30 min (SEQIDNO:65) sdSAVEEELRRRLSPg M T1 2-30 min (SEQIDNO:66) sdSGLQEELRRRLSPg M T1 2-30 min (SEQIDNO:67) sdSGLEEQLRRRLSPg M T1 2-30 min (SEQIDNO:68) sdSGLEEEIRRRLSPg M T1 2-30 min (SEQIDNO:69) sdSGLEEEVRRRLSPg M T1 2-30 min (SEQIDNO:70) .sub.dsGELEEELRRRLSPg M T1 2-30 min (SEQIDNO:71) dsGRLEQELRRRLSPg M T1 2-30 min (SEQIDNO:72) dsGRLEEEIRRRLSPg M T1 2-30 min (SEQIDNO:73) dsGRLEQEIRRRLSPg M T1 2-30 min (SEQIDNO:74) dsGRLEQEIARRLSPg M T1 2-30 min (SEQIDNO:75) .sub.dsGRLEQEIQRRLSPg M T1 2-30 min (SEQIDNO:76) dsGRLEQEIERRLSPg M T1 2-30 min (SEQIDNO:77) dsGRLEQEIRARLSPg M T1 2-30 min (SEQIDNO:78) dsGRLEQEIRQRLSPg M T1 2-30 min (SEQIDNO:79) dsGRLEQEIRERLSPg M T1 2-30 min (SEQIDNO:80) gpSRLEEELRRRL. C T1 2-30 min (SEQIDNO:81) MSGLEQELRRRLTPs N T1 2-30 min (SEQIDNO:82) MsGRLEEELRRRLSPs N T1 2-30 min (SEQIDNO:83) spSAVEEELRRRLSPs M T1 2-30 min (SEQIDNO:84) gpSAVEEELRRRLS. C T1 2-30 min (SEQIDNO:85) MpSGLEQELRRRLTPs N T1 2-30 min (SEQIDNO:86) MsSGLEQELRRRLTPs N T1 2-30 min (SEQIDNO:87) MpSGRLEEELRRRLSps N T1 2-30 min (SEQIDNO:88) msGRLEEELRRRLSPs M T1 2-30 min (SEQIDNO:83) msGRLEEELRRRLSP C T1 2-30 min (SEQIDNO:89) msGRLEEELRRRLSP N,M,C T1 2-30 min (SEQIDNO:33) sdSGLEQELRRRLSPg M T1 2-30 min (SEQIDNO:34) pdGGLEQELRRRLTAp M T1 2-30 min (SEQIDNO:35) psGGLEQELRRRLTAp M T1 2-30 min (SEQIDNO:36) dsPGLEQELRRRLTAp M T1 2-30 min (SEQIDNO:37) pdSGLEQELRRRLTP.sub.a M T1 2-30 min (SEQIDNO:38) spSGLEEELRRRLTAep M T1 2-30 min (SEQIDNO:39) gpSGLEQELRRRLT. C T1 2-30 min (SEQIDNO:40) gpSGLEQELRRRLTAas. C T1 2-30 min (SEQIDNO:41) spSRLEEELRRRLPSk M T1 2-30 min (SEQIDNO:42) spSGLEQELRRRLTPs M T1 2-30 min (SEQIDNO:43) spGRLEQEIRRRLSPs M T1 2-30 min (SEQIDNO:44) psGRLEEELRRRLSPs M T1 2-30 min (SEQIDNO:45) psGRLEEELRRRLS. C T1 2-30 min (SEQIDNO:46) psGRLEEELRRRLA. C T1 2-30 min (SEQIDNO:47) psGRLEEELRRRLSP. C T1 2-30 min (SEQIDNO:48) pdSGLEQELRRRLSPg M T2 20-100 min (SEQIDNO:50) pdSGLEQELRRRLTAp M T2 20-100 min (SEQIDNO:51) psSGLEQELRRRLTAp M T2 20-100 min (SEQIDNO:52) dpSGLEQELRRRLTAp M T2 20-100 min (SEQIDNO:53) dsGPLEQELRRRLTAp M T2 20-100 min (SEQIDNO:54) spSRLEEELRRRLTAep M T2 20-100 min (SEQIDNO:55) spSGLEEELRRRLTAp M T2 20-100 min (SEQIDNO:56) spSGLEEELRRRLDAp M T2 20-100 min (SEQIDNO:57) spSGLEEELRRRLEAp M T2 20-100 min (SEQIDNO:58) spSGLEEELRRRLTDp M T2 20-100 min (SEQIDNO:59) spSGLEEELRRRLTAdp M T2 20-100 min (SEQIDNO:60) gpSGLEQELRRRLTA. C T2 20-100 min (SEQIDNO:169) spSGLEQELRRRLTDp M T2 20-100 min (SEQIDNO:170) spSGLEQELRRRLTAdp M T2 20-100 min (SEQIDNO:171) spSGLEQELRRRLTAep M T2 20-100 min (SEQIDNO:172) dsPGLEQELRRRLTAp M T2 20-100 min (SEQIDNO:173) spSGLEQELRRRLSP.sub.s M T2 20-100 min (SEQIDNO:174) grSRLEEELRRRLTA. C T3 >100 min (SEQIDNO:08) pgSRLEEELRRRLTAp M T3 >100 min (SEQIDNO:09) psTRLEEELRRRLTAp M T3 >100 min (SEQIDNO:10) spSRLEEELRRRLTAp M T3 >100 min (SEQIDNO:11) spSRLEEELRRRLDAp M T3 >100 min (SEQIDNO:12) spSRLEEELRRRLEAp M T3 >100 min (SEQIDNO:13) spSRLEEELRRRLTDp M T3 >100 min (SEQIDNO:14) spSRLEEELRRRLTEp M T3 >100 min (SEQIDNO:15) spSRLEEELRRRLTAdp M T3 >100 min (SEQIDNO:16) spSGLEEELRRRLTEp M T3 >100 min (SEQIDNO:17) gPSRLEEELRRRLT. C T3 >100 min (SEQIDNO:18) gPSRLEEELRRRLTA. C T3 >100 min (SEQIDNO:19) gPSRLEEELRRRLTAa. C T3 >100 min (SEQIDNO:20) gPSRLEEELRRRLTAas. C T3 >100 min (SEQIDNO:21) spSGLEQELRRRLTAp M T3 >100 min (SEQIDNO:22) spSGLEQELRRRLDAp M T3 >100 min (SEQIDNO:23) spSGLEQELRRRLEAp M T3 >100 min (SEQIDNO:24) spSGLEQELRRRLTEp M T3 >100 min (SEQIDNO:25) gpSRLEEELRRRLTAp. C T3 >100 min (SEQIDNO:26) gpSRLEEELRRRLTEp. C T3 >100 min (SEQIDNO:27) gpSRLEEELRRRLTE. C T3 >100 min (SEQIDNO:28) MSRLEEELRRRLTEp N T3 >100 min (SEQIDNO:29) MpSRLEEELRRRLTEp N T3 >100 min (SEQIDNO:05) pSRLEEELRRRLTE.sub.p M T3 >100 min (SEQIDNO:06) pSRLEEELRRRLTE C T3 >100 min (SEQIDNO:07) MsSRLEEELRRRLTE.sub.
