ENGINEERED INVARIANT NATURAL KILLER T (INKT) CELLS AND METHODS OF MAKING AND USING THEREOF
20250223333 ยท 2025-07-10
Assignee
Inventors
Cpc classification
A61K40/11
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
C12N2830/48
CHEMISTRY; METALLURGY
A61K40/15
HUMAN NECESSITIES
A61K2039/5154
HUMAN NECESSITIES
C12N2740/13043
CHEMISTRY; METALLURGY
International classification
A61K40/11
HUMAN NECESSITIES
A61K40/15
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
Abstract
Disclosed herein are invariant natural killer T (iNKT) cells engineered using hematopoietic stem and progenitor cells (HSPCs) and methods of making and using thereof.
Claims
1. A composition comprising an engineered cell having an exogenous invariant natural killer T cell receptor nucleic acid, wherein the engineered cell is derived from a progenitor cell into which has been incorporated the exogenous invariant natural killer T cell receptor nucleic acid and wherein the exogenous invariant natural killer T cell receptor nucleic acid is expressed as an invariant alpha chain polypeptide and a semi-invariant beta chain polypeptide.
2. The composition of claim 1, wherein the progenitor cell comprises a hematopoietic stem cell.
3. The composition of claim 1, wherein the exogenous invariant natural killer T cell receptor nucleic is incorporated into the progenitor cell by transduction.
4. The composition of claim 1, wherein the exogenous invariant natural killer T cell nucleic acid encodes a T cell receptor that recognizes alph-galactosylceramide (-Gal-Cer).
5. The composition of claim 1, wherein the engineered cell does not contain an exogenous oncogene.
6. The composition of claim 1, wherein the engineered cell is capable of producing one or more cytokines and/or chemokines.
7. The composition of claim 6, wherein the one or more cytokines and/or chemokines is selected from the group consisting of IFN, TNF, TGF, GM-CSF, IL-2, IL-4, IL-5, IL-6, IL- 10, IL-13, IL-17, IL-21, RANTES, Eotaxin, MIP-1, and MIP-1.
8. The composition of claim 1, wherein the engineered cell is derived from a progenitor cell that was expanded in vitro.
9. The composition of claim 1, wherein the progenitor cell is obtained from bone marrow, peripheral blood, amniotic fluid, or umbilical cord fluid.
10. The composition of claim 1, wherein the engineered cell is a human cell.
11. The composition of claim 1, wherein endogenous TCRs of the engineered cell are suppressed.
12. The composition of claim 1, wherein the progenitor cell is CD34+.
13. The composition of claim 1, wherein the engineered cell is a functional invariant Natural Killer T cell.
Description
DESCRIPTION OF THE DRAWINGS
[0017] This invention is further understood by reference to the drawings wherein (in the drawings, HSC refers to HSPC):
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
DETAILED DESCRIPTION OF THE INVENTION
[0054] The present invention provides HSPC-iNKT cells, invariant natural killer T (iNKT) cells engineered from hematopoietic stem cells (HSCs) and/or hematopoietic progenitor cells (HPCs), and methods of making and using thereof. As used herein, HSPCs is used to refer to HSCs, HPCs, or both HSCs and HPCs. The methods for making HSPC-iNKT cells according to the present invention are cost-effective and high-throughput. For example, using the methods of the present invention, one can readily implement retrovirus-transduced bone marrow transfer and generate HSPC-iNKT cells within as few as 6 weeks.
[0055] As disclosed herein, large numbers of HSPC-iNKT cells were generated by transducing HSPCs with one or more nucleic acid sequences encoding iNKT T cell receptors (TCRs) and engrafting the TCR-transduced HSPCs in subjects. Once engrafted, the transduced cells follow a two-stage developmental path, first in thymus and then in the periphery, which resembles that of endogenous iNKT cells and results in functional HSPC-iNKT cells. When tested in a mouse melanoma lung metastasis model, the HSPC-iNKT cells effectively protected mice from tumor metastasis.
[0056] HSPC-iNKT cells according to the present invention can also be generated in vitro. For example, HSPCs can be transduced with one or more iNKT TCR nucleic acid sequences and cultured with OP9-DL1 or MS5-DL4 stromal cells (Sun, et al. (2015) Cytokine 72:48-57) to result in TCR-engineered iNKT cells. The resulting iNKT cells can be further expanded by secondary culture with irradiated donor peripheral blood mononuclear cells (PBMCs) as antigen-presenting cells (APCs) or CD1d-expressing artificial antigen-presenting cells (aAPCs) in the presence of agonist antigen like -galactosylceramide (-GalCer). An example of such aAPCs could be K562 cells engineered to overexpress CD1d (Tian, et al. (2013) J. Immunol. 190:45.3).
[0057] As disclosed herein, HSPC-iNKT cells according to the present invention follow a classical iNKT cell development path, Check Point 1 in the thymus to gain iNKT TCR expression and Check Point 2 in the periphery to gain NK1.1 expression. They also display a typical iNKT cell phenotype (TCR.sup.lomCD1d/PBS-57.sup.hiNK1.1.sup.hiCD62L1.sup.oCD44.sup.hiCD4.sup.+/CD8.sup.) and exhibit full iNKT cell functionality with potent and fast response to antigen stimulation, both in vitro and in vivo. Thus, the HSPC-iNKT cells according to the present invention are functional, which means the HSPC-iNKT cells are able to produce, upon activation, one or more cytokines and/or chemokines such as IFN, TNF, TGF, GM-CSF, IL-2, IL-4, IL-5, IL-6, IL-10, IL-13, IL-17, IL-21, RANTES, Eotaxin, MIP-1, MIP-1, and the like.
