G protein-coupled receptor screening systems
12360111 ยท 2025-07-15
Assignee
Inventors
- Ryan Strachan (Chapel Hill, NC, US)
- Reid Olsen (Oxford, GB)
- Bryan Leo Roth (Durham, NC)
- Justin Gregory English (Chapel Hill, NC, US)
- Jeffrey Frederick Diberto (Carrboro, NC, US)
Cpc classification
C07K14/705
CHEMISTRY; METALLURGY
C07K14/723
CHEMISTRY; METALLURGY
C07K2319/60
CHEMISTRY; METALLURGY
G01N33/566
PHYSICS
C12N15/1055
CHEMISTRY; METALLURGY
G01N2500/04
PHYSICS
G01N33/74
PHYSICS
G01N2333/726
PHYSICS
C12N15/1055
CHEMISTRY; METALLURGY
International classification
G01N33/566
PHYSICS
Abstract
Disclosed herein is a G protein-coupled receptor (GPCR) assay platform comprised of two complementary systems that equate dynamic intermolecular interactions between a receptor and transducer with more complex stimulus-response cascades in living cells. In the disclosed in vitro ADSoRB method, the forced dissociation of transducers like G protein heterotrimers from receptors alters receptor conformations and ligand interactions to simulate pathway activation in a cell. In the disclosed TRUPATH method, measuring the extent of engineered G protein heterotrimer complex dissociation provides single transducer resolution in a cell.
Claims
1. A method for measuring G protein pathway activation by an agent, comprising (a) providing a system comprising: a G protein coupled receptor (GPCR) that is unfused or fused to a G protein subunit that is tagged with a fluorescent or luminescent donor or acceptor at an insertion site and incorporated into a lipid bilayer, a G protein subunit and a G protein subunit, wherein one of the G protein subunit or the G protein subunit is tagged with a fluorescent or luminescent donor or acceptor through insertion sites, wherein the insertion site for the fluorescent or luminescent donor or acceptor in the G protein subunit is: wherein the G subunit is a G(i1) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 91, 93, 95, 98, or 99; wherein the G subunit is a G(i2) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 91, 93, 113, 114, or 119; wherein the G subunit is a G(i3) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 98, 99, 100, 113, or 114; wherein the G subunit is a G(oA) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 91, 92, 93, 98, or 113; wherein the G subunit is a G(oB) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 91, 92, 93, 97, or 99; wherein the G subunit is a G(Z) subunit, the fluorescent donor or acceptor starts is inserted in the G subunit at position 114, 115, 116, 117, or 118; wherein the G subunit is a G(Q) subunit, the fluorescent donor or acceptor starts is inserted in the G subunit at position 119, 122, 123, 125, or 126; wherein the G subunit is a G(Slong) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 136, 137, 138, 139, or 140; wherein the G subunit is a G(Sshort) subunit, the fluorescent donor or acceptor starts is inserted in the G subunit at position 122, 123, 124, 125, or 126; wherein the G subunit is a G(Gustducin) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 114, 115, 116, 117, or 119; wherein the G subunit is a G(G12) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 134, 135, 136, 137, or 138; wherein the G subunit is a G(G13) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 125, 126, 127, 128, or 129; wherein the G subunit is a G(G11) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 239, 241, 244, 245, or 246; wherein the G subunit is a G(G15) subunit, the fluorescent donor or acceptor is inserted in the G subunit at position 244, 245, 246, 247, or 248; wherein if the G protein subunit is tagged with a fluorescent or luminescent donor, then either the G protein subunit or the G protein subunit is tagged with a fluorescent acceptor, and wherein if the G protein subunit is tagged with a fluorescent acceptor, then either the G protein subunit or the G protein subunit is tagged with a fluorescent or luminescent donor; (b) measuring a first resonance energy transfer in the system; (c) contacting the system with the agent; (d) measuring a second resonance energy transfer in the system; and (e) calculating G protein pathway activation (complex dissociation or rearrangement) from the difference between the second bioluminescence resonance energy transfer and the first bioluminescence resonance energy transfer.
2. The method of claim 1, further comprising repeating steps (b) to (e) for the agent at a plurality of doses and calculating a dose-response curve.
3. The method of claim 1, further comprising repeating steps (b) to (e) for the agent using a plurality of G/G/G combinations.
4. The method of claim 1, further comprising repeating steps (b) to (e) over time to determine kinetic parameters.
5. The method of claim 1, wherein the agent is a ligand with differential affinity for the GPCR in transducer-coupled versus uncoupled states.
6. The method of claim 1, wherein the system comprises a GPCR-G fusion or GPCR-G unfused pair.
7. The method of claim 1, wherein the lipid bilayer is a membrane of an intact cell, micelle, microsome, or liposome.
8. The method of claim 1, wherein other unfused or fused transducers are substituted for the G-protein.
9. The method of claim 1 wherein the insertional sites for the G/G/G combinations are: wherein the G subunit is a G(i1) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 91, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G9 subunit; wherein the G subunit is a G(i2) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 91, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G8 subunit; wherein the G subunit is a G(i3) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 99, wherein the G protein subunit is a G3 or G4 subunit, and wherein the G protein subunit is a G9 subunit; wherein the G subunit is a G(oA) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 92, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G8 subunit; wherein the G subunit is a G(oB) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 92, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G8 subunit; wherein the G subunit is a G(Z) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 114, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G1 subunit; wherein the G subunit is a G(Q) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 125, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G9 subunit; wherein the G subunit is a G(Slong) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 137, wherein the G protein subunit is a G1 subunit, and wherein the G protein subunit is a G1 subunit; wherein the G subunit is a G(Sshort) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 123, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G9 subunit; wherein the G subunit is a G(Gustducin) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 117, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G1 subunit; wherein the G subunit is a G(G12) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 134, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G9 subunit; wherein the G subunit is a G(G13) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 126, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G9 subunit; wherein the G subunit is a G(G11) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 246, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G13 subunit; and wherein the G subunit is a G(G15) subunit, wherein the fluorescent donor or acceptor is inserted in the G subunit at position 245, wherein the G protein subunit is a G3 subunit, and wherein the G protein subunit is a G13 subunit.
10. The method of claim 1, wherein the insertional site for the G-protein subunit encompasses a position within the Switch III region of the G protein.
11. The method of claim 1 wherein any combination of the GPCR-G fusion, G protein subunit, or the G protein subunit are expressed in a single plasmid under one promoter or in a bidirectional construct.