(141) As a rough estimation, which is based on an estimated on-rate of 2*10.sup.5 (1/(M*sec)), which is commonly observed for sdAbs, t.sub.1/2 of <2 min correspond to a K.sub.d of > about 30 nM, t.sub.1/2 of 2-30 min correspond to a K.sub.d of about 2-30 nM, t.sub.1/2 of 20-100 min correspond to a K.sub.d of about 0.6-3 nM, and t.sub.1/2 of more than 100 min correspond to a K.sub.d of about 1 nM or lower.
(142) We found an ALFA mutant (ALFA.sup.PE for Peptide Elutable) (SEQ ID NO: 33) fulfilling these criteria. Proteins fused to ALFA.sup.PE efficiently bound to the ALFA Selector.sup.ST. Binding was even resistant to harsh washing steps (e.g. up to 3M NaCl, 1M MgSO.sub.4, 4M urea, 1% TX-100 or even 100 mM DTT,
Example 2: Application of NbALFA.SUP.ST .for Pull-Down of ALFA-Tagged Target Proteins
(143) To address the specificity of ALFA Selector.sup.ST, we performed pull-down experiments from complex lysates under physiological conditions. To this end, E. coli or HeLa lysates prepared in PBS were spiked with 3 M of shGFP2 (Frey, S. et al. Surface Properties Determining Passage Rates of Proteins through Nuclear Pores. Cell 174, 202-217.e9 (2018)) N-terminally tagged with either ALFA.sup.ST or ALFA.sup.PE, that have been expressed in E. coli and purified via Nickel-chelate chromatography followed by size exclusion chromatography before. The purified input proteins are shown in
Example 3: Co-Immunoprecipitation Using ALFA.SUP.PE.-Tagged Target Protein and ALFA Selector.SUP.ST
(144) To see if the ALFA system can also be applied for more delicate co-immunoprecipitation experiments, we tried to pull down the binary E. coli YfgM-PpiD inner membrane protein complex (Gtzke, H. et al. YfgM is an ancillary subunit of the SecYEG translocon in Escherichia coli. J Biol Chem 289, 19089-19097 (2014)) under native conditions (
Example 4: Detection of ALFA.SUP.ST.-Tagged Proteins by Direct Immunofluorescence
(145) We first tested if fluorescently labeled NbALFA.sup.ST could be applied for immuno-detection of ALFA-tagged proteins in PFA-fixed samples. Indeed, using the NbALFA.sup.ST (SEQ ID NO: 133) coupled to two fluorophores (FluoTag-X2 anti-ALFA AbberiorStar635P), a specific staining pattern could be obtained irrespective of the localization of the ALFA.sup.ST tag or ALFA.sup.PE tag within the target proteins in mammalian cells. More specifically, we successfully tested target proteins with ALFA tags placed at the C-terminus (Tom70-EGFP-ALFA.sup.ST,
Example 5: ALFA.SUP.ST.-Tagged Proteins Show Normal Folding, Targeting and Multimerization Status
(146) Importantly, all assayed target proteins showed their characteristic localization (Tom70-EGFP-ALFA: mitochondrial outer membrane; ALFA-Vimentin: characteristic filamentous structures; EGFP-ALFA.sup.ST-TM: plasma membrane), indicating that the ALFA-tags did not interfere with general folding or proper targeting of the tagged proteins. Proper incorporation of ALFA.sup.ST-Vimentin and ALFA.sup.PE-Vimentin into characteristic intermediate filament structures (
(147) To more sensitively address if the ALFA.sup.ST tag influence the intracellular localization of a fused protein of interest, we statistically analyzed the localization of cytosolic EGFP harboring N- or C-terminal ALFA.sup.ST tags transfected into mammalian cells (
Example 6: ALFA Tags are Compatible with Common Fixation Conditions
(148) Immunofluorescence (IF) applications often require optimization of fixation conditions. This may be complicated, especially if proteins requiring different fixation conditions need to be localized in the same specimen. In addition, established epitope tags often contain lysines that render them potentially sensitive towards modification by amine-reactive fixatives (Table 1). The ALFA tags, in contrast, do not contain lysines. In line with these considerations, the ALFA.sup.ST tag and the ALFA.sup.PE tag could be detected after standard fixation with 4% paraformaldehyde (PFA) or precipitative fixation with 100% methanol and was even resistant to fixation with 2% glutaraldehyde (
Example 7: Detecting ALFA.SUP.ST.-Tagged Proteins In Vivo
(149) We next wanted to know if our NbALFA.sup.ST can also be used as an intrabody. Such nanobodies expressed in situ in the cytoplasm (or other compartments) of a target cell are often used to localize or manipulate target proteins in life cells (Caussinus, E., Kanca, O. & Affolter, M. Fluorescent fusion protein knockout mediated by anti-GFP nanobody. Nat Struct Mol Biol 19, 117-121 (2012); Kirchhofer, A. et al. Modulation of protein properties in living cells using nanobodies. Nat Struct Mol Biol 17, 133-138 (2010)). Such applications depend on the stability and functionality of a given nanobody in the reducing environment of the cytoplasm of a eukaryotic host cell. To test our nanobody under such conditions, we co-expressed ALFA.sup.ST-tagged target proteins (ALFA.sup.ST-Vimentin or Tom70-EGFP-ALFA.sup.ST) with NbALFA.sup.ST fused to mScarlet-I (Bindels, D. S. et al. mScarlet: a bright monomeric red fluorescent protein for cellular imaging. Nat Methods 11, 121-122 (2016)). Indeed, in cells co-transfected with both constructs, the mScarlet-I signal robustly co-localized with the respective ALFA.sup.ST_tagged target protein (
Example 8: Western-Blot
(150) In order to test if the ALFA-tag can be detected with a Western-blot using fluorescently labeled NbALFA.sup.ST, we analyzed lysates from COS-7 cells transfected with ALFA.sup.ST-tagged Vimentin (
(151) To directly compare the performance of NbALFA.sup.ST with commonly used monoclonal tools recognizing epitope tags, we produced maltose-binding protein (MBP) fused to multiple epitope tags (HA, myc, FLAG and ALFA.sup.ST,
Example 9: Capture of ALFA.SUP.ST.-Tagged Target Proteins Using ALFA Selector Resins
(152) Next, we site-specifically immobilized NbALFA.sup.ST on an agarose-based resin with ultra-low background via a hydrophilic and flexible linker. Binding to the nanobody-coupled resin was analyzed using an ALFA.sup.ST-tagged GFP variant (shGFP2; Frey, S. et al. Surface Properties Determining Passage Rates of Proteins through Nuclear Pores. Cell 174, 202-217.e9 (2018);
Example 10: The Interaction of ALFA-Tagged Proteins with ALFA Selector is Compatible with Stringent Washing
(153) We decided to further analyze the biochemical properties of both ALFA Selector resins. To this end, both resins were charged with either ALFA.sup.ST-shGFP2 or shGFP2-ALFA.sup.ST and subjected to stringent washing steps (
Example 11: pH Resistance
(154) In a similar assay, the loaded ALFA Selector resins were washed with buffers adjusted to different pH (
Example 12: Affinity Estimation
(155) The affinity of shGFP2-ALFA.sup.ST to both NbALFA.sup.ST and NbALFA.sup.PE was determined in solution by microscale thermophoresis (MST). This technique provided evidence that NbALFA.sup.PE has a dissociation constant of 15 nM, while NbALFA.sup.ST binds shGFP2-ALFA.sup.ST with a K.sub.d of 10 M, which is the lower detection limit of the device. These values are well in line with the dissociation kinetics observed during peptide elution (
Example 13: Pull-Down of ALFA.SUP.ST.-Tagged Target Proteins from Complex Lysates
(156) To address the specificity of our ALFA Selector resins, we performed pull-down experiments from complex lysates under physiological conditions (
