ENGINEERED BIOCATALYSTS FOR THE SYNTHESIS OF GAMMA-HYDROXY AMINO ACIDS

20250223619 ยท 2025-07-10

Assignee

Inventors

Cpc classification

International classification

Abstract

A DNA expression construct comprising a polynucleotide encoding an unnatural UstD enzyme, the unnatural enzyme itself, and a method of making gamma-hydroxy amino acids by contacting an aldehyde-containing substrate, an amino acid, and the unnatural, purified UstD enzyme under conditions and for a time sufficient to react at least a portion of the aldehyde-containing substrate with at least a portion of the amino acid, to yield a gamma-hydroxy amino acid product.

Claims

1. An unnatural, mutated UstD (Ustiloxin B biosynthesis protein D) enzyme having at least 90% sequence identity but less than 100% sequence identity to a wild-type UstD enzyme as shown in SEQ ID NO: 1.

2. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 1, wherein at least one residue selected from positions 122, 139, 227, 236, and 428, is not cysteine.

3. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ. ID. NO: 1, wherein the residue at position 122 is not cysteine.

4. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ. ID. NO: 1, wherein the residue at position 139 is not cysteine.

5. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ. ID. NO: 1, wherein the residue at position 227 is not cysteine.

6. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ. ID. NO: 1, wherein the residue at position 236 is not cysteine.

7. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ. ID. NO: 1, wherein the residue at position 428 is not cysteine.

8. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 5, 6, 7, 8, 9, 10, 11, 12, and 13.

9. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 4.

10. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 5.

11. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 6.

12. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 7.

13. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 8.

14. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 9.

15. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 10.

16. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 11.

17. The unnatural, mutated UstD enzyme of claim 1, wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 12.

18. The unnatural, mutated UstD enzyme of claim 1. wherein the unnatural, mutated UstD enzyme comprises an amino acid sequence as shown in SEQ ID NO: 13.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0014] FIG. 1 depicts a proposed mechanism of action for the enzyme UstD.

[0015] FIG. 2 is a scheme depicting a screening reaction for condition optimization and original reaction conditions. The histogram depicts a summary of iterative reaction condition optimization for UstD. Bar labels indicate change in conditions from previous iteration. Average apparent total turnover number (TTN) for each step is indicated above each bar. Maximum turnover number (TON) for a given step is given in parenthesis below the varied condition label. (See also FIGS. 6A, 6B, and 6C.)

[0016] FIG. 3 is a histogram depicting the increase in TTN of UstD through multiple rounds of mutagenesis. Values above the bar graph represent TTN observed (triplicate pending) for a given variant. The superscripts in the labels for each bar represent the UstD mutant usedi.e., how the UstD variant was mutagenized in region (I391-C392-L393) with respect to the wild-type sequence.

[0017] FIG. 4 shows non-limiting examples of suitable substrates for UstD. UstDWT was used for reactions. TTN values were calculated based on apparent conversion method, except for glycolaldehyde and pyruvate where comparison of reactions at two separate catalyst loadings followed by estimation was used.

[0018] FIG. 5A is a histogram depicting TTN for a variety of substrates. The aldehyde starting material for each reaction set is indicated. Reactions were conducted in parallel using the optimized reaction conditions described above. The figure demonstrates the general nature of the method disclosed herein and variant performance.

[0019] FIG. 5B depicts a histogram as in FIG. 5A using glycolaldehyde as the substrate. Here, unreacted starting material was not quantifiable, so the relative MS peak area (positive mode, 150 m/z) of the product as compared to wild-type is shown.

[0020] FIG. 6A is a graph depicting the apparent total turnover number (TTN) of the subject method as a function of PLP concentration.

[0021] FIG. 6B is a graph depicting the apparent total turnover number (TTN) of the subject method as a function of L-aspartate concentration.

[0022] FIG. 6C is a graph depicting the apparent total turnover number (TTN) of the subject method as a function of initial reaction pH.

[0023] FIG. 7 is a rendering of a homology model of the UstD active site with simulated docking of 4-bromo--hydroxy-homo-1-phenylalanine (gray) to PLP cofactor (yellow). Residue H148 is shown in magenta, and the four (4) residues mutagenized in the final saturation mutagenesis library are shown in cyan.

[0024] FIG. 8 is a representative sampling of various gamma-hydroxy amino acid products that have been made using the method disclosed herein. For all products, a product with the correct m/z was observed via UPLC-MS; no corresponding peak was observed in a no-enzyme (negative) control. Products in blue have been scaled to preparative levels. (See Examples section, below.) The structures of the compounds prepared at preparative scale have been confirmed by high-resolution MS and NMR to be diastereomerically pure.

[0025] FIG. 9 is a thermal ellipsoid crystal structure of 4-bromo-gamma-hydroxy-homo-L-phenylalanine. The structure confirms the conserved absolute configuration of stereocenters as compared to the native Ustiloxin B product.

[0026] FIG. 10 is an expanded proposed mechanism of UstD. The orange and red paths indicate shunt pathways. The pink and blue paths represent alternative on-path cycles.

[0027] FIGS. 11A, 11B, 11C, and 11D are histograms depicting turnover numbers of UstD through evolutionary trajectory on four different substrates. Dots represent individual measured values, bars represent average values of the dots for a given variant. All values were calculated using apparent conversion except for glycolaldehyde (FIG. 11D), which is calculated as the fold-product area against the average UstD.sup.WT area across the triplicate dataset. FIG. 11A depicts the results for benzaldehyde. FIG. 11B depicts the results for 4-biphenyl-carboxaldehyde. FIG. 11C depicts the results for 4-anisaldehyde. FIG. 11D depicts the results for glycoaldehyde.

DETAILED DESCRIPTION

Abbreviations and Definitions

[0028] As used herein, about will be understood by persons of ordinary skill in the art and will vary to some extent depending upon the context in which it is used. If there are uses of the term which are not clear to persons of ordinary skill in the art, given the context in which it is used, about will mean up to plus or minus 10% of the term or value so referenced.

[0029] The term alignment refers to a method of comparing two or more polynucleotides or polypeptide sequences for the purpose of determining their relationship to each other. Alignments are typically performed by computer programs that apply various algorithms. It is also possible to perform an alignment by hand. Alignment programs typically iterate through potential alignments of sequences and score the alignments using substitution tables, employing a variety of strategies to reach a potential optimal alignment score. Commonly-used alignment algorithms include, but are not limited to, CLUSTALW, (sec, Thompson J. D., Higgins D. G., Gibson T. J., CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice, Nucleic Acids Research 22: 4673-4680, 1994); CLUSTALV, (see, Larkin M. A., et al., CLUSTALW2, ClustalW and ClustalX version 2, Bioinformatics 23(21): 2947-2948, 2007); Jotun-Hein, Muscle et al., MUSCLE: a multiple sequence alignment method with reduced time and space complexity, BMC Bioinformatics 5:113, 2004); Mafft, Kalign, ProbCons, and T-Coffee (see Notredame et al., T-Coffee: A novel method for multiple sequence alignments, Journal of Molecular Biology 302: 205-217, 2000). Exemplary programs that implement one or more of the above algorithms include, but are not limited to MegAlign from DNAStar (DNAStar, Inc. Madison, WI, USA), MUSCLE, T-Coffee, CLUSTALX, CLUSTALV, JalView, Phylip, and Discovery Studio from Accelrys (Accelrys, Inc., San Diego, CA, USA). In a non-limiting example, MegAlign is used to implement the CLUSTALW alignment algorithm with the following parameters: Gap Penalty 10, Gap Length Penalty 0.20, Delay Divergent Seqs (30%) DNA Transition Weight 0.50, Protein Weight matrix Gonnet Series, DNA Weight Matrix IUB.