12. The method of claim 1, wherein the GPCR, the G protein subunit, the G protein subunit, and the G protein subunit are expressed in a stably-transfected cell line.
13. The method of claim 1 wherein the GPCR, G protein subunit, G protein subunit, or the G protein subunit are derived from non-human mammalian genomes.
14. The method of claim 1 wherein the GPCR, G protein subunit, G protein subunit, or the G protein subunit are derived from non-mammalian genomes.
15. The method of claim 1, wherein the fluorescent donor is a Renilla luciferase (Rluc) and the fluorescent acceptor is a green fluorescent protein (GFP).
16. The method of claim 12, wherein the G protein subunit is a G1, G2, G3, or G4 subunit, and the G protein subunit is a Gy1, G2, G3, G4, G7, G8, G9, G10, G11, G12, or G13 subunit.
17. A method for measuring G protein pathway activation by an agent, comprising (a) providing a system comprising: a G protein coupled receptor (GPCR) that is unfused or fused to a G protein subunit that is tagged with a fluorescent or luminescent donor or acceptor at an insertion site and incorporated into a lipid bilayer, a G protein subunit and a G protein subunit, wherein one of the G protein subunit or the G protein subunit is tagged with a fluorescent or luminescent donor or acceptor through-insertion sites, wherein the insertion site for the fluorescent or luminescent donor or acceptor in the G protein subunit encompasses a position within the Switch III region of the G protein, wherein if the G protein subunit is tagged with a fluorescent or luminescent donor, then either the G protein subunit or the G protein subunit is tagged with a fluorescent acceptor, and wherein if the G protein subunit is tagged with a fluorescent acceptor, then either the G protein subunit or the G protein subunit is tagged with a fluorescent or luminescent donor; (b) measuring a first resonance energy transfer in the system; (c) contacting the system with the agent; (d) measuring a second resonance energy transfer in the system; and (e) calculating G protein pathway activation (complex dissociation or rearrangement) from the difference between the second bioluminescence resonance energy transfer and the first bioluminescence resonance energy transfer.
Description
DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
DETAILED DESCRIPTION
(36) Before the present disclosure is described in greater detail, it is to be understood that this disclosure is not limited to particular embodiments described, and as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims.
(37) Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure.
(38) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure, the preferred methods and materials are now described.
(39) All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior disclosure. Further, the dates of publication provided could be different from the actual publication dates that may need to be independently confirmed.
(40) As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present disclosure. Any recited method can be carried out in the order of events recited or in any other order that is logically possible.
(41) Embodiments of the present disclosure will employ, unless otherwise indicated, techniques of chemistry, biology, and the like, which are within the skill of the art.
(42) The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to perform the methods and use the probes disclosed and claimed herein. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but some errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, temperature is in C., and pressure is at or near atmospheric. Standard temperature and pressure are defined as 20 C. and 1 atmosphere.
(43) Before the embodiments of the present disclosure are described in detail, it is to be understood that, unless otherwise indicated, the present disclosure is not limited to particular materials, reagents, reaction materials, manufacturing processes, or the like, as such can vary. It is also to be understood that the terminology used herein is for purposes of describing particular embodiments only, and is not intended to be limiting. It is also possible in the present disclosure that steps can be executed in different sequence where this is logically possible.
(44) It must be noted that, as used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise.
(45) The process of ligand-mediated formation and subsequent dissociation of GPCR-Transducer signaling complexes correlates with receptor activation and downstream responses in cells. These complexes can consist of native transducer proteins and/or those consisting of a fusion or chimeric transducer which contains or is fused to a BRET-like donor enzyme (e.g. Renilla luciferase, RLuc) or a BRET or FRET acceptor (e.g. GFP2). The disclosed system is distinguished in part by the implementation of real time signaling complex formation and dissociation as a way to recapitulate signaling outside of a cellular context (i.e. in vitro) and measure activation of single pathways within a cell without the requirement for second messenger detection. The dynamic signaling complexes claimed may exist unfused or fused. This conceptual framework provides significant advantages detailed herein.
(46) The invention is further separated into two components: ADSORB (Affinity Directed Selection of Receptor Binders) primarily for large-scale, ultra-high throughput in vitro drug screening and TRUPATH (for TRansdUcerome Profile Analysis of g protein paTHways) for cellular drug screening and signaling assays.
(47) Before the present disclosure is described in greater detail, it is to be understood that this disclosure is not limited to particular embodiments described, and as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims.
(48) It must be noted that, as used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise.
(49) The term polynucleotide barcode or barcode or polynucleotide tag are used interchangeably and, according to the present disclosure, as used herein refer to a sequence of nucleotides, i.e., an oligonucleotide, an oligomer, or an oligo. According to the present disclosure a barcode is attached to a subject molecule. An attached polynucleotide barcode finds use in tagging or labeling a single macromolecule, e.g., a polynucleotide, a polypeptide, a ribonucleoprotein, a carbohydrate, a lipid, a complex, and the like. A single polynucleotide barcode also finds use in tagging or labeling a plurality of macromolecules, e.g., a group of related polynucleotides, a group of related polypeptides, a group of related ribonucleoproteins, a group of related carbohydrates, a group of related lipids, a group of related complexes, and the like. Unique barcodes are used to individually differentiate members of a group from one another, e.g., unique barcodes attached to individual ribonucleoproteins serves to individually differentiate each ribonucleoprotein from every other ribonudeoprotein. Unique barcodes are also used to differentiate groups of related members, e.g., derived from the same species, derived from the same individual, derived from the same library, derived from the same experiment, derived from the same sample, etc., from other groups. For example, the same unique barcode is attached to a first plurality of related ribonucleoproteins and a second unique barcode is attached to a second plurality of related ribonucleoproteins such that when the first and second pluralities of related ribonucleoproteins are mixed the barcodes serve to indicate the group to which each ribonucleoprotein belongs. A polynucleotide barcode may be of any useful length, e.g., about 1-100 nucleotides, about 5-10 nucleotides, about 10-15 nucleotides, about 10-18 nucleotides, about 18-25 nucleotides, or about 25-50 nucleotides, depending on the particular contexts in which the barcode is being used and how many individual members or individual groups are preferably differentiated. In certain instances the barcode is between about 17 to about 22 nucleotides in length, e.g., about 17 nucleotides, about 18 nucleotides, about 19, nucleotides about 20 nucleotides, about 21 nucleotides, or about 22 nucleotides. For example, the use of a barcode about 1 nucleotide in length differentiates 4 individual members or groups, about 2 nucleotides in length differentiates 16 individual members or groups, about 3 nucleotides in length differentiates 64 individual members or groups, about 4 nucleotides in length differentiates 256 individual members or groups, about 5 nucleotides in length differentiates 1024 individual members or groups, and so on. Thus the use of a barcode over about 9 nucleotides in length differentiates over 1 million unique individual members or groups and a barcode over about 14 nucleotides in length differentiates over 1 billion unique individual members or groups.