Example 14: Co-Immunoprecipitation Using ALFA Selector.SUP.PE .Resin
(157) To see if the ALFA system can also be applied for more delicate co-immunoprecipitation experiments, we tried to pull down the binary E. coli YfgM-PpiD inner membrane protein complex (Gtzke, H. et al. YfgM is an ancillary subunit of the SecYEG translocon in Escherichia coli. J Biol Chem 289, 19089-19097 (2014)) under native conditions (
Example 15: Isolation of Live Lymphocytes
(158) An envisioned application for the ALFA Selector.sup.PE is the specific enrichment of cells under physiological conditions. This may be particularly interesting e.g. for the generation of chimeric antigen receptor-modified T (CAR-T) cells, the precursors of which are usually obtained from blood (Tokarew, N. et al. Teaching an old dog new tricks: next-generation CAR T cells. Br. J. Cancer (2018). doi:10.1038/s41416-018-0325-1). To investigate if the ALFA system can be applied to enrich live blood cells, human peripheral blood mononuclear cells (PBMCs) were passed through an ALFA Selector.sup.PE column pre-charged with an ALFA-tagged nanobody recognizing CD62L, a surface marker typically present on nave T cells (Lefrangois, L. Development, trafficking, and function of memory T-cell subsets. Immunological Reviews (2006). doi:10.1111/j.0105-2896.2006.00393.x) (
(159) Discussion
(160) We reported the development and initial characterization of the ALFA system. This system comprises the ALFA.sup.ST tag, a novel and highly versatile epitope tag, a mutant variant thereof (ALFA.sup.PE tag) and a set of related single-domain antibodies (nanobodies) recognizing the ALFA.sup.ST tag with extraordinarily high or moderate affinity, respectively. Importantly, the rational approach chosen allowed us to equip the ALFA system with features that are crucial for its generic applicability. When selecting the ALFA tag sequences, it was preferred that the tag was small, devoid of lysines, hydrophilic without carrying any net charge and absent within the proteome of relevant model organisms, but also that it would adopt a stable fold in solution. As a result, the ALFA tags are preferably by design highly specific, insensitive to amine-reactive fixatives, generally well tolerated by the tagged target proteins and can easily refold after denaturation.
(161) As binders we preferred nanobodies, because in contrast to conventional antibodies they are small, monovalent and robust probes that can easily be modified by genetic means and recombinantly produced in various expression systems. It is therefore possible to site-specifically immobilize nanobodies or to quantitatively introduce fluorescent labels (Pleiner, T. et al. Nanobodies: site-specific labeling for super-resolution imaging, rapid epitope-mapping and native protein complex isolation. Elife 4, (2015)). NbALFA.sup.ST, our preferred high affinity nanobody recognizing the ALFA.sup.ST tag, can thus readily be used e.g. for direct immunofluorescence. Due to the small size of the nanobodies (3-4 nm diameter) and the defined number and location of the attached dyes, fluorescently labeled NbALFA.sup.ST is an ideal tool for high-resolution or quantitative imaging. We could show that NbALFA.sup.ST faithfully interacts with various ALFA.sup.ST_tagged target proteins expressed in mammalian cells. Importantly, NbALFA.sup.ST can even fold in the cytoplasm of eukaryotic cells and can thus be used as an intrabody for detecting or manipulating ALFA-tagged target proteins in vivo (Rothbauer, U. et al. Targeting and tracing antigens in live cells with fluorescent nanobodies. Nat Methods 3, 887-889 (2006); Kirchhofer, A. et al. Modulation of protein properties in living cells using nanobodies. Nat Struct Mol Biol 17, 133-138 (2010); Rder, R. et al. Intracellular Delivery of Nanobodies for Imaging of Target Proteins in Live Cells. Pharm. Res. (2016). doi:10.1007/s11095-016-2052-8). This finding is in line with our biochemical evidence showing that NbALFA.sup.ST is resistant to at least 100 mM DTT at room temperature and suggests that the conserved internal disulfide bridge common to all nanobodies is largely dispensable for a faithful interaction with the ALFA.sup.ST tag. For intrabody applications, we found that expression of both, NbALFA.sup.ST fused to a fluorescent reporter and target proteins under the control of a CMV or PGK promoter, led to good results with low background. For optimal results or detection of low-abundant ALFA.sup.ST-tagged target proteins, more sophisticated titrations of the relative expression levels may be required.
(162) Generally, most nanobodies recognize three-dimensional epitopes on the surface of their target proteins and thus do not recognize denatured proteins (e.g. in Western-Blots). We could show that NbALFA.sup.ST is an exception from this rule as it can also be used for highly sensitive target protein detection in Western-Blot applications. This fact suggests that the ALFA.sup.ST and ALFA.sup.PE tags can efficiently refold after transfer to the membrane and removal of SDS. A direct comparison showed thatdespite its monovalent binding modeNbALFA.sup.ST significantly outperformed established monoclonal anti-epitope tag tools with respect to absolute signal intensities and detection limit. We envision similar advantages in other applications like ELISA or microarray assays that require high sensitivity. Due to the resistance to amine-reactive fixatives, we believe it will be possible to also adapt the ALFA system to immuno-EM applications in the future.
(163) The affinity of NbALFA.sup.ST for the ALFA.sup.ST tag is extraordinarily high. While this is ideal for high profile imaging applications and highly sensitive detection, it prevents an elution under physiological conditions within a reasonable time frame and thus sets limits for biochemical applications. We therefore aimed at lowering the affinity of the nanobody for its substrate without affecting its specificity. We approached this on two separate ways: 1) We screened a large selection of ALFA peptides for reduced binding strength. This approach led to the ALFA.sup.PE tag, which binds efficiently to NbALFA.sup.ST but can efficiently be eluted by competition with free ALFA.sup.ST peptide. 2) Based on the crystal structure of NbALFA.sup.ST in complex with the ALFA.sup.ST peptide, we introduced specific mutations in NbALFA.sup.ST that successfully increased the off-rate to a level allowing for an efficient peptide elution under physiological conditions. When immobilized to an agarose resin with low background binding, the mutant nanobody (NbALFA.sup.PE) proved to be ideally suited for native purifications of proteins and protein complexes from various lysates under physiological conditions. ALFA Selector.sup.ST displaying the wild-type high affinity nanobody (NbALFA.sup.ST), in turn, might have advantages in special applications requiring harsh washing with up to 6M urea or up to 0.1% SDS, or when extremely low-abundant proteins need to be depleted from dilute lysates. Elution from ALFA Selector.sup.ST, however, requires strongly denaturing or acidic elution (e.g. 1% SDS or Glycin pH2.2), which is in general incompatible with a native target protein conformation.