[0030] BEH=bridged ethylene hybrid.

[0031] The term contacting refers to the act of touching, making contact, or of bringing to immediate or close proximity, including at the molecular level, for example, to bring about a chemical reaction, or a physical change, e.g., in a solution or in a reaction mixture.

[0032] DMSO=dimethylsulfoxide.

[0033] ESI=electro-spray ionization.

[0034] FMOC=fluorenylmethyloxycarbonyl chloride.

[0035] Gene refers to a polynucleotide (e.g., a DNA segment), which encodes a polypeptide, and includes regions preceding and following the coding regions as well as intervening sequences (introns) between individual coding segments (exons).

[0036] The term homologous genes refers to a pair of genes from different but related species, which correspond to each other and which are identical or similar to each other. The term encompasses genes that are separated by the speciation process during the development of new species (orthologous genes), as well as genes that have been separated by genetic duplication (paralogous genes).

[0037] The term homologous sequences as used herein refers to a polynucleotide or polypeptide sequence having, for example, about 100%, about 99% or more, about 98% or more, about 97% or more, about 96% or more, about 95% or more, about 94% or more, about 93% or more, about 92% or more, about 91% or more, about 90% or more, about 88% or more, about 85% or more, about 80% or more, about 75% or more, about 70% or more, about 65% or more, about 60% or more, about 55% or more, about 50% or more, about 45% or more, or about 40% or more sequence identity to another polynucleotide or polypeptide sequence when optimally aligned for comparison. In certain versions of the genes and proteins described herein, homologous sequences can retain the same type and/or level of a particular activity of interest. In some versions, homologous sequences have between 85% and 100% sequence identity, whereas in other versions there is between 90% and 100% sequence identity. In particular embodiments, there is between 95% and 100% sequence identity.

[0038] Homology refers to sequence similarity or sequence identity. Homology is determined using standard techniques known in the art. (See, for example, Smith and Waterman, Adv. Appl. Math., 2:482, 1981; Needleman and Wunsch, J. Mol. Biol., 48:443, 1970; Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:2444, 1988. See also programs such as GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group, Madison, WI, USA); and Devereux et al., Nucl. Acid Res., 12:387-395, 1984.) A non-limiting example includes the use of the BLAST program (Altschul et al., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402, 1997) to identify sequences that can be said to be homologous. A recent version such as version 2.2.16, 2.2.17, 2.2.18, 2.2.19, or the latest version, including sub-programs such as blastp for protein-protein comparisons, blastn for nucleotide-nucleotide comparisons, tblastn for protein-nucleotide comparisons, or blastx for nucleotide-protein comparisons, and with parameters as follows: Maximum number of sequences returned 10,000 or 100,000; E-value (expectation value) of 1e-2 or 1e-5, word size 3, scoring matrix BLOSUM62, gap cost existence 11, gap cost extension 1, may be suitable. An E-value of 1e-5, for example, indicates that the chance of a homologous match occurring at random is about 1 in 10,000, thereby marking a high confidence of true homology.

[0039] The term host strain or host cell refers to a suitable host for an expression vector comprising a DNA of the present invention.

[0040] The term hybridization refers to the process by which a strand of polynucleotide joins with a complementary strand through base pairing, as known in the art. A polynucleotide sequence is selectively hybridizable to a reference polynucleotide sequence if the two sequences specifically hybridize to one another under moderate to high stringency hybridization and wash conditions. Hybridization conditions are based on the melting temperature (T.sub.m) of the polynucleotide binding complex or probe. For example, maximum stringency typically occurs at about T.sub.m5 C. (that is, 5 C. below the T.sub.m of the probe); high stringency at about 5-10 C. below the T.sub.m; intermediate stringency at about 10-20 C. below the T.sub.m of the probe; and low stringency at about 20-25 C. below the T.sub.m. Functionally, maximum stringency conditions may be used to identify sequences having strict identity or near-strict identity with the hybridization probe; while an intermediate or a low stringency hybridization can be used to identify or detect polynucleotide sequence homologs. Moderate and high stringency hybridization conditions are well known in the art. An example of high stringency conditions includes hybridization at about 42 C. in 50% formamide, 5SSC, 5Denhardt's solution, 0.5% SDS and 100 pg/mL denatured carrier DNA followed by washing two times in 2SSC and 0.5% SDS at room temperature and two additional times in 0.1SSC and 0.5% SDS at 42 C. An example of moderate stringent conditions includes an overnight incubation at 37 C. in a solution comprising 20% formamide, 5SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5Denhardt's solution, 10% dextran sulfate and 20 mg/mL denaturated sheared salmon sperm DNA, followed by washing the filters in 1SSC at about 37 C. to about 50 C. Those of skill in the art know how to adjust the temperature, ionic strength, and other conditions as necessary to accommodate factors such as probe length and the like.

[0041] IPTG=Isopropyl -D-1-thiogalactopyranoside.

[0042] The term isolated or purified means a material that is removed from its original environment, for example, the natural environment if it is naturally occurring, or a fermentation broth if it is produced in a recombinant host cell fermentation medium. A material is said to be purified when it is present in a composition in a higher or lower concentration than the concentration that exists prior to the purification step(s). For example, with respect to a composition normally found in a naturally occurring or wild type organism, such a composition is purified when the final composition does not include some material from the original matrix. As another example, where a composition is found in combination with other components in a recombinant host cell fermentation medium, that composition is purified when the fermentation medium is treated in a way to remove some component of the fermentation, for example, cell debris or other fermentation products through, for example, centrifugation or distillation. As another example, a naturally occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated from some or all of the coexisting materials in the natural system, is isolated, whether such process is through genetic engineering or mechanical separation. Such polynucleotides can be parts of vectors. Alternatively, such polynucleotides or polypeptides can be parts of compositions. Such polynucleotides or polypeptides can be considered isolated because the vectors or compositions comprising thereof are not part of their natural environments. In another example, a polynucleotide or protein is said to be purified if it gives rise to essentially one band in an electrophoretic gel or a blot.

[0043] LOOCV=leave-one-out cross-validation.

[0044] NMR=nuclear magnetic resonance spectrometry.

[0045] nsAAs=non-standard amino acids.

[0046] The term operationally linked and operably linked are synonymous and, in the context of a polynucleotide sequence, refer to the placement of one polynucleotide sequence into a functional relationship with another polynucleotide sequence. For example, a DNA encoding a secretory leader (e.g., a signal peptide) is operably linked to a DNA encoding a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide. A promoter or an enhancer is operably linked to a coding sequence if it affects the transcription of the sequence. A ribosome binding site is operably linked to a coding sequence if it is positioned to facilitate translation. Operably linked does not require that the DNA sequences so linked are contiguous (although that is often the case).

