Collagen type X alpha-1 assay

12366582 ยท 2025-07-22

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided herein is an antibody specifically reactive with an N-terminus neo-epitope of collagen type X alpha 1 in the amino acid sequence H.sub.2N-GIATKGLNGP, and its use in an immunoassay for evaluating a disease associated with collagen type X alpha 1, such as osteoarthritis.

Claims

1. An antibody, wherein said antibody specifically reacts with an N-terminus neo-epitope of collagen type X alpha 1 comprised in the amino acid sequence H.sub.2N-GIATKGLNGP (SEQ ID NO: 1); wherein the antibody comprises complementarity-determining regions (CDRs): CDR-L1: RSSQSLVHNNGNTYLH (SEQ ID NO: 13), CDR-L2: KVSNRFS (SEQ ID NO: 14), CDR-L3: SQITHVPWT (SEQ ID NO: 15), CDR-H1: SGFWS (SEQ ID NO: 16), CDR-H2: YIKYSGDTYFNPSLKS (SEQ ID NO: 17), and CDR-H3: MDY (SEQ ID NO: 24).

2. The antibody of claim 1, wherein said antibody specifically binds to the N-terminus amino acid sequence H.sub.2N-GIATKG (SEQ ID NO: 2).

3. The antibody of claim 1, wherein the antibody does not specifically recognise or bind an N-extended elongated version of said N-terminus amino acid sequence or an N-truncated shortened version of said N-terminus amino acid sequence.

4. The antibody of claim 1, wherein said antibody is a monoclonal antibody or fragment thereof.

5. A cell line producing the monoclonal antibody of claim 4.

6. A method of immunoassay for detecting in a biological sample fragments of collagen type X alpha 1 comprising an N-terminus neo-epitope amino acid sequence H.sub.2N-GIATKGLNGP (SEQ ID NO: 1), said method comprising contacting said biological sample comprising said N-terminus neo-epitope amino acid sequence H.sub.2N-GIATKGLNGP (SEQ ID NO: 1) with the antibody of claim 1, and determining the amount of binding of said antibody.

7. The method of immunoassay of claim 6, wherein the detection is quantitative.

8. The method of immunoassay of claim 6, wherein said method is used to detect and/or quantify the amount of fragments of collagen type X alpha 1 comprising the N-terminus neo-epitope amino acid sequence H.sub.2N-GIATKGLNGP (SEQ ID NO: 1) in a biofluid.

9. The method of immunoassay of claim 8, wherein said biofluid is a patient derived biofluid.

10. The method of immunoassay of claim 8, wherein said biofluid is blood, urine, synovial fluid, serum, or plasma.

11. The method of immunoassay of claim 6, wherein said method is a competition assay or a sandwich assay.

12. The method of immunoassay of claim 6, wherein said method is a radioimmunoassay or an enzyme-linked immunosorbent assay.

13. An assay kit for determining the quantity of fragments of collagen type X alpha 1 comprising the N-terminus neo-epitope amino acid sequence H.sub.2N-GIATKGLNGP (SEQ ID NO: 1) in a biological sample, said kit comprising the antibody of claim 1 and at least one of: a streptavidin coated 96 well plate, a biotinylated peptide H.sub.2N-GIATKGLNGP-L-Biotin (SEQ ID NO: 5), wherein L is an optional linker, a secondary antibody for use in a sandwich immunoassay, a calibrator peptide comprising the sequence H.sub.2N-GIATKGLNGP (SEQ ID NO: 1), an antibody biotinylation kit, an antibody HRP labeling kit, an antibody radiolabeling kit; or an assay visualization kit.

Description

DESCRIPTION OF THE FIGURES

(1) FIG. 1 shows the peptide-binding specificity of mAb. The reactivity of 2F4 toward a biotinylated synthetic peptide, GIATKGLNGP-k(Biotin) (SEQ ID NO: 5), was completely displaced by adding of 1000 ng/mL selection peptide. In contrast, a slight or no displacement was observed with elongation of selection peptide or truncation of selection peptide at the same concentration.