(164) The structure of NbALFA.sup.ST bound to the ALFA.sup.ST peptide shows that NbALFA.sup.ST recognizes the ALFA.sup.ST peptide in its alpha-helical conformation. In order to minimize the potential influences of neighboring secondary structures on the conformation of the ALFA.sup.ST tag, we placed the core ALFA.sup.ST sequence (SRLEEELRRRLTE, SEQ ID NO: 04)) between two prolines acting as insulators. Using this approach, the interaction of NbALFA.sup.ST with the ALFA.sup.ST tag is largely independent of the tag's localization within the protein, i.e. both NbALFA.sup.ST and NbALFA.sup.PE will recognize ALFA.sup.ST tags placed both at the N- and C-terminus of a target protein or even within two protein domains.
(165) Taken together, we here introduced a novel epitope tag system with exceptionally broad applicability. Using the ALFA system, a single transgenic cell line or organism harboring an ALFA.sup.ST-tagged target protein is sufficient for a wealth of different applications including (super-resolution) imaging, in-vivo manipulation of proteins, in-vitro detection by Western-blot or even native pull-down applications aiming at detecting specific interaction partners. ALFA Selector.sup.PE could even be applied for the selective enrichment of CD62L-positive lymphocytes from PBMC preparations (
(166) Material and Methods
(167) Transfection of 3T3 and COS-7 Cells
(168) For immunofluorescence experiments, 3T3 or COS-7 cells were transiently transfected with appropriate plasmids listed in Table 3, using the PolyJet transfection kit (SignaGen) according to the manufacturers recommendations. In short, for each experiment cells were seeded on 12-well plates. Volumes were adjusted according to the size of the well. 1 g of each plasmid was premixed with 38 l of serum-free medium and subsequently supplemented with PolyJet transfection reagent diluted in 38 l of serum-free medium. The suspension was incubated at room temperature for 15 min and afterwards added drop-wise to the cells. Cells were incubated for 24 h at 37 C. with 5% CO.sub.2. For co-expression experiments, plasmid DNA was premixed in a 1:1 ratio and further processed as described above.
(169) Fixation and Staining of COS-7 Cells
(170) Transiently transfected cells were fixed 24 h post transfection in either 4% paraformaldehyde (PFA) (w/v) or 2% glutaraldehyde (GA) (v/v) for 30 min at room-temperature. Alternatively, fixation was performed in ice cold methanol for 15 min at 20 C. Cells were blocked and permeabilized in PBS containing 10% normal goat serum (v/v) and 0.1% Triton-X 10 (v/v) for 15 min at room temperature. Fluorescently labeled NbALFA.sup.ST(FluoTag-X2 anti-ALFA AbberiorStar635P, NanoTag Biotechnologies N1502-Ab635P-L) was diluted 1:500 in PBS containing 3% normal goat serum and 0.1% Triton-X 100 (v/v). The cells were incubated in this staining solution for 1 h at room temperature and subsequently washed 3 times for 5 min with PBS. To stain the nucleus, DAPI (0.4 g/ml) was included in one of the PBS washing steps. Coverslips were mounted on cover-slides using MOWIOL solution, dried at 37 C. and imaged using an epifluorescence microscope (Axio, Zeiss) equipped with a 20 lens. Constructs expressed at the cell-surface were co-stained with anti-FLAG M2 (primary antibody, Sigma, F1804) and FluoTag-X2 anti-mouse IgG Atto488 (secondary nanobody, NanoTag, N1202-At488-L) diluted 1:1000 and 1:500 respectively, in PBS containing 3% normal goat serum and 0.1% Triton-X 100 (v/v).
(171) Impact of ALFA Tags on the Localization of EGFP
(172) Transiently transfected 3T3 cells were imaged using an epifluorescence microscope (Axio, Zeiss) equipped with a 401.3 oil lens. For cells transfected with either pCMV ALFA.sup.ST-EGFP, pCMV EGFP-ALFA.sup.ST, or pEGFP-N1, 107-133 cells were imaged on a total of six to seven individual images. For each individual image, cells were grouped and counted according to the localization of EGFP (slightly nuclear, equally distributed, other). The fraction of cells in each group was statistically analyzed using Student's t-test.
(173) Western Blots with COS-7 Lysates
(174) Transfected cells from a confluent 10 cm petri dish were washed with PBS and lysed in 2 mL SDS sample buffer. Lysates were resolved by SDS-PAGE and transferred to a nitrocellulose membrane. After blocking with 5% milk powder in TBS-T, membranes were incubated with mouse anti-tubulin (SYSY #302 211; 1:1000 dilution) followed by a FluoTag-X2 anti-Mouse IgG IRDye680 (NanoTag Biotechnologies #N1202; 1:1000 dilution) and FluoTag-X2 anti-ALFA IRDye800 (NanoTag Biotechnologies #1502; 1:1000 dilution). Membranes were scanned using Odyssey CLx (Li-COR).
(175) Sensitivity Assay
(176) A serial dilution of MBP fused to FLAG, HA, myc and ALFA.sup.ST tags was prepared in PBS pH7.4, 0.1 g/mL BSA. 1 l of each dilution was spotted on nitrocellulose membranes.
(177) The membrane was blocked and washed with 5% milk powder in TBS-T. Established monoclonal antibodies (anti-FLAG M2Sigma #F1804, anti-myc 9E10SynapticSystems #343 011, anti-HA F-7SantaCruz #sc-7392) were used in combination with a secondary goat anti-mouse IgG IRDye800CW (Li-COR #925-32210, dilution 1:500) to detect FLAG, myc and HA-tag, respectively. The ALFA.sup.ST tag was detected using a FluoTag-X2 anti-ALFA (NanoTag Biotechnologies #N1502) directly coupled to IRDye800CW. All primary antibodies and the nanobody were used at 2.7 nM final concentration. Detection of MBP by a rabbit polyclonal serum recognizing MBP (SynapticSystems) and an anti-rabbit IgG IRDye680RD (Li-COR #925-68071) served as an internal loading control. Membranes were scanned using Odyssey CLx (Li-COR). Quantifications were performed using ImageStudioLight (Li-COR).
(178) Off-Rate Assays
(179) 20 l ALFA Selector.sup.ST or ALFA Selector.sup.PE (NanoTag Biotechnologies) was saturated with the respective recombinant target protein. After washing 4 with PBS, the beads were suspended in a 10-fold excess of PBS containing 200 M free ALFA.sup.ST peptide and mixed at 25 C. Control reactions were carried out without peptide. At indicated time points, specific elution from the beads was quantified using the GFP fluorescence released into the supernatant (Q-Bit 3.0; Thermo-Fischer Scientific). Three independent experiments were performed in parallel. Mean values, standard deviations and exponential fits were calculated using GraphPad Prism 5.0. Photographic pictures were taken upon UV illumination using a Nikon D700 equipped with a 105 mm macro lens (Nikon).