(50) A fusion protein refers to a polypeptide formed by the joining of two or more polypeptides through a peptide bond formed between the amino terminus of one polypeptide and the carboxyl terminus of another polypeptide. The fusion protein can be formed by the chemical coupling of the constituent polypeptides or it can be expressed as a single polypeptide from nucleic acid sequence encoding the single contiguous fusion protein. A single chain fusion protein is a fusion protein having a single contiguous polypeptide backbone. Fusion proteins can be prepared using conventional techniques in molecular biology to join the two genes in frame into a single nucleic acid, and then expressing the nucleic acid in an appropriate host cell under conditions in which the fusion protein is produced.
(51) A spacer or linker as used herein refers to a peptide that joins the proteins comprising a fusion protein. Generally, a spacer has no specific biological activity other than to join the proteins or to preserve some minimum distance or other spatial relationship between them. However, the constituent amino acids of a spacer may be selected to influence some property of the molecule such as the folding, net charge, or hydrophobicity of the molecule. Additionally, linkers may be selected which comport some new functionality to the fusion (e.g. a phosphorylatable region).
(52) Luciferase here is used as a generic stand-in for any enzyme or protein which can, through chemical or enzymatic reaction, produce light (e.g. luminescence).
(53) For the purposes of the mechanism employed in TRUPATH, a luminescent enzyme can be replaced with a fluorescent protein to convert the technique from BRET to FRET.
(54) The location of the donor protein and acceptor protein is interchangeable between the subunits of the heterotrimer but is discussed in terms of the donor being fused to the G and the acceptor on the G for purposes of simplicity.
(55) Disclosed herein is a screening platform that in some embodiments involves fusion proteins comprised of G protein coupled receptors (GPCRs) fused to a transducer, such as a native or engineered G protein subunit (G), arrestin, or a signaling associated protein (e.g. a scaffolding protein, complex, or a protein or protein fragment that induces inactive or active structural changes in the receptor). In some cases, the GPCR and transducer are connected by a flexible linker. By fusing the transducer to the receptor, the system has a 1:1 local stoichiometry, maintains appropriate membrane trafficking, and has increased fidelity to the expressed receptor/transducer pathway (
(56) All eukaryotes use G proteins for signaling, resulting in a large diversity of G proteins. For example, the human genome encodes roughly 800 GPCRs, 18 different G proteins, 4 major G proteins, and 12 G proteins (
(57) For use in the disclosed TRUPATH and ADSoRB methods, the G subunit of the disclosed fusion protein can also be tagged with a fluorescent/luminescent donor or acceptor. In these embodiments, if the G protein subunit is tagged with a fluorescent/luminescent donor, then either a G protein subunit or a G protein subunit is tagged with a fluorescent acceptor, and if the G protein subunit is tagged with a fluorescent acceptor, then either a G protein subunit or a G protein subunit is tagged with a fluorescent/luminescent donor.
(58) Fusion proteins, also known as chimeric proteins, are proteins created through the joining of two or more genes which originally coded for separate proteins. Translation of this fusion gene results in a single polypeptide with function properties derived from each of the original proteins. Recombinant fusion proteins can be created artificially by recombinant DNA technology for use in biological research or therapeutics. Chimeric mutant proteins occur naturally when a large-scale mutation, typically a chromosomal translocation, creates a novel coding sequence containing parts of the coding sequences from two different genes.
(59) The functionality of fusion proteins is made possible by the fact that many protein functional domains are modular. In other words, the linear portion of a polypeptide which corresponds to a given domain, such as a tyrosine kinase domain, may be removed from the rest of the protein without destroying its intrinsic enzymatic capability. Thus, any of the herein disclosed functional domains can be used to design a functional fusion protein or chimera. Function of the GPCR-transducer fusion proteins and select G protein-RLuc8 chimeras disclosed herein is shown in
(60) A recombinant fusion protein is a protein created through genetic engineering of a fusion gene. This typically involves removing the stop codon from a cDNA sequence coding for the first protein, then appending the cDNA sequence of the second protein in frame through ligation or overlap extension PCR. Synthesis of the fused cDNA sequence can also yield a recombinant fusion protein. That DNA sequence will then be expressed by a cell as a single protein. The protein can be engineered to include the full sequence of both original proteins, or only a portion of either.
(61) If the two entities are proteins, often linker (or spacer) peptides are also added which make it more likely that the proteins fold independently and behave as expected (see below). Especially in the case where the linkers enable protein purification, linkers in protein or peptide fusions are sometimes engineered with cleavage sites for proteases or chemical agents which enable the liberation of the two separate proteins. This technique is often used for identification and purification of proteins, by fusing a GST protein, FLAG peptide, or a hexa-his peptide (aka: a 6his-tag) which can be isolated using nickel or cobalt resins (affinity chromatography). Chimeric proteins can also be manufactured with toxins or anti-bodies attached to them in order to study disease development.
(62) Linkers are any flexible amino-acid sequence including but not limited to the following examples:
(63) TABLE-US-00001 TANGOLinker: (SEQIDNO:2) DTGGRTPPSLGPQDESCTTASSSLAKDTSSTGENLYFQL; SmallLinker: (SEQIDNO:3) SGGGS; MediumLinker: (SEQIDNO:4) GGGGSADIAAAKAGGGGS; and LongLinker (SEQIDNO:5) GGGGSADIAAAKAGGGGSGGGGSADIAAAKAGGGGS.