[0047] PDA=photodiode array.

[0048] The terms percent sequence identity, percent amino acid sequence identity, percent gene sequence identity, and/or percent polynucleotide sequence identity, with respect to two polypeptides, polynucleotides and/or gene sequences (as appropriate), refer to the percentage of residues that are identical in the two sequences when the sequences are optimally aligned. Thus, 80% amino acid sequence identity means that 80% of the amino acids in two optimally aligned polypeptide sequences are identical.

[0049] PLP=pyridoxal 5-phosphate.

[0050] In general, substituted refers to an organic group as defined below (e.g., an alkyl group) in which one or more bonds to a hydrogen atom contained therein are replaced by a bond to non-hydrogen or non-carbon atoms. Substituted groups also include groups in which one or more bonds to a carbon(s) or hydrogen(s) atom are replaced by one or more bonds, including double or triple bonds, to a heteroatom. Thus, a substituted group is substituted with one or more substituents, unless otherwise specified. In some embodiments, a substituted group is substituted with 1, 2, 3, 4, 5, or 6 substituents. Examples of substituent groups include: halogens (i.e., Cl. F, Br, and I); hydroxyls; alkoxy, alkenoxy, aryloxy, aralkyloxy, heterocyclyloxy, and heterocyclylalkoxy groups; carbonyls (oxo); carboxyls; esters; urethanes; oximes; hydroxylamines; alkoxyamines; aralkoxyamines; thiols; sulfides; sulfoxides; sulfones; sulfonyls; sulfonamides; amines; N-oxides; hydrazines; hydrazides; hydrazones; azides; amides; ureas; amidines; guanidines; enamines; imides; isocyanates; isothiocyanates; cyanates; thiocyanates; imines; nitro groups; nitriles (i.e., CN); and the like.

[0051] TON=maximum turnover number.

[0052] TTN=apparent total turnover number.

[0053] TLC=Thin-layer chromatography

[0054] UPLC-MS=ultra-high-pressure liquid chromatography-mass spectrometry.

[0055] Numerical ranges as used herein are intended to include every number and subset of numbers contained within that range, whether specifically disclosed or not. That is, for all purposes, and particularly in terms of providing a written description, all ranges disclosed herein also encompass any and all possible subranges and combinations of subranges thereof. Any listed range can be easily recognized as sufficiently describing and enabling the same range being broken down into at least equal halves, thirds, quarters, fifths, tenths, etc. As a non-limiting example, each range discussed herein can be readily broken down into a lower third, middle third and upper third, etc. As will also be understood by one skilled in the art all language such as up to, at least, greater than, less than, and the like include the number recited and refer to ranges which can be subsequently broken down into subranges as discussed above. Finally, as will be understood by one skilled in the art, a range includes each individual member. Thus, for example, a group having 1-3 atoms refers to groups having 1, 2, or 3 atoms. Similarly, a group having 1-5 atoms refers to groups having 1, 2, 3, 4, or 5 atoms, and so forth.

[0056] The methods of the present invention can comprise, consist of, or consist essentially of the essential elements and limitations of the method, molecules, and constructs described herein, as well as any additional or optional ingredients, components, or limitations described herein or otherwise useful in synthetic organic chemistry.

[0057] Generally, reference to a certain element such as hydrogen or H is meant to include all isotopes of that element. For example, if an R group is defined to include hydrogen or H, it also includes deuterium and tritium. Compounds comprising radioisotopes such as tritium, C.sup.14, p.sup.32 and S.sup.35 are thus within the scope of the present technology. Procedures for inserting such labels into the compounds of the present technology will be readily apparent to those skilled in the art based on the disclosure herein.

[0058] Compounds disclosed herein may exhibit the phenomena of tautomerism, conformational isomerism, geometric isomerism and/or stereoisomerism. As the formula drawings within the specification and claims can represent only one of the possible tautomeric, conformational isomeric, stereochemical, or geometric isomeric forms, it should be understood that the present method encompasses any tautomeric, conformational isomeric, stereochemical and/or geometric isomeric forms of the compounds having one or more of the utilities described herein, as well as mixtures of these various different forms.

[0059] Tautomers refers to isomeric forms of a compound that are in equilibrium with each other. The presence and concentrations of the isomeric forms will depend on the environment the compound is found in and may be different depending upon, for example, whether the compound is a solid or is in an organic or aqueous solution. For example, in aqueous solution, quinazolinones may exhibit the following isomeric forms, which are referred to as tautomers of each other:

##STR00001##

[0060] Because of the limits of representing compounds by structural formulas, it is to be understood that all chemical formulas of the compounds described herein represent all tautomeric forms of compounds and are within the scope of the present technology.

[0061] Stereoisomers of compounds (also known as optical isomers) include all chiral, diastereomeric, and racemic forms of a structure, unless the specific stereochemistry is expressly indicated. Thus, compounds used and made using the present method include enriched or resolved optical isomers at any or all asymmetric atoms as are apparent from the depictions (including enantiomers, diasteromers, and atropisomers). Racemic and diastereomeric mixtures, as well as the individual optical isomers can be enriched in any proportion or isolated or synthesized to be substantially free of their enantiomeric or diastereomeric partners, and these stereoisomers and atropisomers are all within the scope of the present disclosure.

[0062] All references to singular characteristics or limitations of the present invention shall include the corresponding plural characteristic or limitation, and vice-versa, unless otherwise specified or clearly implied to the contrary by the context in which the reference is made. That is, unless specifically stated to the contrary, a and an mean one or more. The phrase one or more is readily understood by one of skill in the art, particularly when read in context of its usage. For example, one or more substituents on a phenyl ring designates one to five substituents.

[0063] All combinations of method or process steps as used herein can be performed in any order, unless otherwise specified or clearly implied to the contrary by the context in which the referenced combination is made.

Expression and Characterization of UstD

[0064] A C-terminally 6His-tagged, codon-optimized sequence of UstD from A. flavus was cloned into the IPTG controlled pET-22b (+) vector and transformed into BL21(DE3) E. coli. (New England BioLabs, Inc., Ipswich, MA, USA, hereinafter NEB). Recombinant expression of UstD in Terrific Broth II (TB) media (Thomas Scientific Swedesboro, NJ, USA) followed by harvest, lysis, and Ni-NTA affinity chromatography purification afforded a biocatalyst yield of 8 mg/L TB. To test the activity of UstD, reactions were conducted using benzaldehyde as the target aldehyde starting material. This aldehyde was used as a general substrate for initial testing because the native Ustiloxin B precursor was not readily available. Product formation was assayed by UPLC-MS, and catalyst activity was calculated by dividing the product absorption peak area at 210 nm by the sum of the product and unreacted starting material peak area. This value was then multiplied by the maximum turnover number achievable for the given reaction to determine the apparent total turnover number (TTN). Under initial reaction conditions (see FIG. 2), UstD was able to catalyze the conversion of benzaldehyde to the corresponding -hydroxy amino acid with a TTN of 120. It was suspected that sub-optimal reaction conditions could be playing a role in the low catalytic activity, so a series of reaction condition optimization experiments were conducted.