(2) FIGS. 2A-2C show the in vitro cleavage of cartilage by enzymes. FIG. 2A: MMPs cleaved human cartilage. FIG. 2B: ADAMTSs cleaved human cartilage. FIG. 2C: Cathepsin K cleaved human cartilage. Data shown as meanSD. There was no increased level of Col10/C in none of the tested MMPs or ADAMTSs solution compared to the one without adding proteases in the digestion buffer. Conversely, Cathepsin K yielded the largest amount indicating its ability of releasing the fragment carrying the neo-epitope of 479GIATKGLNGP.

(3) FIGS. 3A-3C show the immunolocalization of 479GIATKG in cartilage. FIG. 3A: normal mouse IgG. FIG. 3B: 11G8, anti-C terminus of type X collagen. FIG. 3C: 2F4, anti-479GIATKG. Type X collagen detected by 11G8 occurred in the extracellular matrix of chondrocytes in the deep zone, but it was absent from the region of calcified cartilage. Surprisingly, in FIG. 3C the intense staining of 479GIATKG was seen in the extracellular matrix of chondrocytes from all zones in cartilage. Scale bar=500 M.

(4) FIGS. 4A-4B show the association between KL grade and Col10neo level in the plasma of subjects in the C4Pain study. The data were shown as mean95Cl %. FIG. 4A: Plasma Col10neo levels in different K/L groups. There was a trend toward increased Col10neo levels with a greater K/L grade, but not reaching statistical significance. FIG. 4B: The distribution of subjects with a K/L 3-4 in plasma Col10neo level by tertile. The one-way ANOVA with post-hoc Tukey-Kramer test was used. Plasma Col10neo data were logarithmic transformed in all analyses. P value<0.05 was considered statistically significant.

(5) FIG. 5 shows the plasma Col10neo levels in the NYUHJD Progression study. The data were shown as mean95Cl %. Plasma Col10neo was statistically higher in OA than healthy control (p=0.0002) or RA (p<0.0001). No significant difference in healthy control and RA was found. The one-way ANOVA with post-hoc Tukey-Kramer test was used. Plasma Col10/Cat data were logarithmic transformed in all analyses. P value<0.05 was considered statistically significant. One asterisk (*) if p<0.05; two (**) if p<0.01; three (***) if p<0.001 and four (****) if p<0.0001.

DESCRIPTION OF THE INVENTION

Definitions

(6) As used herein, the term N-terminus refers to the extremity of a polypeptide, i.e. at the N-terminal end of the polypeptide, and is not to be construed as meaning in the general direction thereof.

(7) As used herein the term N-terminus neo-epitope refers to an N-terminus epitope formed by cleavage of a protein by a protease. For the instant invention this means an N-terminus epitope formed by cleavage of Collagen type X alpha-1 by cathepsin K.

(8) As used herein, the term fragments of collagen type X alpha 1 comprising an N-terminus neo-epitope amino acid sequence H.sub.2N-GIATKGLNGP (SEQ ID NO: 1) means peptide fragments of collagen type X alpha 1 wherein the N-terminus of the peptide fragment is the amino acid sequence H.sub.2N-GIATKGLNGP . . . (SEQ ID NO: 1).

(9) As used herein, the term, the term competitive ELISA refers to a competitive enzyme-linked immunosorbent assay and is a technique known to the person skilled in the art.

(10) As used herein, the term sandwich immunoassay refers to the use of at least two antibodies for the detection of an antigen in a sample, and is a technique known to the person skilled in the art.

(11) As used herein, the term Col10neo is used as shorthand to describe the herein disclosed specific assay for detecting and quantifying fragments of collagen type X alpha-1 comprising the N-terminus neo-epitope amino acid sequence H.sub.2N-GIATKGLNGP (SEQ ID NO: 1).

EXAMPLES

(12) The presently disclosed embodiments is described in the following Examples, which are set forth to aid in the understanding of the disclosure, and should not be construed to limit in any way the scope of the disclosure as defined in the claims which follow thereafter. The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the described embodiments, and are not intended to limit the scope of the present disclosure nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g. amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.