(64) Alternatively, internal ribosome entry sites (IRES) elements can be used to create multigene or polycistronic messages. IRES elements are able to bypass the ribosome scanning model of 5 methylated Cap dependent translation and begin translation at internal sites (Pelletier and Sonenberg, 1988). IRES elements from two members of the picornavirus family (polio and encephalomyocarditis) have been described (Pelletier and Sonenberg, 1988), as well an IRES from a mammalian message (Macejak and Samow, 1991). IRES elements can be linked to heterologous open reading frames. Multiple open reading frames can be transcribed together, each separated by an IRES, creating polycistronic messages. By virtue of the IRES element, each open reading frame is accessible to ribosomes for efficient translation. Multiple genes can be efficiently expressed using a single promoter/enhancer to transcribe a single message (U.S. Pat. Nos. 5,925,565 and 5,935,819; PCT/US99/05781). IRES sequences are known in the art and include those from encephalomycarditis virus (EMCV) (Ghattas, I. R. et al., Mol. Cell. Biol., 11:5848-5849 (1991); BiP protein (Macejak and Samow, Nature, 353:91 (1991)); the Antennapedia gene of drosophilia (exons d and e) [Oh et al., Genes & Development, 6:1643-1653 (1992)); those in polio virus [Pelletier and Sonenberg, Nature, 334:320325 (1988); see also Mountford and Smith, TIG, 11:179-184 (1985)).
(65) ADSoRB is a screening strategy that relies on the differential abilities of ligand classes (e.g. agonists, antagonists, inverse agonists, allosteric modulators) to recognize or interact with different receptor states (e.g. native/unliganded, liganded, active, inactive, mutant, transducer or signaling mimetic-stabilized) (
(66) Target screening complexes (GPCR-transducer fusion proteins) are produced in a biological or in vitro system. The target can be prepared by a membrane preparation (e.g. released, separated, or sequestered in microsomes) or by a purification and isolation strategy (e.g. immuno or chemical purification methods, nano- or lipodisc, detergent micelle, liposomal, or lipidomimetic environment, with or without the use of further purification or isolation methods). The target preparation may or may not be oriented to expose different receptor surfaces for screening.
(67) The target complexes may or may not be (depending on requirements of assay) immobilized (e.g. bound to affinity bead resin, magnetic resin, column, plate, flow-cells, SPR chips, arrays) or used in the raw or crude form (e.g. collected by standard methods of centrifugation or filtration). The tethered transducer may consist of the tagged (e.g. Renilla luciferase) or native form and need not be a G protein (transducer here also refers to other proteins and methods to reversibly stabilize receptor states). The tagged form may be used to quantify expression or target yield against known standards as some targets lack tools or methods to quantify their expression or yield. This may be done as follows (but is not exclusive to the following method). A known tagged-receptor-transducer fusion is expressed and quantified by methods such as radioligand saturation binding. Via titration, this standard is diluted and probed with a substrate for the tagged luciferase to determine the relationship between luminescence and unit of target determined by standard methods. The unknown tagged target is similarly titrated in the luciferase assay to determine the relative concentration or yield by interpolation of the standard curve derived from the known standard (
(68) Targets are exposed to (i.e. treated or screened with) ligand libraries (collections curated or otherwise, natural product extracts or tissue preparations)this may consist of incubations of varying duration, washing or otherwise flowing ligands across or through the target preparation. The flow-through/un-bound fraction of the library can be collected for further analysis or subsequent screening (e.g. as a negative selection tool). The treated target may or may not be washed to identify stronger or more selective interacting ligands or to create a more stringent selection strategyall flow-through from wash-stages may be captured for analysis as in the initial eluate.
(69) In an important distinguishing step that has not been disclosed in other screening methods and that provides control over ligand pharmacology (i.e. to isolate in a targeted fashion agonists, biased agonists, positive allosteric modulators, and others) bound or interacting ligands are functionally eluted by incubating complexes with inhibitors of GPCR-transducer interactions (e.g. guanine nucleotides and other chemical derivatives for G-proteins; inhibitors of arrestin association like arrestin loop peptides; antibodies or other biomimetics that compete for binding surfaces, G protein peptide fragments, or engineered domains that change protein structure) (
(70) Functional analysis of the elution may consist of bulk-screening eluates in signaling assays (e.g. TRUPATH defined in later section, TANGO assay, GTPyS, Promega Glosensor cAMP, FLIPR calcium mobilization assays, radio-labeled inositol trisphosphate accumulation, cAMP accumulation, Ras/Rac/Rho assays, transcriptional reporters, etc.). The specific contents of the eluates may also be identified by deep sequencing of nucleic acid barcodes, protein microarrays, small molecule or protein mass spectroscopy, phage tittering, clonal isolation, or other deconvolution methods. Contents of eluates can also be amplified to subsequently enrich future ligand libraries for subsequent and iterative screening. This multi-round selection strategy is an iterative process to enrich for ligands with preferences for the desired receptor affinity state. Mufti-round selection can also be used as mentioned above for negative selection. The determined selected components of the library can be compiled into a database for other purposes (e.g. computational analysis and deconvolution, subsequent structure activity relationship analysis, artificial intelligence/machine learning for in silico drug discovery and computational sorting and design, or for further iterative screening purposes involving medicinal chemistry). This selection strategy may be used iteratively as needed for as many rounds as required. The information set for each transducer-tethered target can be used to identify differential affinities of the same or different ligands for the different states (hereafter referred to as signaling bias).
(71) As depicted in
(72) One-shot screening (i.e. using only one round of ADSoRB) of libraries could be achieved using very stringent wash protocols or using microfluidics such as those common to surface plasmon resonance (SPR) machines or those using magnetic beads. Automated immobilization of target complexes, library incubation, washing, functional elution, and recovery of eluted library agents would greatly increase the selectivity and efficiency of ADSoRB screens.