(180) Resistance Towards Stringent Washing and pH
(181) Depending on the experiment, 10-15 l of ALFA Selector.sup.ST or ALFA Selector.sup.PE saturated with indicated ALFA-tagged shGFP2 fusion proteins were washed with PBS and incubated with 100 l of the indicated substances for 60 min at room temperature. Photos were taken after sedimentation of the beads upon UV illumination. To assay for pH resistance, the same beads were incubated with 150 mM NaCl buffered to various pH (100 mM Glycin-HCl, pH2.2; 100 mM Na-Acetate pH4.5, 100 mM Tris-HCl pH 7.5, 100 mM Carbonate pH9.5) for 30 min at RT. The resin was washed twice with the same buffer. Photos were taken after equilibrating several times with PBS.
(182) One-Step Affinity Purifications Using the ALFA Selector Resins.
(183) To obtain defined input materials for pull-down experiments from E. coli or HeLa lysates, respective mock lysates were blended with 3 M of the indicated purified ALFA-tagged shGFP2 variant. 1 mL of each lysate/substrate mixture was incubated with 25 l of ALFA Selector.sup.ST or ALFA Selector.sup.PE for 1 h at 4 C. Depending on the experimental setup, either an analogous resin without immobilized sdAb (Selector Control) or a mock lysate without target protein served as a specificity control. After washing 3 times with 600 L of PBS, the resins were transferred into MiniSpin columns (NanoTag Biotechnologies). Excess buffer was removed by centrifugation (3000g, 30 sek) before incubating twice for 10 min at room temperature with 50 l each of 200 M ALFA.sup.ST peptide in PBS. Proteins remaining on the beads were afterwards eluted with SDS sample buffer. 0.5 L (E. coli) or 1.5 L (HeLa) of input and non-bound fractions were resolved by SDS-PAGE (12%) and Coomassie staining. Shown eluate fractions correspond to the material eluted from 1 l of the respective resins.
(184) YfgM Pull-Downs Using ALFA Selector.sup.PE
(185) A yfgM deletion strain was complemented with either C-terminally ALFA.sup.ST-tagged or untagged YfgM expressed from a pSC-based low-copy vector under control of the endogenous promoter. Membrane protein complexes were solubilized from total lysates prepared in buffer LS (50 mM Tris pH7.5, 300 mM NaCl, 5 mM MgCl.sub.2) using 1% DDM within 1 h on ice (Maddalo, G. et al. Systematic analysis of native membrane protein complexes in Escherichia coli. J Proteome Res 10, 1848-1859 (2011)). Both lysates were incubated with 20 l of ALFA Selector.sup.PE resin for 1 h at 4 C. on a roller drum. After washing in PBS+0.3% DDM, bound proteins were eluted under native conditions by sequentially incubating twice with 50 l PBS containing 200 M ALFA.sup.ST peptide. Samples corresponding to 1/800 of the input and non-bound material or 1/80 of eluate fractions were resolved by SDS-PAGE. Analysis was performed by Western-blotting using a polyclonal rabbit antiserum raised against the YfgM-PpiD complex (Gtzke, H. et al. YfgM is an ancillary subunit of the SecYEG translocon in Escherichia coli. J Biol Chem 289, 19089-19097 (2014)) followed by an HRP-conjugated goat anti-rabbit IgG (Dianova). Blots were developed using the Western Lightning Plus-ECL Kit (Perkin Elmer) and imaged using a LAS 4000 mini luminescence imager (Fuji Film).
(186) YfgM Pull-Down Using ALFA Selector.sup.ST
(187) A yfgM deletion strain was complemented with either C-terminally ALFA.sup.PE-tagged or untagged YfgM expressed from a pSC-based low-copy vector under control of the endogenous promoter. Membrane protein complexes were solubilized from total lysates prepared in buffer LS (50 mM Tris pH7.5, 300 mM NaCl, 5 mM MgCl.sub.2) using 1% DDM within 1 h on ice (Maddalo, G. et al. Systematic analysis of native membrane protein complexes in Escherichia coli. J Proteome Res 10, 1848-1859 (2011)). Both lysates were incubated with 20 l of ALFA Selector.sup.ST resin for 1 h at 4 C. on a roller drum. After washing in PBS+0.3% DDM, bound proteins were eluted under native conditions by sequentially incubating twice with 50F1 PBS containing 200 M ALFA.sup.ST peptide. Samples corresponding to 1/800 of the input and non-bound material or 1/80 of eluate fractions were resolved by SDS-PAGE. Analysis was performed by Western-blotting using a polyclonal rabbit antiserum raised against the YfgM-PpiD complex (Gtzke, H. et al. YfgM is an ancillary subunit of the SecYEG translocon in Escherichia coli. J Biol Chem 289, 19089-19097 (2014)) followed by an HRP-conjugated goat anti-rabbit IgG (Dianova). Blots were developed using the Western Lightning Plus-ECL Kit (Perkin Elmer) and imaged using a LAS 4000 mini luminescence imager (Fuji Film).