(13) In the following examples, the following materials and methods were employed.

Materials

(14) Unless otherwise stated, all materials used for experiments were of high quality and ordered from Sigma-Aldrich (Copenhagen, Denmark) or VWR (Rodedovre, Denmark). The synthetic peptides used for monoclonal antibody production and assay development were purchased from GenScript (USA). MMP-2 catalytic domain (cat #G14MP02C), MMP-9 catalytic domain (cat #G04MP09C) and MMP-13 catalytic domain (cat #G04MP13C) were bought from Gitto Biotech (Florence, Italy). Cathepsin K (cat #219461), Cathepsin B (cat #219362) and Cathepsin S (cat #219343) and ADAMTS-4 (cat #CC1028) were from Merck Millipore (Darmstadt, Germany). ADAMTS-5 (cat #2198-AD-20) was purchased from R&D system (Minnesota, USA).

(15) Selection of the Sequence for Immunization

(16) The analysis for naturally occurring peptides in human urine from OA patients was carried out by LC-MS/MS. A significant amount of peptide fragments were identified in human OA urine. 17 peptide sequences were found to be unique to human type X collagen. Two among 17 sequences carrying the same free c-terminus located at amino acid (aa) position 478 (Accession No.: Q03692; Database: UniProt) were present in the diseased urine, indicating the cleavage occurring between the bond of A.sup.478_479G. The first 10 aa, .sup.479GIATKGLNGP.sup.488 (SEQ ID NO: 1), of the free N-terminal end generated by this cleavage was selected for immunization. The sequence alignment from different species was also analyzed using the Basic Local Alignment Search Tool (BLAST, see Table 1).

(17) Monoclonal Antibody (mAb) Production

(18) Six female Balb/C mice of 6-7 weeks of age were immunized subcutaneously with emulsified GIATKGLNGP-GGC-KLH (SEQ ID NO: 6) with Sigma Adjuvant System (cat #56322, Sigma-Aldrich). 100 g of emulsified KLH-conjugate with adjuvant was repeatedly injected into mouse every 3.sup.rd week until stable titer levels were obtained. At each bleeding, the serum antibody titer was measured against the biotinylated peptide, GIATKGLNGP-k(Biotin) (SEQ ID NO: 5) coated on streptavidin coated microplates (Roche Diagnostics, Germany). The mice with the highest antibody titer and best reactivity towards the selection peptide, GIATKGLNGP (SEQ ID NO: 1), was chosen for fusion (data not shown). The mouse selected was boosted intraperitoneally (i.p.) with 100 g KLH-conjugate in 100 L 0.9% sodium chloride solution three days before sacrificed for fusion. The fusion and antibody screening process was performed using standard techniques. Briefly, the spleen was surgically removed for isolation of splenocytes which was fused with murine myeloma cells, SP2/0-Ag14 (ATCCCRL-1581). Hybridoma cells were selected by using HAT (hypoxanthine Aminopterin Thymidine) medium. Supernatants were screened by an indirect ELISA, where the biotinylated peptide, GIATKGLNGP-k(Biotin) (SEQ ID NO: 5) was coated on streptavidin-precoated microplates. Standard limiting dilution process was carried out to select single cells. The isotype of antibody in supernatant was tested using the isotype determination kit, SBA Clonotyping System-HRP (5300-05, Southern Biotech). Single-cell derived hybridoma were transferred to 24-well plate to allow them for further growth, and eventually scale up from T25 to T175 flasks. The supernatants were collected and filtered with 0.2 m filter before applying to a 1 mL HiTrap Protein G HP column (cat #17-0404-01, GE healthcare) for antibody purification.

(19) The antibody generated was sequenced and the CDRs determined.