(73) TRUPATH is a comprehensive signal transduction profiling assay that correlates heterotrimeric G protein dissociation with downstream signaling. It can be run in unfused or transducer-receptor-fused scenarios and is based on the concept of Frster Resonance Energy Transfer. The described application herein relies on a bioluminescent donor enzyme, a derivation called Bioluminescence Resonance Energy Transfer (e.g. BRET) (
(74) A GPCR is an allosteric machine that catalyzes the exchange of one nucleotide (e.g. GDP) for another (GTP) in the subunit of a physically associated G protein. The G protein when inactive is closely associated with the GG subunit (an obligate dimeric complex). By tagging the G or G subunit with a donor or acceptor, and the G with a donor or acceptor, the association or dissociation of this complex can be measured (
(75) TRUPATH biosensor compositions are novel as insertion sites for the donor/acceptor within the G subunits and GG acceptor pairs have been empirically determined and optimized (see below for detailed explanation,
(76) A completely unexplored and non-obvious region for luminescent or fluorescent insertions is disclosed herein. Specifically, we identified a flexible linker region extending from the 4-strand to the 3 helix of the Ras-like domain (Switch III,
(77) TABLE-US-00002 TABLE 1 Example Donor/Acceptor Insertion sites.sup.# G Top five AA positions* G G i1 91*, 93, 95, 98, 99 1, 2, 3*, 4 1, 9*, , 11, 13 i2 91*, 93, 113, 114, 119 1, 2, 3*, 4 2, 8*, 9, 10 i3 98, 99*, 100, 113, 114 1, 2, 3*, 4* 1, , 9*, 11, 13 oA 91, 92*, 93, 98, 113 1, 2, 3*, 4 2, 4, 8*, 10 oB 91, 92*, 93, 97, 99 1, 2, 3*, 4 2, 8*, 9, 10 Z 114*, 115, 116, 117, 118 1, 2, 3*, 4 1*, 4, 9, 11 Q 119, 122, 123, 125*, 126 1, 2, 3*, 4 1, 8, 9*, 11 Slong 136, 137*, 138, 139. 140 1*, 2, 3, 4 1*, 4, 9, 11 Sshort 122, 123*, 124, 125, 126 1, 2, 3*, 4 1, 4, 9*, 11 Gustducin 114, 115, 116, 117*, 119 1, 2, 3*, 4 1*, 9, 11, 12 G12 134*, 135, 136, 137, 138 1, 2, 3*, 4 1, 4, 9*, 11 G13 125, 126*, 127, 128, 129 1, 2, 3*, 4 1, 7, 9*, 12 G11 239, 241, 244, 245, 246* 1, 2, 3*, 4 1, 3, 11, 13* G14 ND ND ND G15 244, 245*, 246, 247, 248 1, 2, 3*, 4 2, 3, 9, 13* Golf ND ND ND *Denotes top G-Rluc chimera, G, or G-GFP. To efficiently define the optimal G-RLuc8/G-GFP heterotrimer composition, we established a screening process and a-priori selection criterion for each step of the optimization (i.e., the construct with the greatest dynamic range, defined as Emax-Basal signal in a dose response assay, was chosen for further refinement). .sup.#For naming, we use the position of the first amino acid in the linker-RLuc8 in the full protein sequence. For example, insertion of RLuc8 following the lysine at position 97 in Gq is named Gq(98)RLuc8,
(78) Head-to-head comparisons against other BRET heterotrimer sensors demonstrates that TRUPATH biosensor compositions are superior at every G protein tested, with statistically significant improvements ranging from 1.5- to approximately 100-fold (
(79) The TRUPATH platform can be enhanced by generating polycistronic triple plasmids that encode G, G, and G subunits under the same promoter using 2A self-cleaving peptide and internal ribosome entry site sequences (
(80) The general principle described in the G protein example can be extended to situations such as the recruitment of other transducers such as arrestins, scaffolding complexes, or in some cases the dissociation of other complexes at the receptor.
(81) TABLE-US-00003 TABLE 2 Head-to-head comparison for TRUPATH sensors# Reference Optimized Sensor AA G- Net BRET AA G- Net BRET Fold G Receptor position GFP G (Avg SEM) position GFP G (Avg SEM) Increase T p I1 OPRM 92 2 1 0.018 0 003 91 9 3 0.229 0.004 2.12 0.03 24.6 <0.0001 I2 OPRM 92 2 1 0.013 0.002 91 8 3 0.103 0.003 7.81 0.23 25.43 <0.0001 I3 OPRM 92 2 1 0.063 0.003 99 9 3 0.245 0.006 3.9 0.07 36.27 <0.0001 oA OPRM 92 2 1 0.127 0.003 92 8 3 0.185 0.005 1.48 0.04 9.472 oB OPRM 92 2 1 0.130 0.003 92 8 3 0.198 0.003 1.52 0.03 11.95 Z OPRM 92 2 1 0.037 0.003 114 1 3 0.251 0.006 6.87 0.16 32.95 <0.0001 Gust KOR 92 2 1 0.003 0.001 117 1 3 0.223 0.006 65.43 1.75 35.84 <0.0001 sS ADRB2 100 1 1 0.016 0.002 123 9 3 0.128 0.006 7.81 0.35 18.75 <0.0001 sL ADRB2 114 1 1 0.018 0.003 137 1 3 0.077 0.005 5.43 0.25 17.24 <0.0001 Olf ADRB2 101 2 1 n.d. n.d n.d. n.d. n.d. n.d. n.d. n.d. Q NTSR1 98 1 1 0.018 0.002 125 9 3 0.203 0.005 11.04 0.18 49.59 <0.0001 11 NTSR1 98 1 1 0.001 0.001 246 13 3 0.123 0.008 106.58 6.49 16.25 <0.0001 14 NTSR1 98 2 1 n.d. n.d. n.d. n.d. n.d. n.d. n.d. n.d. 15 NTSR1 101 2 1 0.006 0.001 245 13 3 0.047 0.003 8.01 0.46 14.36 <0.0001 12 NTSR1 115 2 1 0.004 0.001 134 9 3 0.161 0.002 40.49 0.59 65.05 <0.0001 13 NTSR1 107 2 1 0.021 0.002 126 9 3 0.412 0.006 19.51 0.29 61.39 <0.0001 #Raw data (NET BRET and fold-increase in amplitude, FIG. 29) showing significant improvement in dynamic range for all optimized BRET sensors. Data represent mean values standard error from three biological replicates. Fold increase in dynamic range (NET BRET) between reference construct sets and the final optimized sensor (TRUPATH) were analyzed by two-tailed unpaired t-tests for each G, significance set at 0.05.
(82) Highlighting the platform's strength as a complete drug discovery tool, TRUPATH can be used to i) assay dose-responses of known ligands or those derived from ADSoRB in an effort to determine their efficacies, potencies, or allosteric properties, or ii) assay single point concentrations of ligand across multitudes of conditions (matrix) or large ligand libraries. Conversely, TRUPATH can precede ADSoRB to identify transducer preferences that can then be used to screen and isolate new pathway-specific ligands (i.e. tailor ligand pharmacology). For example, the GPCR-GRLuc8 fusion protein corresponding to the signaling pathway activated in TRUPATH will serve as the target complex for uHTS of extremely large ligand libraries in ADSoRB. Miniaturizing this platform to 384-well (
(83) ADSoRB and TRUPATH are complementary technologies, which as a platform enable large scale profiling of all signaling pathways that can facilitate rapid and targeted screening of complex ligand mixtures, and vice versa. Together, these technologies greatly expand the signaling space and chemical space available to GPCRs, thus increasing our understanding of GPCR function in human health and disease and our ability to treat its dysfunction.