[0065] To begin the optimization process, it was tested whether the presence of additional PLP in the reaction mixture affected the TTN of a reaction with 1:1 L-aspartate and benzaldehyde. It was reasoned that the PLP cofactor was potentially being destroyed during the reaction process because the catalytic reactions with benzaldehyde became colorless, while control reactions in the absence of enzyme remained yellow after 16 h. All reactions were done in triplicate to ensure consistency. A large boost in activity was observed with increasing concentrations of PLP, with an almost 40-fold increase in TTN at 50-fold PLP relative to UstD concentration. See FIG. 2, second bar from left. See also FIG. 6A. This large increase in TTN indicates that PLP was degraded during the reaction, though the precise origin of this degradation pathway is unknown.

[0066] Next, the amount of L-aspartate was varied to see if further improvements could be observed with the increased PLP concentration. A further doubling in TTN was observed at 10-fold aspartate relative to benzaldehyde concentration. (Data not shown; TTN data for 4-fold aspartate relative to benzaldehyde concentration is shown in FIG. 2, third bar from left.) See also FIG. 6B.

[0067] Finally, a pH profile was generated to find the optimal initial pH for reactivity. It was found that a pH of 7.0 provided an additional modest boost in activity, with the final optimized reaction conditions resulting in a maximum TTN of almost 8800. See FIG. 2, far right bar and FIG. 6C. These reaction conditions were used for all further preparative scale reactions with wild-type UstD. A similar optimization procedure can also be performed for variants of UstD to optimize yield.

Directed Evolution of UstD for Improved Catalytic Function

[0068] With optimized reaction conditions in hand, efforts were shifted toward engineering UstD for improved activity. Methods used to screen UstD for activity are described in further detail in the examples below. Reaction conditions for screening were chosen to mimic idealized conditions, such as a 1:1 benzaldehyde:L-aspartate ratio for increased coupling efficiency. For the first round of engineering, a series of homology models of UstD was generated using the I-TASSER and SwissModel web services. See the following references Yang, J. et al. The I-TASSER Suite: protein structure and function prediction, Nat. Methods 12, 7-8 (2015). Roy, A., Kucukural, A. & Zhang, Y. I-TASSER: a unified platform for automated protein structure and function prediction, Nat. Protoc. 5, 725-738 (2010). Waterhouse, A. et al. SWISS-MODEL: homology modelling of protein structures and complexes, Nucleic Acids Res. 46, W296-W303 (2018). Guex, N., Peitsch, M. C. & Schwede, T. Automated comparative protein structure modeling with SWISS-MODEL and Swiss-PdbViewer: A historical perspective, Electrophoresis 30, S162-S173 (2009). See FIG. 7 for the resulting homology model. These models were used to guide targeting efforts for saturation mutagenesis of residues predicted to be near the putative active site of the enzyme. The model predicts that D232 is involved in hydrogen bonding to the pyridine nitrogen of the PLP cofactor. The protonation state of the pyridine nitrogen likely plays an important role in stabilizing the formed enamine intermediate. Thus mutations at D232 were expected to cause large changes in the activity of the enzyme. Indeed, all mutations observed at this position abolished activity of the biocatalyst. H148 was also predicted to be a -stacking partner for the cofactor, and likely represents the residue which protonates the nascent oxyanion to form an alcohol in the product. While a small quantity of variants appeared to be moderately tolerated at this position, no variants led to an increase in activity. Four additional residues near the putative active site (A55, G84, Y257, C392) were also selected for saturation mutagenesis. Of these positions, one variant (C392L, UstD.sup.ILL) was discovered with a 2.3-fold boost in observed activity relative to wild-type UstD (UstD.sup.WT). See FIG. 3. In tandem with these saturation libraries, a global random mutagenesis library was generated. Serendipitously, an activated variant (L393M, UstD.sup.ICM) was made and which displays a 2.7-fold boost in activity. The L393 residue neighbors the previously identified C392L position. It was hypothesized that these variants could exhibit a high degree of cooperativity when combined, and so the double variant (UstD.sup.ILM) was generated. (Again, see FIG. 3.) Indeed, the double variant exhibited a 3.9-fold boost in activity relative to wild-type UstD. This seemed to indicate that this predicted loop region could be amiable to mutations and warranted further exploration.

[0069] A four-position degenerate-codon library including the residues which flank the C392 and L393 positions (I391, A394) was constructed to explore the mutational landscape of the region. Mutations resulting in primarily hydrophobic variants were selected, as the homology model predicted the putative loop region to be buried in the interior of the enzyme. For residue I391, a wide variety of possible variants were incorporated in the library to explore a diverse landscape. Residue A394 is predicted to be at the beginning of an alpha helix, so residues targeted towards exploring flexibility in the loop region were tested. Of note, mutations at C392 were chosen to omit the original residue identity. This was done in order to avoid the formation of cysteine sulfinic acid near the active site, which would result in potential heterogeneity in the biocatalyst state over the course of a reaction. A wide variety of activated variants were revealed using this targeted library, all of which retaining the identity of A394. Of the sequenced hits, two variants were chosen for further study, I391T-C392L-L393M (UstD.sup.TLM) and I391F-C392V-L393F (UstD.sup.FVF). UstD.sup.TLM represented the variant with the largest increase in activity observed during screening, while UstD.sup.FVF was chosen for its diversity in variant composition. It was determined that FVF bore a 4.3-fold boost in activity relative to wild-type UstD, while TLM resulted in a 7.7-fold boost. See FIG. 3.

[0070] Thus, as compared to the wild-type protein, these unnatural, mutated proteins have the following amino acid sequences: [0071] C392L=UstD.sup.ILL SEQ. ID. NO: 4 (2.3 better than wt) [0072] L393M=UstD.sup.ICM SEQ. ID. NO: 5 (2.7 better than wt) [0073] C392L-L393M=UstD.sup.ILM SEQ. ID. NO: 6 (3.9 better than wt) [0074] I391F-C392V-L393F=UstD.sup.FVF SEQ. ID. NO: 7 (4.3 better than wt) [0075] I391T-C392L-L393M=UstD.sup.TLM SEQ. ID. NO: 8 (7.7 better than wt)

[0076] The inventors have found that UstD is able to catalyze the formation of a wide variety of -hydroxy amino acids, the vast majority of which show the formation of only a single diastereomer. See FIGS. 4 and 8. FIG. 4 shows non-limiting examples of suitable substrates for UstD. The wild-type enzyme was used for reactions shown in FIG. 4 and TTN values were calculated based on apparent conversion method, except for glycolaldehyde and pyruvate where comparison of reactions at two separate catalyst loadings followed by estimation was used. FIG. 8 shows a sampling of various gamma-hydroxy amino acid products that have been made using the method disclosed herein. These range from sterically demanding aryl aldehydes (biphenyl-4-carboxaldehyde) to electronically deactivated aryl aldehydes (4-hydroxybenzaldehyde) to aliphatic aldehydes (glycolaldehyde.) See FIGS. 5A and 5B. FIG. 5A depicts TTNs for the reaction using UstD.sup.WT, UstD.sup.ILM, UstD.sup.FVF, and UstD.sup.TLM enzymes and the substrates/reactants biphenyl-4-carboxaldehyde, 4-methoxybenzaldehyde, and 2-methylbenzaldehyde. FIG. 5B shows corresponding results using glycoaldehyde as the substrate/reactant.