(188) TABLE-US-00009 TABLE 3 Plasmids Transfection Identifier Promoter Encoded protein Origin/Citation pNT1112 pCMV ALFA.sup.ST-FLAG-Vimentin This application pNT1077 pCMV ALFA.sup.PE-FLAG-Vimentin This application pNT1076 pPGK Tom70-EGFP-ALFA.sup.ST This application pNT1178 pPGK Tom70-EGFP-ALFA.sup.PE This application pNT1066 pCMV EGFP-ALFA.sup.ST-myc-TM This application pNT1004 pCMV NbALFA.sup.ST-mScarlet-I This application pEGFP-N1 pCMV EGFP Clontech pNT1137 pCMV EGFP-ALFA.sup.ST This application pNT1135 pCMV ALFA.sup.ST-EGFP This application Bacterial expression Identifier Encoded protein Origin/Citation pNT1208 His.sub.14-bdSUMO-FLAG-HA-MBP-myc- This ALFA.sup.ST application pNT1177 ALFA.sup.ST-shGFP2-His.sub.6 This application pNT1176 ALFA.sup.PE-shGFP2-His.sub.6 This application pNT1050 His.sub.14-bdSUMO-shGFP2-ALFA.sup.ST This application pNT1116 His.sub.14-bdSUMO-shGFP2-ALFA.sup.PE This application pNT1063 His.sub.14-bdSUMO-ALFA.sup.ST-shsfGFP This application pNT1115 His.sub.14-bdSUMO-ALFA.sup.PE-shsfGFP This application pNT1209 pSC YfgM-ALFA.sup.ST This application pNT1123 pSC YfgM-ALFA.sup.PE This application pSC-yfgM pSC YfgM (native promoter in pUA66) .sup.(a) pNT0076 His.sub.14-bdSUMO-TwinStrepTag-bdNEDD8- This ALFA.sub.min application .sup.(a) Gtzke, H. et al. YfgM is an ancillary subunit of the SecYEG translocon in Escherichia coli. J Biol Chem 289, 19089-19097 (2014)
E. coli Strains
(189) E. coli MC4100 yfgM ppiD (Gtzke, H. et al. YfgM is an ancillary subunit of the SecYEG translocon in Escherichia coli. J Biol Chem 289, 19089-19097 (2014))
(190) TABLE-US-00010 TABLE 4 Antibodies Antibody Supplier Order No FluoTag-X2 anti-ALFA NanoTag N1502-Ab635P AbberiorSTAR635P Biotechnologies FluoTag-X2 anti-ALFA NanoTag N1502 IRDye800CW Biotechnologies (Custom) FluoTag-X2 anti-Mouse NanoTag N1202 IRDye680RD Biotechnologies (Custom) anti-FLAG M2 Sigma F1804 anti-myc 9E10 SynapticSystems #343 011 anti-HA F-7 SantaCruz #sc-7392 Goat anti-rabbit IRDye680RD Li-COR #925-68071 Goat anti-mouse IRDye800CW Li-COR #925-32210 anti-Tubulin SynapticSystems #302 211 polyclonal serum recognizing SynapticSystems MBP goat anti-rabbit IgG HRP- Dianova #GAR/IgG(H + conjugate L)/PO anti-YfgM/PpiD .sup.(a) .sup.(a) Gtzke, H. et al. YfgM is an ancillary subunit of the SecYEG translocon in Escherichia coli. J Biol Chem 289, 19089-19097 (2014)
(191) TABLE-US-00011 TABLE5 Fusionproteins Identifier Encodedprotein Sequenceofencodedprotein Transfection pNT1112 ALFA.sup.ST-FLAG- MPSRLEEELRRRLTEPDYKDDDDKGSTRSVSS Vimentin SSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSL (SEQIDNO:180) GSALRPSTSRSLYSSSPGGAYVTRSSAVRLRS SVPGVRLLQDSVDFSLADAINTEFKNTRTNEK VELQELNDRFANYIDKVRFLEQQNKILLAELE QLKGQGKSRLGDLYEEEMRELRRQVDQLTNDK ARVEVERDNLAEDIMRLREKLQEEMLQREEAE STLQSFRQDVDNASLARLDLERKVESLQEEIA FLKKLHDEEIQELQAQIQEQHVQIDVDVSKPD LTAALRDVRQQYESVAAKNLQEAEEWYKSKFA DLSEAANRNNDALRQAKQESNEYRRQVQSLTC EVDALKGTNESLERQMREMEENFALEAANYQD TIGRLQDEIQNMKEEMARHLREYQDLLNVKMA LDIEIATYRKLLEGEESRISLPLPTFSSLNLR ETNLESLPLVDTHSKRTLLIKTVETRDGQVIN ETSQHHDDLE pNT1077 ALFA.sup.PE-FLAG- MSGRLEEELRRRLSPDYKDDDDKGSTRSVSSS Vimentin SYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLG (SEQIDNO:181) SALRPSTSRSLYSSSPGGAYVTRSSAVRLRSS VPGVRLLQDSVDFSLADAINTEFKNTRTNEKV ELQELNDRFANYIDKVRFLEQQNKILLAELEQ LKGQGKSRLGDLYEEEMRELRRQVDQLTNDKA RVEVERDNLAEDIMRLREKLQEEMLQREEAES TLQSFRQDVDNASLARLDLERKVESLQEEIAF LKKLHDEEIQELQAQIQEQHVQIDVDVSKPDL TAALRDVRQQYESVAAKNLQEAEEWYKSKFAD LSEAANRNNDALRQAKQESNEYRRQVQSLTCE VDALKGTNESLERQMREMEENFALEAANYQDT IGRLQDEIQNMKEEMARHLREYQDLLNVKMAL DIEIATYRKLLEGEESRISLPLPTFSSLNLRE TNLESLPLVDTHSKRTLLIKTVETRDGQVINE TSQHHDDLE pNT1067 Tom70-EGFP- MKSFITRNKTAILATVAATGTAIGAYYYYGNS ALFA.sup.ST PVATMVSKGEELFTGVVPILVELDGDVNGHKF (SEQIDNO:182) SVSGEGEGDATYGKLTLKFICTTGKLPVPWPT LVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEG YVQERTIFFKDDGNYKTRAEVKFEGDTLVNRI ELKGIDFKEDGNILGHKLEYNYNSHNVYIMAD KQKNGIKVNFKIRHNIEDGSVQLADHYQQNTP IGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMV LLEFVTAAGITLGMDELYKGSPSRLEEELRRR LTE pNT1178 Tom70-EGFP- MKSFITRNKTAILATVAATGTAIGAYYYYGNS ALFA.sup.PE PVATMVSKGEELFTGVVPILVELDGDVNGHKF (SEQIDNO:183) SVSGEGEGDATYGKLTLKFICTTGKLPVPWPT LVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEG YVQERTIFFKDDGNYKTRAEVKFEGDTLVNRI ELKGIDFKEDGNILGHKLEYNYNSHNVYIMAD KQKNGIKVNFKIRHNIEDGSVQLADHYQQNTP IGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMV LLEFVTAAGITLGMDELYKGSPSRLEEELRRR LTE pNT1066 SS-HA-EGFP- METDTLLLWVLLLWVPGSTGDYPYDVPDYASN ALFA.sup.ST-myc-TM GTSKGEELFTGVVPILVELDGDVNGHKFSVSG (SEQIDNO:184) EGEGDATYGKLTLKFICTTGKLPVPWPTLVTT LTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQE RTIFFKDDGNYKTRAEVKFEGDTLVNRIELKG IDFKEDGNILGHKLEYNYNSHNVYIMADKQKN GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDG PVLLPDNHYLSTQSALSKDPNEKRDHMVLKEF VTAAGITLGMDELYKGSPSRLEEELRRRLTEP GDEQKLISEEDLNAVGQDTQEVIVVPHSLPFK VVVISAILALVVLTIISLIILIMLWQKKPR pNT1004 NbALFA.sup.ST- MGSGDASDSEVQLQESGGGLVQPGGSLRLSCT mScarlet-I ASGVTISALNAMAMGWYRQAPGERRVMVAAVS (SEQIDNO:185) ERGNAMYRESVQGRFTVTRDFTNKMVSLQMDN LKPEDTAVYYCHVLEDRVDSFHDYWGQGTQVT VSSEPKTPKPQTSGSTGENVATMVSKGEAVIK EFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGT QTAKLKVTKGGPLPFSWDILSPQFMYGSRAFI KHPADIPDYYKQSFPEGFKWERVMNFEDGGAV TVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQ KKTMGWEASTERLYPEDGVLKGDIKMALRLKD GGRYLADFKTTYKAKKPVQMPGAYNVDRKLDI TSHNEDYTVVEQYERSEGRHSTGGMDELYK pEGFP-N1 EGFP MVSKGEELFTGVVPILVELDGDVNGHKFSVSG (SEQIDNO:186) EGEGDATYGKLTLKFICTTGKLPVPWPTLVTT LTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQE RTIFFKDDGNYKTRAEVKFEGDTLVNRIELKG IDFKEDGNILGHKLEYNYNSHNVYIMADKQKN GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDG PVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF VTAAGITLGMDELYK pNT1137 EGFP-ALFA.sup.ST MVSKGEELFTGVVPILVELDGDVNGHKFSVSG (SEQIDNO:187) EGEGDATYGKLTLKFICTTGKLPVPWPTLVTT LTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQE RTIFFKDDGNYKTRAEVKFEGDTLVNRIELKG IDFKEDGNILGHKLEYNYNSHNVYIMADKQKN GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDG PVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF VTAAGITLGMDELYKGSPSRLEEELRRRLTE pNT1135 ALFA.sup.ST-EGFP MPSRLEEELRRRLTEPMVSKGEELFTGVVPIL (SEQIDNO:188) VELDGDVNGHKFSVSGEGEGDATYGKLTLKFI CTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMK QHDFFKSAMPEGYVQERTIFFKDDGNYKTRAE VKFEGDTLVNRIELKGIDFKEDGNILGHKLEY NYNSHNVYIMADKQKNGIKVNFKIRHNIEDGS VQLADHYQQNTPIGDGPVLLPDNHYLSTQSAL SKDPNEKRDHMVLLEFVTAAGITLGMDELYK Bacterialexpression pNT1208 His.sub.14-bdSUMO- MSKHHHHSNHHRHNHHHHSGNHHHSGSAAGGE FLAG-HA-MBP- EDKKPAGGEGGGAHINLKVKGQDGNEVFFRIK myc-ALFA.sup.ST RSTQLKKLMNAYCDRQSVDMTAIAFLFDGRRL (SEQIDNO:189) RAEQTPDELEMEDGDEIDAMLHQTGGASDYKD DDDKGSTGDYPYDVPDYASNGTKTEEGKLVIW INGDKGYNGLAEVGKKFEKDTGIKVTVEHPDK LEEKFPQVAATGDGPDHFWAHDRFGGYAQSGL LAEITPDKAFQDKLYPFTWDAVRYNGKLIAYP IAVEALSLIYNKDLLPNPPKTWEEIPALDKEL KAKGKSALMFNLQEPYFTWPLIAADGGYAFKY ENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKH MNADTDYSIAEAAFNKGETAMTINGPWAWSNI DTSKVNYGVTVLPTFKGQPSKPFVGVLSAGIN AASPNKELAKEFLENYLLTDEGLEAVNKDKPL GAVALKSYEEELAKDPRIAATMENAQKGEIMP NIPQMSAFWYAVRTAVINAASGRQTVDEALKD AQTNGSVSAGDEQKLISEEDLNAVGQDTASTP SRLEEELRRRLTE pNT1177 ALFA.sup.ST-shGFP2- MPSRLEEELRRRLTEPSKGEELFTGTVPIKVE His.sub.6 LDGDVNGHKFSVRGEGEGDATEGKLTLKFICT (SEQIDNO:190) TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRH DFFKSAMPEGYVQERTIEFKDDGTYKTRAEVK FEGDTLVNRIELKGNDFKEDGNILGHKLEYNH NSHNVRIEADKQKNGIKANFKIRHNVEDGSQQ EADHKQQNTPIGDGPVRLPDNHYLSTQTTLSK DPNEKRDHMVLKEFVTAAGITKGEDERDKHHH HHH pNT1176 ALFA.sup.PE-shGFP2- MSGRLEEELRRRLSPSKGEELFTGTVPIKVEL His.sub.6 DGDVNGHKFSVRGEGEGDATEGKLTLKFICTT (SEQIDNO:191) GKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHD FFKSAMPEGYVQERTIEFKDDGTYKTRAEVKF EGDTLVNRIELKGNDFKEDGNILGHKLEYNHN SHNVRIEADKQKNGIKANFKIRHNVEDGSQQE ADHKQQNTPIGDGPVRLPDNHYLSTQTTLSKD PNEKRDHMVLKEFVTAAGITKGEDERDKHHHH HH pNT1050 His.sub.14-bdSUMO- MSKHHHHSNHHRHNHHHHSGNHHHSGSAAGGE shGFP2-ALFA.sup.ST EDKKPAGGEGGGAHINLKVKGQDGNEVFFRIK (SEQIDNO:192) RSTQLKKLMNAYCDRQSVDMTAIAFLFDGRRL RAEQTPDELEMEDGDEIDAMLHQTGGGSKGEE LFTGTVPIKVELDGDVNGHKFSVRGEGEGDAT EGKLTLKFICTTGKLPVPWPTLVTTLTYGVQC FSRYPDHMKRHDFFKSAMPEGYVQERTIEFKD DGTYKTRAEVKFEGDTLVNRIELKGNDFKEDG NILGHKLEYNHNSHNVRIEADKQKNGIKANFK IRHNVEDGSQQEADHKQQNTPIGDGPVRLPDN HYLSTQTTLSKDPNEKRDHMVLKEFVTAAGIT KGEDERDKGSGNSDGPSRLEEELRRRLTE pNT1116 His.sub.14-bdSUMO- MSKHHHHSNHHRHNHHHHSGNHHHSGSAAGGE shGFP2-ALFA.sup.PE EDKKPAGGEGGGAHINLKVKGQDGNEVFFRIK (SEQIDNO:193) RSTQLKKLMNAYCDRQSVDMTAIAFLFDGRRL RAEQTPDELEMEDGDEIDAMLHQTGGGSKGEE LFTGTVPIKVELDGDVNGHKFSVRGEGEGDAT EGKLTLKFICTTGKLPVPWPTLVTTLTYGVQC FSRYPDHMKRHDFFKSAMPEGYVQERTIEFKD DGTYKTRAEVKFEGDTLVNRIELKGNDFKEDG NILGHKLEYNHNSHNVRIEADKQKNGIKANFK IRHNVEDGSQQEADHKQQNTPIGDGPVRLPDN HYLSTQTTLSKDPNEKRDHMVLKEFVTAAGIT KGEDERDKGSGNSDGMSGRLEEELRRRLSP pNT1063 His.sub.14-bdSUMO- MSKHHHHSNHHRHNHHHHSGNHHHSGSAAGGE ALFA.sup.ST-shsfGFP EDKKPAGGEGGGAHINLKVKGQDGNEVFFRIK (SEQIDNO:194) RSTQLKKLMNAYCDRQSVDMTAIAFLFDGRRL RAEQTPDELEMEDGDEIDAMLHQTGGSGDASD SPSRLEEELRRRLTEPSKGEELFTGTVPIKVE LDGDVNGHKFSVRGEGEGDATEGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRH DFFKSAMPEGYVQERTIEFKDDGTYKTRAEVK FEGDTLVNRIELKGNDFKEDGNILGHKLEYNH NSHNVRIEADKQKNGIKANFKIRHNVEDGSQQ EADHKQQNTPIGDGPVRLPDNHYLSTQTTLSK DPNEKRDHMVLKEFVTAAGITKGEDERDKA pNT1115 His.sub.14-bdSUMO- MSKHHHHSNHHRHNHHHHSGNHHHSGSAAGGE ALFA.sup.PE-shsfGFP EDKKPAGGEGGGAHINLKVKGQDGNEVFFRIK (SEQIDNO:195) RSTQLKKLMNAYCDRQSVDMTAIAFLFDGRRL RAEQTPDELEMEDGDEIDAMLHQTGGSGDASD SMSGRLEEELRRRLSPSKGEELFTGTVPIKVE LDGDVNGHKFSVRGEGEGDATEGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRH DFFKSAMPEGYVQERTIEFKDDGTYKTRAEVK FEGDTLVNRIELKGNDFKEDGNILGHKLEYNH NSHNVRIEADKQKNGIKANFKIRHNVEDGSQQ EADHKQQNTPIGDGPVRLPDNHYLSTQTTLSK DPNEKRDHMVLKEFVTAAGITKGEDERDKA pNT1209 YfgM-ALFA.sup.ST MEIYENENDQVEAVKRFFAENGKALAVGVILG (SEQIDNO:196) VGALIGWRYWNSHQVDSARSASLAYQNAVTAV SEGKPDSIPAAEKFAAENKNTYGALASLELAQ QFVDKNELEKAAAQLQQGLADTSDENLKAVIN LRLARVQVQLKQADAALKTLDTIKGEGWAAIV ADLRGEALLSKGDKQGARSAWEAGVKSDVTPA LSEMMQMKINNLSIGSPSRLEEELRRRLTE pNT1123 YfgM-ALFA.sup.PE MEIYENENDQVEAVKRFFAENGKALAVGVILG (SEQIDNO:197) VGALIGWRYWNSHQVDSARSASLAYQNAVTAV SEGKPDSIPAAEKFAAENKNTYGALASLELAQ QFVDKNELEKAAAQLQQGLADTSDENLKAVIN LRLARVQVQLKQADAALKTLDTIKGEGWAAIV ADLRGEALLSKGDKQGARSAWEAGVKSDVTPA LSEMMQMKINNLSIGSMSGRLEEELRRRLS pSC-yfgM YfgM MEIYENENDQVEAVKRFFAENGKALAVGVILG (SEQIDNO:198) VGALIGWRYWNSHQVDSARSASLAYQNAVTAV SEGKPDSIPAAEKFAAENKNTYGALASLELAQ QFVDKNELEKAAAQLQQGLADTSDENLKAVIN LRLARVQVQLKQADAALKTLDTIKGEGWAAIV ADLRGEALLSKGDKQGARSAWEAGVKSDVTPA LSEMMQMKINNLSI pNT0076 His.sub.14-bdSUMO- MSKHHHHSNHHRHNHHHHSGNHHHSGSAAGGE TwinStrepTag- EDKKPAGGEGGGAHINLKVKGQDGNEVFFRIK bdNEDD8-ALFA.sub.min RSTQLKKLMNAYCDRQSVDMTAIAFLFDGRRL (SEQIDNO:199) RAEQTPDELEMEDGDEIDAMLHQTGGACAWSH PQFEKGGGSGGSSGGSAWSHPQFEKGSGSAES EAASSTMIKVKTLTGKEIEIDIEPTDTIDRIK ERVEEKEGIPPVQQRLIYAGKQLADDKTAKDY NIEGGSVLHLVLALRGGATGTASTRLEEELRR RLAS