(84) TRUPATH screening has many uses. These include but are not limited to: 1) comprehensive profiling of signaling for any given ligand-GPCR pair, 2) profiling the signaling of receptor mutants and variants (pharmacogenomics), and 3) profiling the signaling of understudied GPCRs and orphan GPCRs (i.e. receptors that lack an endogenous agonist or well-defined physiological function).
(85) A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.
EXAMPLES
Example 1: Affinity-Directed Selection of Receptor Binders (ADSoRB) Enables Specific Isolation of Opioid Receptor Agonists
Methods
(86) Cloning: GPCR-transducer fusions in which the top G-RLuc8 chimera from TRUPATH (Table 1) is fused via its N-terminus to the C-terminus of a GPCR can be generated via standard cloning methodologies such as Gibson assembly. Fusions between proteins can be direct or use any of the linkers detailed above. See the Genbank formatted example of a receptor-Galpha-Rluc fusion protein (Neurotensin-Gq) provided below.
(87) Microsomal membrane preparation: A given GPCR-transducer fusion in a mammalian expression vector is transiently transfected into HEK293 suspension cells (30 g DNA/30 mL culture) for overexpression. Microsomes are prepared 36-48 hr post-transfection using differential centrifugation. Briefly, cells are collected at 300g for 10 min at RT. Cell pellets are resuspended in 10 mL Homogenization Buffer (50 mM TrisHCl, 2 mM EDTA, 1 protease inhibitors, pH7.4) and dounce homogenized on ice (50 strokes, Type A). Lysed cells are centrifuged 500g for 10 min at 4C. The low speed supernatant is transferred to a 30 mL centrifuge tube and microsomes are collected at 35,000g for 60 min at 4 C. The high-speed pellet (P2) is resuspended in 1 mL of Resuspension Buffer (50 mM TrisHCl, 2 mM EDTA, 10 mM MgCl.sub.2, 5% glycerol, 1 protease inhibitors, pH7.4) and aliquoted into 1.5 mL tubes. Membranes pellets are collected at max speed in a table top centrifuge (14000g for 30 min) at 4 C. The supernatant is removed and pellets are frozen and stored at 80 C. until use.
(88) ADSoRB process using membranes and centrifugation: Membrane pellets are thawed and resuspended to homogeneity in cold Binding Buffer (20 mM HEPES, 10 mM MgCl2, 0.1 mM EDTA, 0.1% BSA, pH7.4) and aliquoted into 1.5 mL tubes at 110.sup.12 receptor molecules per selection (or less depending on round). The membrane pellet is recovered at 18000g for 10 min at 4 C. Microsomes are resuspended in a library surrogate (KD concentration of [.sup.3H]agonist radiotracers like [H]DAMGO or [.sup.3H]U69593, or [H]antagonist radiotracer like [.sup.3H]Naloxone) and incubated for 2 hr at RT with end-over-end mixing. The membrane pellet is recovered at 18000g for 10 min at 4 C. Supernatant is removed and membrane pellet washed by resuspension in 1 mL cold binding buffer. Membranes are recovered at 18000g for 10 min at 4 C. This step is repeated four times for a total of 5 washes, with the last wash split according to the different elution conditions (e.g. buffer or GPPNHP). The final wash is removed and the pellet is resuspended in 500 L of binding buffer or GPPNHP elution buffer. Incubate at RT for various times (typically 1 to 5 min). High speed centrifugation is used to pellet the membrane and the supernatant containing the eluted ligands is saved for downstream processing. In the case of a radiotracer we performed scintillation counting to detect the number of ligands at each step. Elution steps can be repeated as needed to recover the ligand. Functional elution can be followed with general elution (e.g. 0.2M Glycine, pH 2.2) for recovery of all other binders.
(89) Results
(90)
(91)
(92)
(93)
Example 2: Development of a Scalable, Cell-Type-Agnostic Platform for Profiling GPCR Signaling at Single Transducer Resolution
(94) G Protein Coupled Receptors (GPCRs) are the most widely drugged protein family in the human genome. It is recognized that signaling events following GPCR activation by a ligand can proceed disproportionately through multiple G-protein pathways. This signaling bias makes it possible to tune the physiological response for each receptor-ligand interaction, thus setting up the potential to develop safer and more efficacious biased drugs (Manglik A et al. Nature. 2016 Sep. 8; 537(7619):185-190). However, there are limited assays that can differentiate between G proteins, and many of these are further confounded because of their dependence on downstream signaling events and manifest qualities such as amplification and cell-type variation. The ability to measure the extent to which any given ligand-GPCR signaling response is biased would advance the scope of known GPCR pharmacology and help inform drug-discovery and optimization efforts. This disclosure presents a comprehensive signaling assay to avoid these specific caveats.
(95) For the following, placement of the luminescent donor and fluorescent acceptor can be exchanged (i.e. it is not necessary that the luminescent donor be on the G, and could for the intended purposes be located on the G or G subunit).
(96) Peptide sequences for G subunits are used to generate maps of known or putative flexible or disordered domains. This can be done either by using published structures or through modeling of amino acid sequences for less well understood G subunits against known structures with high similarity (Table 3). Plasmids containing human G, G, and G constructs were obtained from public resources, except for G12 and Ggustducin, which were synthesized as gene blocks. All constructs were subcloned into pcDNA5/FRT/TO.
(97) TABLE-US-00004 TABLE 3 List of G proteins and the PDB ID for the structure used to build homology models in swiss model. Gi1 3UMS Gi2 3UMS Gi3 5KDO GoA 3C7K GoB 3C7K GZ 5KDO GGust 3V00 GsS 3SN6 GsL 3SN6 GOlf 3SN6 GQ 3AH8 G11 3AH8 G14 4GNK G15 3AH8 G12 1ZCA G13 3AB3
(98) Chimeric constructs (e.g. G-RLuc8 and G-GFP2 constructs) were generated via Gibson assembly-type methods. G-GFP2 constructs were generated by amplification of the backbone construct (e.g. pcDNA-G) from the N-terminal start codon and adding homology to the C-terminus of GFP flanked by a short flexible linker sequence (GSAGT). GFP2 sequences were amplified by PCR, adding homology to the pcDNA backbone at the 5 end, and homology to the N-terminus of the G sequence at the 3 end. Backbone and insert constructs were co-incubated with Gibson-assembly master mix and transformed into competent E. coli. G-RLuc8 constructs were generated by linearizing a single backbone template for each region (e.g. A-B linker region, B-C helical region, Switch III), amplifying outwards from the 5 and 3 ends of the beginning of those respective regionsproducing a linearized construct lacking that sequence. These deleted codons were filled in with RLuc8 insertion sequences by overhang PCR while adding a flexible SGGGS linker, the missing codon sequences flanking the appropriate insertion site, and homology to the 5 and 3 end of the linearized backbone. These were incubated with Gibson-assembly master mix to assemble G-RLuc8 chimeric constructs containing a fully intact G with an RLuc8 sequence, one for each amino-acid position within the targeted region.