(20) The sequence of the chains are as follows (CDRs in bold; Framework sequence in Italics; Constant region underlined):

(21) TABLE-US-00008 Lightchain:Aminoacidsequence(238aa) (mouseKappaisotype): (SEQID.NO:22) DVVMTQTPRSLPVSLGDQASISCRSSQSLVHNNGNTYLHWYLQMPGQSP KLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQITH VPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPK DINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNS YTCEATHKTSTSPIVKSFNRNEC, CDR-L1: (SEQID.NO:13) RSSQSLVHNNGNTYLH, CDR-L2: (SEQID.NO:14) KVSNRFS, and CDR-L3: (SEQID.NO:15) SQITHVPWT. Heavychain:Aminoacidsequence(464aa) (MouseIgHisotype) (SEQID.NO:23) EVQLQESGPSLVKPSQTLSLTCSVTGDSITSGFWSWIRKFPGNKLEFMG YIKYSGDTYFNPSLKSRISITRDTSKNQYYLQLNSVTPEDTATYYCSDM DYWGQGTSVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPES VTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVA HPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPP NIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHRE DYNSTIRVVSTLPIQHQDVVMSGKEFKCKVNNKDLPSPIERTISKIKGL VRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEVVTSNGHTEEN YKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKK TISRSPGK, CDR-H1: (SEQID.NO:16) SGFWS, CDR-H2: (SEQID.NO:17) YIKYSGDTYFNPSLKS, and CDR-H3: (SEQID.NO:24) MDY.
.sup.479GIATKG Specific Immuno-Assay (Col10neo)

(22) A purified monoclonal antibody was first tested for peptide-binding specificity by three synthetic peptides, selection peptide (GIATKGLNGP; SEQ ID NO: 1), elongation of the selection peptide (AGIATKGLNGP; SEQ ID NO: 3) and truncation of the selection peptide (IATKGLNGP; SEQ ID NO: 4), and then used in a competitive immunoassay. After optimization with buffer, temperature, incubation time and concentrations for key reagents, the final protocol for detection of .sup.479GIATKG (SEQ ID NO: 2) assay was developed as follows: a 96-well streptavidin pre-coated micro plate was coated with 1 ng/ml biotinylated peptide, GIATKGLNGP-k(Biotin) (SEQ ID NO: 5) dissolved in 50 mM PBS-BTB buffer (phosphate-buffered saline with bovine serum albumin and Tween-20, pH7.4) for 30 min at 20 C. Then, the plate was washed 5 times by standard wash buffer (20 mM Tris, 50 mM NaCl, pH 7.2). 20 L of the peptide standards, kit controls or samples were added to appropriate wells, followed by 100 L of 23 ng/ml monoclonal antibody in 50 mM PBS-BTB buffer containing 5% Osteocalcin EIA Puf-Liq (Roche diagnostics, Germany), and incubated overnight (201 hr) at 4 C. After 5 times wash, 100 L of goat anti-mouse secondary antibody (115-035-003, Jackson ImmunoResearch) was added and incubated for 1 hr at 20 C. After this step, the plate was washed for 5 times with wash buffer. Finally, 100 L 3,3,5,5-tetramethylbenzidine (TMB) was added to each well and incubated for 15 min at 20 C. in the dark. The colorimetric reaction was stopped by adding 100 L stopping solution (1% H.sub.2SO.sub.4) and measured at 450 nm with 650 nm as the reference.

(23) The inter- and intra-plate variation were determined by 10 independent runs of quality control panel (three human sera and two peptide standard) in duplicate. The lower limit of detection (LLOD) was calculated as 3SD of the mean value of 21 zero standard. Multiple human serum or plasma samples were assayed neat, 2, 4, 6, 8, 16-fold in incubation buffer. Percent recovery was calculated as the measured concentration divided by the expected concentration corrected for dilution.