[0077] A reaction with 4-bromobenzaldehyde was done at preparative scale to produce 50 mg of product:

##STR00002##

The corresponding amino acid product was crystallized, and small molecule crystallographic studies revealed the product retains the same absolute configuration as the native Ustiloxin B product. FIG. 9 depicts the 3D ball-and-stick model of the amino acid product. While a majority of the substrate scope exploration was done with the wild-type enzyme, early studies have shown that the increases in activity are general. Of note, both UstD.sup.ILM and UstD.sup.TLM have much higher TTNs for catalyzing a reaction with 4-methoxybenzaldehyde than does UstD.sup.WT. Additionally, TTNs for reactions with biphenyl-4-carboxalehyde did not decrease, as one might have expected with a more sterically crowded catalyst such as UstD.sup.FVF. These results show that UstD is engineerable as a generalized diastereoselective biocatalyst.

EXAMPLES

[0078] The following examples are included herein solely to provide a more complete description of the methods and materials disclosed herein. The examples are not intended to limit the scope of the claims in any way.

General Materials and Methods

[0079] All chemicals and reagents were purchased from various international commercial suppliers at the highest quality available and used without further purification. These suppliers were Sigma-Aldrich Corporation (St. Louis, MO, USA), VWR International, LLC (Radnor, PA, USA), Chem-Impex International, Inc. (Wood Dale, IL, USA), Alfa Aesar (Tewksbury, MA, USA), and Combi-Blocks Inc. (San Diego, CA, USA). E. coli cells were electroporated with an Eppendorf E-porator at 2500 V. New Brunswick I26R shaker incubators (Eppendorf) were used for cell growth. (Eppendorf North America, Hauppauge, NY, USA). Cell disruption via sonication was performed with a Sonic Dismembrator 550 sonicator (Thermo Fisher Scientific, Waltham, MA, USA). Optical density and UV-vis spectroscopic measurements were collected on a UV-2600 Shimadzu spectrophotometer. (Shimadzu Corporation, Kyoto, Japan.) UPLC-MS data were collected on an Acquity-brand UPLC equipped with an Acquity-brand PDA and QDa-brand MS detector using a using either a BEH C18 column for substituted benzaldehyde reactions (all from Waters Corporation, Millford, MA, USA), or an Intrada Amino Acid column (Imtakt USA, Inc., Portland, OR, USA) for aliphatic aldehyde reactions. Preparative column separations were performed on an Isolera One Flash Purification system (Biotage, Uppsala, Sweden). NMR data were collected on Bruker 400 or 500 MHz spectrometers. (Bruker Corporation, Billerica, MA, USA.) High-resolution mass spectrometry data were collected with a Q Extractive Plus Orbitrap instrument (NIH 1S10OD020022-1) (ThermoFisher Scientific) with samples ionized by ESI.

Cloning of Wild-Type UstD

[0080] A codon-optimized copy of the Aspergillus flavus UstD gene was purchased as a gBlock-brand, double-stranded DNA from Integrated DNA Technologies, Coralville, Iowa, USA (hereinafter IDT). This DNA fragment was inserted into a pET-22b(+) vector by the Gibson Assembly method (Codex DNA, Inc., San Diego, California) and transformed into electrocompetent BL21(DE3) E. coli cells via electroporation. (Gibson, D. G. et al. Enzymatic assembly of DNA molecules up to several hundred kilobases. Nat. Methods 6, 343-345 (2009).) After a 30-minute recovery period in Luria-Burtani (LB) media, cells were plated onto LB plates containing 100 g/mL ampicillin (LB.sub.amp) and incubated overnight. A single colony was then used to inoculate 50 mL of Terrific Broth II media containing 100 g/mL ampicillin (TB.sub.amp), which was then incubated overnight at 37 C. with shaking at 200 rpm. 500 L of the saturated cell culture was then mixed with 500 L of sterile 80% glycerol and snap-frozen in liquid nitrogen to generate a glycerol stock.

Protein and DNA Sequences

[0081] The protein sequence of UstD (Uniprot accession code: XP_002381324.1) is:

TABLE-US-00001 (SEQ.ID.NO:1) MKSVATSSLDDVDKDSVPLGSSINGTAQAETPLENVIDVE SVRSHFPVLGGETAAFNNASGTVVLKEAIESTSNFMYSFP FPPGVDAKSMEAITAYTGNKGKVAAFINALPDEITFGQST TCLFRLLGLSLKPMLNNDCEIVCSTLCHEAAASAWIHLSR ELGITIKWWSPTTTPNSPDDPVLTTDSLKPLLSPKTRLVT CNHVSNVVGTIHPIREIADVVHTIPGCMLIVDGVACVPHR PVDVKELDVDFYCFSWYKLFGPHLGTLYASRKAQDRYMTS INHYFVSSSSLDGKLALGMPSFELQLMCSPIVSYLQDTVG WDRIVRQETVLVTILLEYLLSKPSVYRVFGRRNSDPSQRV AIVTFEVVGRSSGDVAMRVNTRNRFRITSGICLAPRPTWD VLKPKSSDGLVRVSFVHYNTVEEVRAFCSELDEIVTRDT

[0082] The DNA sequence of UstD (codon optimized using IDT Codon Optimization Tool (IDT), bearing a flanking Gibson Assembly insertion site (Codex DNA. Inc., San Diego, California) and C-terminal 6xHis-Tag sequences is:

TABLE-US-00002 (SEQ.ID.NO:2) GTTTAACTTTAAGAAGGAGATATACATATGAAGAGCGTAGCGACG AGTTCCCTTGATGACGTAGATAAAGATTCCGTCCCCCTGGGCAGT TCGATCAATGGCACTGCACAAGCGGAAATCCGCTGGAGAATGTGA TCGACGTCGAATCAGTGCGCTCACATTTCCCGGTATTAGGGGGGG AAACGGCCGCGTTTAACAATGCATCAGGAACCGTAGTTTTGAAGG AGGCAATTGAATCGACTTCAAATTTCATGTATAGCTTTCCTTTTC CCCCGGGTGTTGACGCTAAGTCAATGGAGGCTATTACCGCATATA CGGGGAATAAGGGCAAGGTTGCGGCATTTATCAATGCACTTCCTG ATGAAATTACATTCGGGCAGTCCACAACTTGTCTGTTCCGTTTAT TAGGTCTGTCGCTTAAACCTATGCTGAATAACGATTGTGAAATCG TATGCTCAACATTATGTCACGAAGCAGCAGCTTCCGCATGGATTC ATTTAAGTCGCGAATTAGGAATTACCATTAAGTGGTGGAGCCCAA CTACTACACCGAATAGTCCCGATGATCCAGTTCTGACGACTGACT CATTGAAGCCCTTGCTTAGTCCAAAAACGCGCCTTGTTACATGTA ATCACGTGTCGAATGTTGTAGGAACCATCCACCCTATTCGTGAGA TTGCCGACGTGGTACATACCATTCCTGGATGCATGCTTATCGTTG ACGGTGTGGCATGTGTCCCGCATCGTCCAGTTGATGTTAAAGAAT TGGATGTAGATTTTTACTGCTTTTCCTGGTACAAGTTGTTCGGAC CGCATCTTGGAACCCTGTATGCTTCCCGCAAAGCCCAAGACCGCT ATATGACCTCAATTAACCATTACTTCGTCTCATCGTCGAGCCTTG ATGGTAAGCTGGCATTAGGCATGCCGTCCTTTGAACTGCAGTTGA TGTGCTCTCCAATTGTTTCGTATTTGCAAGATACGGTGGGCTGGG ACCGTATCGTGCGCCAAGAGACTGTGCTGGTAACTATTTTGTTGG AGTATTTACTTAGCAAGCCATCTGTATATCGTGTGTTCGGACGTC GTAATTCTGATCCCAGTCAGCGTGTAGCAATCGTAACTTTTGAAG TCGTGGGACGTAGTTCCGGGGATGTGGCAATGCGCGTAAATACGC GTAATCGCTTCCGCATTACCTCTGGAATTTGCCTGGCACCGCGCC CGACATGGGACGTCTTGAAACCGAAGAGTAGCGACGGACTTGTTC GCGTCAGCTTTGTACATTACAACACGGTTGAGGAAGTGCGTGCGT TCTGCAGCGAGTTAGACGAGATTGTGACACGCGACACCCTCGAGC ACCATCACCATCACCATTGAGATCCGGCTGC (Boldunderlinedresiduesshowthestartcodon andthe6XHistag.Theencodedproteinis showninSEQ.ID.NO:3.)

Production of UstD Degenerate Codon Libraries

[0083] Saturation mutagenesis libraries were generated using the 22-codon trick. (Kille et al. Reducing Codon Redundancy and Screening Effort of Combinatorial Protein Libraries Created by Saturation Mutagenesis, ACS Synth. Biol. 2013, 2, 2, 83-92 (Jun. 15, 2012).) Reactions were assembled by adding the following to a PCR tube: 32 L H.sub.2O, 10 L 5 Phusion-brand GC buffer (NEB), 1 L 10 mM dNTP mix, 1 L 10 M forward primer mix, 1 L 10 M reverse primer, 1 L100 ng/L parent plasmid, 0.5 L Phusion-brand polymerase (NEB). Reaction annealing temperatures were varied between libraries to optimize amplification.

Production of UstD Random Mutagenesis Libraries

[0084] Random mutagenesis was carried out via error-prone PCR. Reaction conditions were optimized to generate 1-2 codon mutations per plasmid. Reactions were assembled by adding the following to a PCR tube: 32 L H.sub.2O, 5 L 10 Taq buffer (NEB), 1 L 10 mM dNTP mix, 1 L 10 M internal forward primer, 1 L 10 M internal reverse primer, 1 L100 ng/L parent plasmid, 6.5 L 50 mM MgCl.sub.2, 2.5 L 1 mM MnCl.sub.2, 1 L DMSO, 0.5 L Taq polymerase (NEB). Reactions were carried out in a thermocycle at 55 C. for an annealing temperature.

Linear Regression Model Guided Cysteine Shuffle Library Production

[0085] Sequence alignment and homology modeling were used to target five cysteines which were predicted to be on the surface of UstD and were predicted to be amiable to mutagenesis. A degenerate codon library of the following design was created using polymerase cycling assembly:

TABLE-US-00003 Position Degenerate Codon Possible Amino Acids C122 KBC A, C, G, F, S, V C139 TSC C, S C227 KSC A, C, G, S C236 TSK C, S, W C428 KSC A, C, G, S

See SEQ. ID. NO: 14.

[0086] Transformation and screening were conducted for two plates (180 maximum possible variants) as described above, where three control wells were present for UstD.sup.TLM and UstD.sup.WT each and UstD.sup.TLM was treated as the parent enzyme for the plate for relative fold activity calculation. One glycerol stock plate of each screened plate was sent for sequencing (Functional Biosciences, Madison, WI, USA), and the resulting sequencing data were analyzed using SnapGene-brand software (GSL Biotech LLC, Chicago, IL USA) for sequencing integrity and complete sequencing of all variant positions for each well. Of the 192 wells (including controls), 111 successful reads were obtained with 98 unique sequences. Sequences were stored by concatenating the identity of each position mutated in the library, such that the parent sequence is represented as CCCCC. That is, the wt protein has a cysteine residue at all of positions 122, 139, 227, 236, and 428. Any mutation at any of those five positions is indicated by the appropriate one-letter amino acid code. The resulting sequences were paired with their corresponding relative fold-activity values in a.csv file. All data analysis at this stage was conducted using Python-brand software (Python Software Foundation, Beaverton, OR, USA) version 3.6.8 with the Scikit-Learn 0.20.3 package (Institute National de Recherche en Informatique et en Automatique, Le Chesnay, France and Telecom Paris Tech, Paris, France). The analysis workflow was conducted as follows: [0087] 1. Filter all sequence-activity pairings which have an activity less that 0.1 (79 pairings removed, 32 remained) [0088] 2. Take the negative log of all activity values [0089] 3. One-hot encode all remaining sequences [0090] 4. Perform leave-one-out cross-validation (LOOCV) linear regression modelling to ensure model integrity [0091] 5. Fit linear regression model to all data [0092] 6. Construct all possible sequences reachable from the filtered sequence space, and one-hot encode each [0093] 7. Generate activity predictions for all possible sequences within the sequence space [0094] 8. Take the exponential of all negative activities [0095] 9. Sort by predicted relative fold-activity

[0096] From this dataset, two sequences bearing three mutated cysteines (UstD.sup.TLM-ACASC and UstD.sup.TLM-ASCSC) and one sequence bearing four mutated cysteines (UstD.sup.TLM-ASASC) were chosen for cloning and expression.

[0097] These genes were generated from a lower activity sequence found during screening (UstD.sup.TLM-ACASC) using PCA, and were tested in both whole cell catalyst and purified catalyst analytical scale reactions against UstD.sup.TLM and the top hit from the screened plates (UstD.sup.TLM-ACASC). Protein expression yields were determined by standard Bradford assay techniques.