(99) For GPCR-fusion proteins, the optimal G-RLuc8 chimera is fused via its N-terminus to the C-terminus of a GPCR using standard cloning methods. See the Genbank formatted example of a receptor-Galpha-Rluc fusion protein (Neurotensin+Gq) provided below.
(100) Biosensor optimization can be performed as follows using either a co-transfection of receptor and GRluc variants or an N-terminally fused GPCR-GRluc chimera (
(101) The following is a Genbank formatted example of a receptor-G-Rluc fusion protein (Neurotensin-G-Rluc):
(102) TABLE-US-00005 LOCUS Neurotensin_GqRluc83522bpds-DNAlinear28Nov.2018 DEFINITION . FEATURES Location/Qualifiers misc_feature 1360..1365 /label=AgeI /ApEinfo_revcolor=#d59687 /ApEinfo_fwdcolor=#d59687 misc_feature 1846..1871 /label=rluc8FWDhomology /ApEinfo_revcolor=#f8d3a9 /ApEinfo_fwdcolor=#f8d3a9 misc_feature 1846..1863 /label=LinkerF /ApEinfo_revcolor=#75c6a9 /ApEinfo_fwdcolor=#75c6a9 misc_feature 1474..1845 /label=GqFragment1 /ApEinfo_revcolor=#c7b0e3 /ApEinfo_fwdcolor=#c7b0e3 misc_feature 1453..1458 /label=TEVCutSite /ApEinfo_revcolor=#b7e6d7 /ApEinfo_fwdcolor=#b7e6d7 misc_feature 1354..1359 /label=ClaI /ApEinfo_revcolor=#75c6a9 /ApEinfo_fwdcolor=#75c6a9 misc_feature 1864..2796 /label=rluc8 /ApEinfo_revcolor=#ff9ccd /ApEinfo_fwdcolor=#ff9ccd misc_feature 1366..1446 /label=V2Tail /ApEinfo_revcolor=#ffef86 /ApEinfo_fwdcolor=#ffef86 misc_feature 2815..3522 /label=GqFragment2 /ApEinfo_revcolor=#84b0dc /ApEinfo_fwdcolor=#84b0dc misc_feature 1447..1452 /label=AgeI /ApEinfo_revcolor=#b4abac /ApEinfo_fwdcolor=#b4abac misc_feature 1250..1255 /label=KOZAK /ApEinfo_revcolor=#9eafd2 /ApEinfo_fwdcolor=#9eafd2 misc_feature 1354..1473 /label=Linker /ApEinfo_revcolor=#faac61 /ApEinfo_fwdcolor=#faac61 misc_feature 1846..2814 /label=rluc8+linker /ApEinfo_revcolor=#c6c9d1 /ApEinfo_fwdcolor=#c6c9d1 misc_feature complement(2838..2838) /label=Homo2 /ApEinfo_revcolor=#c7b0e3 /ApEinfo_fwdcolor=#c7b0e3 misc_feature 76..81 /label=ClaI /ApEinfo_revcolor=#75c6a9 /ApEinfo_fwdcolor=#75c6a9 misc_feature 1798..1798 /label=Homology1 /ApEinfo_revcolor=#d59687 /ApEinfo_fwdcolor=#d59687 misc_feature 2797..2814 /label=Linker /ApEinfo_revcolor=#f8d3a9 /ApEinfo_fwdcolor=#f8d3a9 misc_feature complement(1256..1261) /label=KOZAK /ApEinfo_revcolor=#9eafd2 /ApEinfo_fwdcolor=#9eafd2 misc_feature 82..3522 /label=Receptor-AlphaFusion /ApEinfo_revcolor=#ffef86 /ApEinfo_fwdcolor=#ffef86 misc_feature 1..3 /label=Start /ApEinfo_revcolor=#f8d3a9 /ApEinfo_fwdcolor=#f8d3a9 misc_feature 82..1353 /label=Neurotensin /ApEinfo_revcolor=#84b0dc /ApEinfo_fwdcolor=#84b0dc misc_feature 1459..1473 /label=TEVCutSite /ApEinfo_revcolor=#b7e6d7 /ApEinfo_fwdcolor=#b7e6d7 misc_feature 4..75 /label=Signal/FLAG /ApEinfo_revcolor=#faac61 /ApEinfo_fwdcolor=#faac61 misc_feature 2790..2814 /label=Rluc8HomologyR /ApEinfo_revcolor=#b4abac /ApEinfo_fwdcolor=#b4abac (SEQIDNO:1) 1 atgaagacgatcatcgccctgagctacatcttctgcctggtattcgccgactacaaggac 61 gatgatgacgccagcatcgatatgcacctcaacagctccgtgccgcagggcacccctggt 121 gaacccgatgcccagcccttttcgggaccacagtccgaaatggaagcgacgttcctggcg 181 ctcagtttgagcaatggttctggcaatacctcggaatccgacacggcagggcccaacagc 241 gacctggacgtgaacactgacatttattccaaggtgctggtgactgctatatacctggca 301 ctcttcgtggtgggcactgtgggcaactccgtgacactcttcactctagcgcggaagaag 361 tcactgcagagcctgcagagcactgtgcattaccacctgggcagcctggcactgtctgac 421 ctgcttatccttctgctggccatgcccgtggagctatacaacttcatctgggtacaccat 481 ccctgggcctttggggacgctggctgccgtggctactatttcctgcgtgatgcctgcacc 541 tatgccacagccctcaatgtagccagcctgagtgtggagcgctacttggccatctgccat 601 cccttcaaggccaagaccctcatgtcccgcagccgcaccaagaaattcatcagtgccata 661 tggctagcttcggcgctgctggctatacccatgcttttcaccatgggcctgcagaaccgc 721 agtgccgacggcacgcaccctggcggcctggtgtgcacacccattgtggacacagccact 781 gtcaaggtcgtcatccaggttaacaccttcatgtccttcctgtttcccatgttggtcatc 841 tccatcctaaacaccgtgattgccaacaaactgacagtcatggtgcaccaggccgccgag 901 cagggccgagtgtgcaccgtgggcacacacaacggtttagagcacagcacgttcaacatg 961 accatcgagccgggtcgtgtccaggccctgcgccacggagtcctcgtcttacgtgctgtg 1021 gtcattgcctttgtggtctgctggctgccctaccacgtgcgacgcctgatgttctgctat 1081 atctcggatgaacagtggactacgttcctcttcgatttctaccactatttctacatgcta 1141 accaacgctctcttctacgccagctccgccatcaatcccatcctctacaacctggtctcc 1201 gccaacttccgccaggtctttctgtccacgctggcctgcctttgtcctgggtggcgccac 1261 cgccggaggaagcgccccgccttctcacggaaggccgactcagtatcctctaaccatacc 1321 ctgagttcaaacgccactcgggaaacgctgtacatcgataccggtggacgcaccccaccc 1381 agcctgggtccccaagatgagtcctgcaccaccgccagctcctccctggccaaggacact 