(24) In Vitro Cleavage of Human Cartilage

(25) Articular cartilage biopsies from osteoarthritis (OA) patients who underwent knee replacement surgery were obtained from Gentofte Hospital (Gentofte, Denmark). The retrieval of the specimens complied with international ethical guidelines for handling human samples and patient information. All participants signed an informed consent and the study was approved by Danish authority. To identify the enzymes responsible for the cleavage of the A.sup.478_479G bond, cartilage was cleaved by numerous proteases including matrix metalloproteases (MMP2, MMP9 and MMP13), Cathepsins (CatK, CatB and CatS), and A disintegrin and metalloprotease domains with thrombospondins motifs (ADAMTS-4 and ADAMTS-5). 30 mg of snap-frozen and crushed cartilage with 1 g each enzyme were placed in a 0.5 ml Eppendorf with 250 L digestion buffer (digestion buffer for MMPs: 100 mM Tris, 100 mM NaCl, 10 mM CaCl.sub.2 and 2 mM zinc acetate, pH 8.0; digestion buffer for ADAMTSs: 50 mM Tris, 100 mM NaCl and 10 mM CaCL.sub.2, pH 7.5; digestion buffer for Cathepsins: 25 mM NA.sub.2HPO.sub.4, 150 mM NaCl, 2 mM EDTA, 2 mM DTT, pH 6.5). The digestion was carried out on one day in 2 replicates. 5 mM EDTA (broad-spectrum inhibitor for MMPs and ADAMTSs) and 5 mM E64 (broad-spectrum inhibitor for Cathepsins) were added to stop the reaction. All supernatants were stored at 80 C. prior to use.

(26) Immunohistochemistry (IHC)

(27) Cartilage with bone specimens for IHC were from the study in collaboration with Frederikshavn Hospital (Denmark) approved by Danish authority (N-20110031). All participants signed an informed consent. The specimens isolated from OA patients who underwent knee replacement surgery were fixed and decalcified, and then embedded in paraffin. 5 m-thick cartilage sections were melt at 60 C. for 1 hr and deparrifined and hydrated, followed by antigen retrieval using Pronase E (cat #10165921001, Roche) at 37 C. for 10 min. The sections were treated by 0.5% casein in Tris Buffered Saline (TBS) for 30 min at room temperature to block unspecific binding. Immunostaining was performed by antibody NB117-2F4 developed in this study and previously developed antibody NB509-11G8. Immunoreactivity was visualized with peroxidase labeled anti-Mouse and diaminobenzidine (DAB, Dako, Denmark). Counterstaining was with Mayer's hematoxylin. The pictures were taken using an Olympus microscope BX60 equipped with an Olympus C5050 digital camera.

(28) Study Participants

(29) Plasma samples were retrieved from two studies, the C4Pain study approved by local ethics committee (N-20100094) (24) and the NYUHJD Progression study approved by local ethics committee (25-26). All participants provided informed consent prior to enrollment.

(30) Briefly, the C4Pain is a cross-sectional study. It comprised 281 individuals with no joint degeneration to severe joint degeneration using the Kellgren/Lawrance (K/L) grading scale (K/L 0-4). The plasma samples from 253 enrollees were measured in the present study due to insufficient volume of other 28 samples.

(31) The NYUHJD Progression study comprised 21 non-OA healthy controls (K/L1 and no pain in either knee), 146 OA patients (K/L 2) and 36 rheumatoid arthritis (RA) patients at baseline. 146 OA patients were further followed up for 24 months. The radiographic assessments were taken at baseline and 24 months and plasma were collected at baseline. Plasma samples from 20 non-OA healthy controls, 142 OA subjects and 34 RA subjects at baseline were available for measurement in the present study. However in the present study, we only investigated the level of Col10neo in different groups at baseline. Future studies will continue to move toward a more complete picture of Col10neo as a potential prognostic biomarker of radiographic progression in OA.

(32) Statistics

(33) Data were analyzed using GraphPad Prism 6 or MedCalc 16.8. For normality check, a Shaprio-Wilk test for all variables of interest was performed. Between group comparison for age, BMI and VAS score, the one-way ANOVA with post-hoc Tukey-Kramer test was used. Plasma Col10neo data were logarithmic transformed in all analyses. P value<0.05 was considered statistically significant. One asterisk (*) if p<0.05; two (**) if p<0.01; three (***) if p<0.001 and four (****) if p<0.0001.