TABLE-US-00004 Purified mg Protein/L Protein Whole Cell Variant Culture Fold-Activity Fold-Activity UstD.sup.TLM 8 1.0 1.0 UstD.sup.TLM-SCASC 48 0.7 1.4 UstD.sup.TLM-ASASC 33 0.6 1.3 UstD.sup.TLM-ACASC 48 0.7 2.4 UstD.sup.TLM-ASCSC 40 0.7 1.6
For clarity, these unnatural, isolated, mutated proteins contain the following mutations relative to the wild-type: [0098] UstD.sup.TLM-ACASC: I391T-C392L-L393M-C122A-C227A-C236S (SEQ. ID. NO: 9) [0099] UstD.sup.TLM-ACASC: I391T-C392L-L393M-C122A-C139S-C236S (SEQ. ID. NO: 10) [0100] UstD.sup.TLM-ACASC: I391T-C392L-L393M-C122A-C139S-C227A-C236S (SEQ. ID. NO: 11) [0101] UstD.sup.TLM-ACASC: I391T-C392L-L393M-C122A-C139S-C227A (SEQ. ID. NO: 12) [0102] UstD.sup.TLM-SCASC: I391T-C392L-L393M-C122S-C227A-C236S (SEQ. ID. NO: 13)

UstD Variant Library Screening

[0103] Library DNA pools were transformed into electrocompetent E. coli BL21(DE3) cells using standard electroporation techniques. The resulting transformed mixture was then plated on LB agar plates containing 100 g/mL ampicillin and allowed to grow for 16 h. Starter culture plates were made by adding 600 L of TB.sub.amp to each well of sterile 96-deep-well plates (2 mL well volume). Column 6 of each plate was used as a control column, where three wells were inoculated with individual colonies of E. coli harboring a pET-22b(+) plasmid encoding the parent variant of the library. An additional three wells were inoculated with E. coli harboring pET-22b(+) plasmids encoding a random enzyme of distinct function from UstD. The final two wells, typically at the center of the plate, were left uninoculated and serve as sterile controls to confirm there was no general contamination of the plate or well-to-well contamination. The plates were then covered with a loose plastic 96-well plate cover. The plates were then incubated overnight in a 37 C. shaker incubator at 200 rpm. Glycerol stock plates were made in duplicate for each overnight culture plate by adding 100 L of each well to a 350 L plate, followed by 100 L of sterile 50% glycerol with mixing by repeated pipetting. Glycerol stock plates were stored at 80 C. Expression plates were made by adding 600 L of TB.sub.amp to each well of sterile 96-deep-well plates, and 5 L of the overnight starter plates were transferred to matching wells in the expression plates. These plates incubated for 2 h at 37 C. in a shaker incubator at 200 rpm. The plates were then transferred to an ice bed and incubated for an additional 30 min. Protein expression was induced by adding 33 L of 1 mM IPTG dissolved in TB.sub.amp to each well, and the plates were transferred to a 20 C. shaker incubator at 200 rpm and incubated for 16 h. The plates were then spun down at 5000g for 30 min to pellet cells, and the supernatant was discarded. The cells were then resuspended in 400 L of lysis buffer containing: 100 mM potassium phosphate buffer pH 7.0, 100 mM sodium chloride, 500 M PLP, 2 mM MgCl.sub.2, 1 mg/mL lysozyme, and 0.01 mg/mL DNase. Lysis was conducted in a 37 C. incubator for 1 h before the plates were spun down at 5000g for 30 min. Reaction plates were created by transferring a small amount (150-300 L, depending on expected activity per well) to sterile 96-deep-well plates, and a reaction master mix was added to each well so that the final concentration of reaction components was: 5% DMSO, 25 mM L-aspartate, 25 mM benzaldehyde. The plates were then sealed with a rubber gasket to prevent evaporation, and the plates were incubated at 37 C. for 16 h. An equal volume to the end well volumes of acetonitrile was added to each well of the reaction plates, and the plates were gently vortexed to facilitate mixing. The plates were then spun down at 5000g, and 250 L of supernatant from each well was transferred to a 96-well filter plate placed on top of a 96-well LC-MS sample plate. The plates were spun at 1000g to filter the supernatants of any large particles, and the LC-MS plates were sealed with a plastic cover. The plates were then analyzed by UPLC-MS as per analytical scale reactions. Relative fold-activity quantification was calculated by dividing the observed product 210 nm peak area or 197.00 m/z MS-SIR peak area by the average parent control well area for the same plate.

Expression and Purification of UstD

[0104] An overnight culture was created by inoculating 50 mL of TB.sub.amp media with a single colony of freshly transformed E. coli BL21(DE3) harboring a pET-22b(+) plasmid encoding the enzyme variant, as described above. This culture was shaken at 37 C. and 200 rpm for roughly 16 h. 10 mL of overnight culture was then used to inoculate 1 L of TB.sub.amp, which was shaken at 37 C. and 200 rpm for approximately 1.5 h or until an optical density (600 nm) of 0.4-0.6 was reached. Cultures were cooled on ice for 30 min and then induced by adding IPTG to a final concentration of 50 M. The cultures were allowed to continue to grow for an additional 16 h at 20 C. and shaking at 200 rpm. Cells were then harvested by centrifugation (4 C., 30 min, 4,000g), and the cell pellets were stored at 20 C. overnight.

[0105] To purify UstD, cell pellets were thawed on ice and then resuspended in lysis buffer (50 mM potassium phosphate buffer (pH 8.0)+100 mM sodium chloride (enzyme storage buffer), 20 mM imidazole, 1 mg/mL Hen Egg White Lysozyme (Gold Biotechnology, Inc., St. Louis, MO, USA, hereinafter GoldBio), 0.2 mg/mL DNasel (GoldBio), 1 mM MgCl.sub.2, 150 M pyridoxal 5-phosphate (PLP)). A volume of 4 mL of lysis buffer was used per gram of wet cell pellet. After 1 h of stirring at 37 C., the resuspended cells were lysed using sonication (20 min, 0.8 seconds on, 0.2 seconds off, power setting 5). The resulting lysate was then spun down at 75,600g to pellet cellular debris. Ni/NTA beads (pre-equilibrated in 50 mM potassium phosphate buffer (pH 8.0), 100 mM sodium chloride, 20 mM imidazole) were added to the supernatant and incubated on ice for 1 h. The beads were then collected in a column, and the flow-through was recycled once to wash any remaining beads from the original vessel. The column was washed with 10 column volumes of enzyme storage buffer containing 20 mM imidazole, followed by sequential 10 column volume washes of enzyme storage buffer containing 40 mM and 60 mM imidazole. Elution was done by adding storage buffer containing 250 mM imidazole and collecting the flow-through until the eluent was no longer yellow (color due to the enzymatically bound PLP cofactor). The eluent was then transferred to a centrifugal filter tube (Amicon-brand Ultra-15, 30 kDa MWCO, Millipore-Sigma, Burlington, MA, USA) and concentrated by centrifugation (4,000g, 15 min). Imidazole was then removed through repeated dilution (with enzyme storage buffer) and concentration steps until no more than 100 nM imidazole was present. The buffer exchanged enzyme was then flash frozen as small droplets by dripping the solution into liquid nitrogen, transferred to a conical vial, and stored at 80 C. for no more than 1 month before use.

[0106] UstD for enzymatic reactions was obtained by thawing an appropriate quantity of stored frozen droplets on ice. Thawed protein was then centrifuged at 20,000g to remove any aggregated protein. Protein concentration was determined by Bradford assay.