1441 tcatcgaccggtgagaacctgtacttccagctaatgactctggagtccatcatggcgtgc 1501 tgcctgagcgaggaggccaaggaagcccggcggatcaacgacgagatcgagcggcagctc 1561 cgcagggacaagcgggacgcccgccgggagctcaagctgctgctgctcgggacaggagag 1621 agtggcaagagtacgtttatcaagcagatgagaatcatccatgggtcaggatactctgat 1681 gaagataaaaggggcttcaccaagctggtgtatcagaacatcttcacggccatgcaggcc 1741 atgatcagagccatggacacactcaagatcccatacaagtatgagcacaataaggctcat 1801 gcacaattagttcgagaagttgatgtggagaaggtgtctgctttttctggtggtggtgga 1861 tccatggcttccaaggtgtacgaccccgagcaacgcaaacgcatgatcactgggcctcag 1921 tggtgggctcgctgcaagcaaatgaacgtgctggactccttcatcaactactatgattcc 1981 gagaagcacgccgagaacgccgtgatttttctgcatggtaacgctacctccagctacctg 2041 tggaggcacgtcgtgcctcacatcgagcccgtggctagatgcatcatccctgatctgatc 2101 ggaatgggtaagtccggcaagagcgggaatggctcatatcgcctcctggatcactacaag 2161 tacctcaccgcttggttcgagctgctgaaccttccaaagaaaatcatctttgtgggccac 2221 gactggggggctgctctggcctttcactacgcctacgagcaccaagacaggatcaaggcc 2281 atcgtccatatggagagtgtcgtggacgtgatcgagtcctgggacgagtggcctgacatc 2341 gaggaggatatcgccctgatcaagagcgaagagggcgagaaaatggtgcttgagaataac 2401 ttcttcgtcgagaccgtgctcccaagcaagatcatgcggaaactggagcctgaggagttc 2461 gctgcctacctggagccattcaaggagaagggcgaggttagacggcctaccctctcctgg 2521 cctcgcgagatccctctcgttaagggaggcaagcccgacgtcgtccagattgtccgcaac 2581 tacaacgcctaccttcgggccagcgacgatctgcctaagctgttcatcgagtccgaccct 2641 gggttcttttccaacgctattgtcgagggagctaagaagttccctaacaccgagttcgtg 2701 aaggtgaagggcctccacttcctccaggaggacgctccagatgaaatgggtaagtacatc 2761 aagagcttcgtggagcgcgtgctgaagaacgagcagagcggaggaggcggcagtgagaat 2821 ccatatgtagatgcaataaagagtttatggaatgatcctggaatccaggaatgctatgat 2881 agacgacgagaatatcaattatctgactctaccaaatactatcttaatgacttggaccgc 2941 gtagctgaccctgcctacctgcctacgcaacaagatgtgcttagagttcgagtccccacc 3001 acagggatcatcgaatacccctttgacttacaaagtgtcattttcagaatggtcgatgta 3061 gggggccaaaggtcagagagaagaaaatggatacactgctttgaaaatgtcacctctatc 3121 atgtttctagtagcgcttagtgaatatgatcaagttctcgtggagtcagacaatgagaac 3181 cgaatggaggaaagcaaggctctctttagaacaattatcacatacccctggttccagaac 3241 tcctcggttattctgttcttaaacaagaaagatcttctagaggagaaaatcatgtattcc 3301 catctagtcgactacttcccagaatatgatggaccccagagagatgcccaggcagcccga 3361 gaattcattctgaagatgttcgtggacctgaacccagacagtgacaaaattatctactcc 3421 cacttcacgtgcgccacagacaccgagaatatccgctttgtctttgctgccgtcaaggac 3481 accatcctccagttgaacctgaaggagtacaatctggtctaa.
Example 3: TRUPATH Assays for Screening Prototypic and Understudied GPCRs for G-Protein Preferences
(103) A mammalian expression vector containing any GPCR can be used to screen the complete set of TRUPATH G protein sensors (Table 1) for any number of ligands. Alternatively, a single expression vector utilizing multiple promoter regions or IRES (or similar sites) can be employed to express the entire system from a single plasmid (described here as a triple plasmid or polycistronic vector (
(104) After transfection, cells are plated in a suitable plate for the instrument/plate-reader (e.g. a 96-well plate, 384, 1536, etc). This step is unnecessary if the cells are transfected directly in such a plate.
(105) After sufficient time to allow for expression (36 to 48 hr), cell media is aspirated off and washed with an assay buffer (e.g. a buffered saline solution).
(106) The order of addition of ligands or substrate can be determined by the experimenter, but in a general experiment a substrate for the luminescent enzyme is added and allowed to equilibrate in solution with the cells (optional). Test ligands are then added (single point or dose response) and either read in the plate-reader right away or after a pre-determined amount of time.
(107) Dose response curves can be analyzed using conventional pharmacological methods (e.g. three parameter logistic model) to estimate parameters such as efficacy (Emax) and potency (EC50) (
(108) The relative efficacies can be measured by comparing the net BRET values from the experiment above against a standard receptor/alpha/ligand (e.g. Neurotensin for most G proteins except for Gs isoforms (beta2-adrenergic receptor) or GGustducin (KOR)). Once normalized to these standards, a user-defined method of bias quantification can be used.
(109) In
(110) In
(111) For comprehensive transducerome profiling of understudied receptors (
(112) Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed invention belongs. Publications cited herein and the materials for which they are cited are specifically incorporated by reference.
(113) Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.