Results

(34) Peptide Selection

(35) Sequence Alignment of the Selected Peptide Across Species

(36) 2 fragments sharing the same free C-terminal end, .sup.463PGSKGDPGSPGPPGPA.sup.478 (SEQ ID NO: 7) and .sup.465SKGDPGSPGPPGPA.sup.478 (SEQ ID NO: 8) were identified by mass spectrometry in urine of OA patients, indicating the presence of a cleavage site existing between A.sup.478_479G. A 10aa peptide from the free N-terminus generated by the cleavage, .sup.479GIATKGLNGP (SEQ ID NO: 1), was chosen for immunization. The blast shows that among human proteins the sequence is unique to type X collagen alpha-1. Sequence similarity across species shows 100% identity between human and mouse, while a mismatched aa is contained in rat or bovine compared to human sequence.

(37) TABLE-US-00009 TABLE1 Thesequencealignmentofthechosenpeptideacrossspecies Species Sequence Genename Acession DataBase Homosapiens.sup.1 GIATKGLNGP COL10A1 Q03692 UniProt Rattusnorvegicus.sup.2 GIVTKGLNGP COL10A1 A0A0G2K7A5 UniProt MusMusculus.sup.3 GIATKGLNGP COL10A1 Q05306 UniProt Bostaurus.sup.4 GIAVKGLNGP COL10A1 P23206 UniProt Canislupus GVATKGLNGP COL10A1 Q2HNR1 UniProt familiaris.sup.5 .sup.1Human (SEQ ID NO: 1); .sup.2Rat (SEQ ID NO: 9); .sup.3Mouse (SEQ ID NO: 10); .sup.4Bovine (SEQ ID NO: 11); .sup.5Dog (SEQ ID NO: 12)
Technical Performance of the Col10neo Assay

(38) The monoclonal antibody 2F4 (isotype: IgG2b, ) targeting .sup.479GIATKG (SEQ ID NO: 2) was produced from hybridoma and purified by HiTrap Protein G affinity column (Cat #17-0404-01, GE Healthcare). In test for peptide-binding specificity, the reactivity of 2F4 toward a biotinylated synthetic peptide, GIATKGLNGP-k(Biotin) (SEQ ID NO: 5), was completely displaced by adding of 1000 ng/mL selection peptide. In contrast, a slight or no displacement was observed with elongation of the selection peptide or truncation of the selection peptide at the same concentration (FIG. 1). This indicated the developed antibody 2F4 was specific for the selection peptide.

(39) The antibody 2F4 showing great specificity was therefore applied in a competitive ELISA assay, Col10neo. The technical performance of this assay is summarized and listed in table 2. The IC50 was 41.9 ng/mL. The intra-assay coefficient variation (CV %) was 3% and the inter-assay CV % was 11.8. The measurement range was 8-250 ng/mL. The linearity was good over a wide range of 4- to 32-fold dilution of serum and 8- to 64-fold dilution of EDTA-anticoagulated plasma.

(40) TABLE-US-00010 TABLE 2 Summary of technical performance of Col10neo assay Assay specifications Col10neo IC50, ng/mL 41.9 Intra-assay, CV % 3 Inter-assay, CV % 11.9 Lower limit of detection, ng/mL 0.127 Measurement range, ng/mL 8-250
Cathepsin K-Derived .sup.479GIATKG

(41) To investigate the responsible enzyme for cleaving A.sup.478_479G bond, several proteases were individually incubated with human cartilage. All proteases were at the same enzyme concentration and all incubations were performed for the same incubation time. The relative efficiency for each protease to generate the neo-epitope of .sup.479GIATKGLNGP (SEQ ID NO: 1) was evaluated by applying to the Col10neo assay. There was no increased level of Col10neo in any of the tested MMPs or ADAMTSs solution compared to the one without adding proteases in the digestion buffer (FIGS. 2A-2B). Conversely, Cathepsin K yielded the largest amount indicating its ability of releasing the fragment carrying the neo-epitope of .sup.479GIATKGLNGP (SEQ ID NO: 1) (FIG. 2C).