Protein Expression and Purification
(192) All recombinant proteins were expressed under the control of the Tac-promoter from expression vectors with ColE1 origin that confer resistance to Kanamycin.
(193) The MBP fusion protein harboring multiple epitope tags, ALFA.sup.ST-shGFP2, ALFA.sup.PE-shGFP2 and TwinStrepTag-bdNEDD8-ALFA.sub.min were expressed as N-terminal His.sub.14-bdSUMO fusions. For protein expression, E. coli was cultured in Terrific broth (TB) supplemented with 0.3 mM IPTG for 14-16 h at 23 C. After harvest, E. coli cells were lysed in LS buffer (50 mM Tris/HCl pH 7.5, 300 mM NaCl) supplemented with 15 mM imidazole/HCl pH 7.5 and 10 mM DTT, and purified by binding to Ni(II)-chelate beads. After extensive washing, proteins were eluted by on-column-cleavage with bdSENP1 as described before (Frey, S. & Grlich, D. A new set of highly efficient, tag-cleaving proteases for purifying recombinant proteins. J Chromatogr A 1337, 95-105 (2014); Frey, S. & Grlich, D. Purification of protein complexes of defined subunit stoichiometry using a set of orthogonal, tag-cleaving proteases. J Chromatogr A 1337, 106-115 (2014)).
(194) ALFA.sup.ST-shGFP2-His.sub.6, ALFA.sup.PE-shGFP2-His.sub.6, His.sub.14-bdSUMO-ALFA.sup.ST-shsfGFP and His.sub.14-bdSUMO-ALFA.sup.PE-shsfGFP were expressed and purified in a similar fashion; Elution was, however, performed using 250 mM Imidazole in buffer LS.
(195) For affinity determinations and binding studies from complex lysates, substrate proteins were in addition purified via size exclusion chromatography on a Superdex200 10/30 column (GE Healthcare).
(196) Selection of Specific sdAb Clones by Affinity Purification of B-Cells Celline
(197) 1 mL of T-Catch resin (IBA Lifesciences) was washed with B cell isolation buffer (PBS pH7.4, 1% BSA, 1 mM EDTA) and incubated with saturating amounts of a TwinStrepTag-bdNEDD8-ALFA.sub.min fusion protein for 30 min rolling at RT. The resins were cleared form excess bait protein by extensively washing with B cell isolation buffer. 100 mL of blood sample was taken from alpaca immunized with ALFA peptide fusions and immediately incubated with 5000 IU/mL heparin (Sigma) to prevent clotting. From the fresh blood (less than 4 h past sampling) PBMCs were isolated using Ficoll-Paque PLUS (GE Healthcare). To remove residual serum, PBMCs were washed three times consecutively with B cell isolation buffer. PBMCs were passed over the loaded T-Catch resin for three times before washing the resins with 10 column volumes B cell isolation buffer. Bound B cells were eluted from the resins by incubating 2 M NEDP1 (Frey, S. & Grlich, D. A new set of highly efficient, tag-cleaving proteases for purifying recombinant proteins. J Chromatogr A 1337, 95-105 (2014); Frey, S. & Grlich, D. Purification of protein complexes of defined subunit stoichiometry using a set of orthogonal, tag-cleaving proteases. J Chromatogr A 1337, 106-115 (2014)) for 30 min at RT. From the eluted B cells an sdAb-specific cDNA library was amplified by a multistep nested RT-PCR and cloned into a bacterial expression vector. 96 single clones were tested by ELISA for expression of ALFA-reactive sdAbs.
(198) Preparation of Human PBMCs
(199) Human peripheral blood mononuclear cells (PBMCs) were obtained from fresh blood using standard density gradient centrifugation. Briefly, 60 mL of fresh blood were diluted with 40 mL of phosphate-buffered saline (PBS) supplemented with 1 mM EDTA and placed on top of a layer of CELLPURE Roti-Sep 1077 (Carl Roth) in 50 mL LEUCOSEP tubes (Greiner Bio-One) and centrifuged at 800g for 20 minutes at room temperature. Subsequently, the PBMC-containing layer was collected and washed five times in cold PBS+EDTA to remove platelets.
(200) Isolation of CD62L-Positive Lymphocytes
(201) Approximately 210.sup.7 PBMCs were passed by gravity flow through an ALFA Selector.sup.PE resin loaded with an ALFA-tagged anti-human CD62L nanobody, followed by extensive washing with PBS supplemented with 1 mM EDTA 1 and 1% (w/v) bovine serum albumin. Subsequently, bound cells were eluted in the same buffer containing 200 M ALFA peptide.
(202) The invention illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by exemplary embodiments and optional features, modification and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.
(203) The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
(204) Other embodiments are within the following claims. In addition, where features or aspects of the invention are described in terms of Markush groups, those skilled in the art will recognize that the invention is also thereby described in terms of any individual member or subgroup of members of the Markush group.