Whole Cell Biocatalyst Reactions

[0107] Cells harboring expressed UstD were made using the standard expression protocol described previously. Harvested cells were resuspended in 100 mM potassium phosphate buffer +100 mM sodium chloride pH 7.0 to a concentration of 100 mg/mL cells and stored at 20 C. until needed. Analytical scale reactions were carried out as described previously, replacing the added purified UstD and PLP with an appropriate amount of whole cell catalyst solution (typically to an end concentration of 10 mg/mL cells) that was thawed on ice.

Optimization of Reaction Conditions for UstD

[0108] All optimization reactions were conducted at an analytical scale (100 L). PLP and L-aspartate stock solutions were made with 100 mM potassium phosphate buffer containing 100 mM sodium chloride (reaction buffer) at the indicated pH. Post-reaction quenching was done by adding 100 L of acetonitrile containing 1 mM tryptamine as an internal standard. Quenched reactions were then centrifuged at 20,000g to remove aggregated protein, and diluted with 200 L of 1:1 water: acetonitrile. Quantification of product formation was performed by UPLC analysis, using integrated UV-vis peak areas at 210 nm. Variability in injection volumes were corrected by dividing peak areas by the observed internal standard peak area. Optimization for each component are listed below. [0109] 1) PLP C

[0110] A 0.5 dram (3.7 mL) glass vial was charged with 82.7 L reaction buffer (pH 8.0), 5 L 500 mM benzaldehyde (2.5 mol, 1 equiv, 25 mM final concentration) in DMSO (5% final concentration), 5 L 500 mM 1-aspartate (2.5 mol, 1 equiv, 25 mM final concentration), and 2.3 L of variable concentration PLP solutions (0-50 equivalents relative to final enzyme concentration). Reactions were initiated by adding 2.3 L of 148 M UstD (0.013% mol cat., 7500 max TON). Reactions vials were placed in a dark 37 C. incubator for 16 h. [0111] 2) L-Aspartate Concentration

[0112] A 0.5 dram (3.7 mL) glass vial was charged with 34.4 L reaction buffer (pH 8.0), 5 L 500 mM benzaldehyde (2.5 mol, 1 equiv, 25 mM final concentration) in DMSO (5% final concentration), 8.3 L 1 mM PLP (50 equivalents relative to final enzyme concentration), and 50 L of variable concentration L-aspartate solutions (2.5-25 mol, 1-10 equiv, 25-250 mM final concentration). Reactions were initiated by adding 2.2 L of 75 M UstD (0.007% mol cat., 15000 max TON). Reactions vials were placed in a dark 37 C. incubator for 16 h. [0113] 3) pH

[0114] A 0.5 dram (3.7 mL) glass vial was charged with 62.3 L reaction buffer (variable pH), 5 L 500 mM benzaldehyde (2.5 mol, 1 equiv, 25 mM final concentration) in DMSO (5% final concentration), 25 L 500 mM L-aspartate (12.5 mol, 5 equiv, 125 mM final concentration), and 5 L 1 mM PLP (50 equivalents relative to final enzyme concentration). Reactions were initiated by adding 2.7 L of 37 M UstD (0.004% mol cat., 25000 max TON). Reactions vials were placed in a dark 37 C. incubator for 16 h.

Preparative Scale Production of Unprotected Gamma-Hydroxy Amino Acids

[0115] Flash frozen UstD was thawed on ice and centrifuged at 15,000g for 10 minutes to pellet any aggregated protein. A 50 mL round bottom flask was charged with a given aldehyde (0.1-0.5 mmol, 1.0 equiv, 25 mM final concentration), which was then dissolved in an appropriate amount of DMSO (5% v/v final concentration). This solution was then diluted with 100 mM potassium phosphate buffer (pH 7.0) containing 100 mM sodium chloride. L-Aspartic acid sodium salt monohydrate (0.5-2.5 mmol, 5.0 equiv, 125 mM final concentration) and 50 molar equivalents of pyridoxal-5-phosphate (PLP) relative to final UstD concentration were then added, followed by addition of UstD (0.001-0.1% mol cat.) Reactions took place in the dark at 37 C. for 16 h. Product formation was assessed by UPLC-MS. After reaction completion, the reaction mixture was quenched with an equivalent volume of acetonitrile and centrifuged (4,000g, 10 min) to remove aggregated UstD. The supernatant was then concentrated to 2 mL by rotary evaporation and loaded onto a preparative reverse-phase C18 pre-equilibrated at 1:20 methanol: water. Purification was performed via gradient elution on an Isolera One Flash Purification system (Biotage). Fractions bearing product (confirmed by UPLC-MS sampling of fraction tubes) were pooled and evaporated to dryness by rotary evaporation. The product was then resuspended in a minimal quantity of water, transferred to a pre-weighed 20 mL scintillation vial, frozen, and subjected to lyophilization.

Preparative Scale Production of Fmoc-Protected Gamma-Hydroxy Amino Acids

[0116] Reactions were carried out in an identical fashion to that of the unprotected amino acids up until the reaction quench. After reaction completion, the reaction mixture was titrated with 6 M sodium hydroxide to a pH of 10. An appropriate quantity of Fmoc-Cl (0.6-3 mmol, 1.2 equiv of original reaction 1-aspartate) was then dissolved in an equivalent volume (relative to total reaction volume) of acetonitrile, which was then added to the alkaline reaction mixture. The reaction was then stirred at room temperature for 4 h. For aliphatic -hydroxy amino acid products, further work-up and purification was performed identical to that of the unprotected amino acids. For aromatic -hydroxy amino acids, the resulting reaction mixture was then subjected to rotary evaporation at 45 C. to 100 mbar to remove dissolved acetonitrile. The reaction was then titrated with 2 M citric acid until a pH of 3 to precipitate all Fmoc-protected amino acids (y-hydroxy amino acid product, L-Aspartic Acid, L-Alanine.) The precipitated mixture was then extracted 3 times with 25 mL of ethyl acetate, and the aqueous phase was analyzed by UPLC-MS to ensure total product extraction. The isolated organic phase was then washed twice with a 25 mL saturated sodium chloride solution to help remove latent water and citric acid. This brine phase was also analyzed by UPLC-MS to ensure no product was lost during the washing phase. The organic phase was then dried over MgSO.sub.4 and concentrated by rotary evaporation. The concentrated solution was tested by TLC against a variety of separating conditions (typically ethyl acetate:n-hexane at varying ratios) to determine ideal separating conditions. The concentrated solution was then loaded onto a Biotage Samplet unit and dried. A Biotage 25 g KP-Sil cartridge was pre-equilibrated to the initial separating conditions, and the Samplet bearing the crude product was inserted into the cartridge. Purification was facilitated by gradient elution and automated fraction collecton, and all fractions bearing compounds absorbing at 210 nm were tested by UPLC-MS to determine which fractions contained purified products. These fractions were then pooled and concentrated by rotary evaporation in a round-bottom until 3 mL of liquid remained. The remaining liquid was then transferred to a pre-weighed 6 mL screw-cap vial, evaporated to dryness by rotary evaporation, and dried further overnight on a high vacuum system.