(42) Immunolocalization of .sup.479GIATKG in Cartilage

(43) To further define the generation and distribution of .sup.479GIATKG (SEQ ID NO: 2), consecutive sections of articular cartilage from a TKR (total knee replacement) patient were stained with anti-.sup.479GIATKG (SEQ ID NO: 2) (2F4), normal mouse IgG (negative control) and anti-C terminus of type X collagen (11G8disclosed in WO 2014/180992) as well. We did not observe any staining with normal mouse IgG (FIG. 3A). In line with previous studies, it was found that type X collagen detected by 11G8 occurred in the extracellular matrix of chondrocytes in the deep zone, but it was absent from the region of calcified cartilage (FIG. 3B). Surprisingly, the intense staining of .sup.479GIATKG (SEQ ID NO: 2) was seen in the extracellular matrix of chondrocytes from all zones in cartilage (FIG. 3C). The staining of neo-epitope demonstrated that type X collagen released into the extracellular matrix had undergone further proteolytic processing.

(44) Association Between K/L Grade and Plasma Col10neo Levels in the C4Pain Study

(45) The 253 participants from the C4Pain study were categorized into 4 groups based on the K/L grade. The demographic characteristics of these 4 groups are summarized in Table 3.

(46) TABLE-US-00011 TABLE 3 Demographics of subjects in the C4Pain study K/L No. of No. of VAS Age, BMI, grade men women Total grade years kg/m.sup.2 0-1 23 27 50 37 030 61.8 08.5 26.4 03.1 2 79 66 145 42 029 64.6 07.3 28.2 03.8 3 17 19 36 56 021 64.3 07.1 29.3 05.6 4 12 10 22 54 024 67.8 07.7.sup.$ 29.5 03.9 Except where indicated otherwise, values are the mean SD. Vas grade = maximal pain intensity for the last 24 hour, BMI = body mass index. .sup.$P<0.05 compare to K/L0-1 group

(47) As the mean age of the participants was >60 years, the few participants with a K/L 0 or K/L of 1 were classified into the same group. 57% of the subjects involved in this study were with a K/L of 2 and assigned to group 2. There was no significant difference in gender distribution within each group. The mean age of K/L4 was significantly higher than K/L 0-1 group (p<0.005). There was a clear but not significant trend of increased BMI with an increase in K/L grade. The mean value of VAS score, defined as the maximal pain intensity for the last 24 hours, was not significantly different from each group.

(48) The mean95Cl % concentrations of Col10neo for participants in 4 groups from KL 0-4 were 2.6 (2.316-2.884) g/mL, 3.288 (2.885-3.691) g/mL, 3.435 (2.729-4.141) g/mL and 3.517 (2.599-4.435) g/mL, respectively. There was a trend toward increased Col10neo levels with a greater K/L grade, but that did not reach statistical significance (FIG. 4A). The subjects were divided into tertiles based on the Col10neo levels and the distribution of K/L grade was compared (FIG. 4B). The number of subjects with a K/L 3-4 was greatest in those in the highest tertile of Col10neo.

(49) Plasma Col10neo Levels in the NYUHJD Progression Study

(50) The result from the C4Pain study caused us to investigate the potential of using Col10neo as a diagnostic biomarker in the NYUHJD Progression study which consists of non-OA healthy control, OA and RA. The percentage of female participants was higher in OA and RA groups than in the healthy control group. The mean age was significantly different in control and OA groups. However, the subjects were significantly younger in the RA group than in the OA group, since RA can occur at any age but has its peak between ages 30-55. There was a slight difference in BMI between healthy control and OA.

(51) The plasma Col10neo (mean95Cl %) in control, OA and RA was 2.953 (2.711-3.194) g/mL, 4.04 (3.835-4.246) g/mL and 2.548 (2.285-2.81) g/mL, respectively (FIG. 5). Plasma Col10neo was statistically higher in OA than healthy control (p=0.0002) or RA (p<0.0001). No significant difference between the healthy control and RA was found. When the data was adjusted for age and gender, the level of Col10neo remained significantly increased in OA with respect to the control (p=0.003) or RA (p<0.0001) (Table 4).

(52) Surprisingly, when adjusted for age and gender the difference between the control and Col10neo became significant for RA (p=0.0084; Table 4).

(53) TABLE-US-00012 TABLE 5 ANCOVA analysis of plasma Col10neo levels adjusted for age and gender. Mean Std. Factors difference Error P .sup.a 95% CI a OA healthy 0.1156 0.02913 0.0003 0.04527 to control 0.1860 RA 0.2200 0.02425 <0.0001 0.1614 to 0.2786 Healthy OA 0.1156 0.02913 0.0003 0.1860 to control 0.04527 RA 0.1044 0.03446 0.0084 0.1860 to 0.04527 a Bonferroni corrected

Concluding Remarks

(54) It has been demonstrated that the herein disclosed col10neo assay is useful in the evaluation of OA. It is herein proposed that this usefulness may extend to evaluating other diseases associated with collagen type X alpha-1, such as ankylosing spondylitis.

(55) In this specification, unless expressly otherwise indicated, the word or is used in the sense of an operator that returns a true value when either or both of the stated conditions is met, as opposed to the operator exclusive or which requires that only one of the conditions is met. The word comprising is used in the sense of including rather than in to mean consisting of. All prior teachings acknowledged above are hereby incorporated by reference.

REFERENCES

(56) 1. Abhishek, A. and M. Doherty, Nat Rev Rheumatol, 7:96-104, 2011. 2. Kronenberg, H. M., Nature, 423:332-6, 2003. 3. Pfander, et al. Am J Pathol, 159:1777-83, 2001. 4. von der Mark, et al. Arthritis Rheum, 35:806-11, 1992. 5. Fuerst, et al. Arthritis Rheum, 60:2694-703, 2009. 6. Dreier, R. Arthritis Res Ther, 12:216, 2010. 7. Pitsillides, A. A. and F. Beier, Nat Rev Rheumatol, 7:654-63, 2011. 8. van der Kraan, P. M. and W. B. van den Berg, Osteoarthritis Cartilage, 20:223-32, 2012. 9. Frischholz, et al. J. Biol. Chem., 1998; 273:4547, 1998. 10. Yamaguchi, et al. J. Biol. Chem., 1989; 264:16022, 1989. 11. Olsen, B. J., and Ninomiya, Y., in: Guidebook to the Extracellular Matrix and Adhesion Proteins, Kreis, T., and Vale, R. (eds.), Oxford University Press, Oxford, pp. 32-48, 1993. 12. Schmid, T. M., and Linsenmayer, T. F., in: Structure and Function of Collagen Types, Mayne, R., and Burgeson, R. E. (eds.), Academic Press Inc., pp. 223-259, 1987. 13. Rucklidge, et al. Matrix Biol., 15:73, 1996. 14. Aigner, et al. Histochem. Cell Biol., 107:435, 1997. 15. Girkontaite, et al. Matrix Biol., 15:231, 1996. 16. Gerstenfeld, L. C. and F. D. Shapiro, J Cell Biochem, 62:1-9, 1996. 17. Wei, et al. Osteoarthritis Cartilage, 20:755-63, 2012. 18. Dong, et al. J Cell Physiol, 208:77-86, 2006. 19. Homer, et al. J Anat, 194:519-24, 1999. 20. Tsuchiya, et al. Bone, 37:323-36, 2005. 21. Huebner, et al. Osteoarthritis Cartilage, 17:1056-64, 2009. 22. Fitzgerald, et al. J Biol Chem, 283:6735-43, 2008. 23. Goldring, et al. Ann Rheum Dis, 67:75-82, 2008. 24. Arendt-Nielsen, et al. Arthritis Rheumatol (Hoboken, NJ). 66(12):3317-3326, 2014. doi:10.1002/art.38856. 25. Attur, M. et al. Osteoarthr Cartil. 2015; 23(11):1915-1924. doi:10.1016/j.joca.2015.08.006. 26. Attur, M. et al. Arthritis Rheumatol. 2015; 67(11):2905-2915. doi:10.1002/art.39279.