[0058] Because the HSPC-iNKT cells of the present invention are functional, they can be used to study iNKT cell biology. The development and function of HSPC-iNKT cells in healthy and disease conditions can be monitored by varying the levels of HSPC-iNKT cells in subjects. In addition, using the methods of the present invention, one can generate large numbers of clonal HSPC-iNKT cells and thereby investigate the similarities and differences between individual iNKT cell clones. For example, by studying the antigen recognition and functional differentiation of single iNKT cell clones, important clues might be revealed to increase understanding of the origins of various iNKT cell subsets with distinct functions, such as those iNKT cell subsets biased to produce Th1, Th2, or Th17 effector cytokines. The flexibility of the inventive methods also allow the convenient generation of HSPC-iNKT cells of different genomic backgrounds at a fast pace and an affordable cost, allowing examination of the functions of designated genes for regulating iNKT cell biology.
[0059] HSPC-iNKT cells according to the present invention can be used in a variety of therapeutic treatments. Unlike transgenic mouse technologies, the inventive methods can be applied to humans through gene-modified CD34.sup.+ cell transfer and therefore can be used as therapeutics to treat a wide variety of diseases and disorders in humans. In addition, unlike iPS-derived iNKT cells, HSPC-iNKT cells according to the present invention do not contain exogenous oncogenes, such as Oct4, Sox2, Klf4, and c-Myc. Consequently, HSPC-iNKT cells of the present invention do not pose the same risks as iPS-derived iNKT cells when used to treat subjects. Therefore, the methods and HSPC-iNKT cells of the present invention can be used to provide subjects with a lifelong supply of iNKT cells. HSPC-iNKT cells according to the present invention can be used to treat various cancers such as melanoma, kidney cancer, lung cancer, prostate cancer, breast cancer, lymphoma, leukemia, and hematological malignancies, bacterial and viral infections such as tuberculosis, HIV, hepatitis, allergies such as asthma and eczema, and autoimmune diseases such as Type I diabetes, multiple sclerosis, and arthritis.
[0060] Donor HSPCs can be obtained from the bone marrow, peripheral blood, amniotic fluid, or umbilical cord blood of a donor. The donor can be an autologous donor, i.e., the subject to be treated with the HSPC-iNKT cells, or an allogenic donor, i.e., a donor who is different from the subject to be treated with the HSPC-iNKT cells. In embodiments where the donor is an allogenic donor, the tissue (HLA) type of the allogenic donor preferably matches that of the subject being treated with the HSPC-iNKT cells derived from the donor HSPCs.
[0061] According to the present invention, an HSPC is transduced with one or more exogenous iNKT TCR nucleic acid molecules. As used herein, an iNKT TCR nucleic acid molecule is a nucleic acid molecule that encodes an alpha chain of an iNKT T cell receptor (TCR), a beta chain of an iNKT T cell receptor (TCR), or both. As used herein, an iNKT T cell receptor is one that is expressed in an iNKT cell and recognizes -GalCer presented on CD1d. The TCR and TCR sequences of iNKT TCRs can be cloned and/or recombinantly engineered using methods in the art. For example, an iNKT cell can be obtained from a donor and the TCR and genes of the iNKT cell can be cloned as described herein. The iNKT TCR to be cloned can be obtained from any mammalian including humans, non-human primates such monkeys, mice, rats, hamsters, guinea pigs, and other rodents, rabbits, cats, dogs, horses, bovines, sheep, goat, pigs, and the like. In some embodiments, the iNKT TCR to be cloned is a human iNKT TCR. In some embodiments, the iNKT TCR clone comprises human iNKT TCR sequences and non-human iNKT TCR sequences.
[0062] In some embodiments, the cloned TCR can have a TCR chain from one iNKT cell and a TCR chain from a different iNKT cell. In some embodiments, the iNKT cell from which the TCR chain is obtained and the iNKT cell from which the TCR chain is obtained are from the same donor. In some embodiments, the donor of the iNKT cell from which the TCR chain is obtained is different from the donor of the iNKT cell from which the TCR chain is obtained. In some embodiments, the sequence encoding the TCR chain and/or the sequence encoding the TCR chain of a TCR clone is modified. In some embodiments, the modified sequence may encode the same polypeptide sequence as the unmodified TCR clone, e.g., the sequence is codon optimized for expression. In some embodiments, the modified sequence may encode a polypeptide that has a sequence that is different from the unmodified TCR clone, e.g., the modified sequence encodes a polypeptide sequence having one or more amino acid substitutions, deletions, and/or truncations.
[0063] The cloned and/or recombinantly engineered iNKT TCR and TCR chains are then inserted into one or more expression vectors to give TCR expression vectors. In some embodiments, the cloned and/or recombinantly engineered iNKT TCR and TCR chains are provided in the same expression vector and are functionally linked to result in their co-expression. In some embodiments, the expression vector is a retroviral vector or a lentiviral vector.
[0064] The donor HSPCs are then transduced with one or more TCR expression vectors. In some embodiments, an HSPC is transduced with a first TCR expression vector that encodes an iNKT TCR chain and a second TCR expression vector that encodes a TCRB chain. In some embodiments, an HSPC is transduced with a TCR expression vector that encodes both an iNKT TCR chain and an iNKT TCR chain. In some embodiments, expression of the iNKT TCR chain and the iNKT TCR chain are under the same promotor in one TCR expression vector. In some embodiments, expression of the iNKT TCR chain is under a first promotor and the expression of the iNKT TCR chain is under a second promotor in one TCR expression vector. In some embodiments, the TCR-transduced HSPCs are expanded in vitro. In some embodiments, the TCR-transduced HSPCs are engrafted in a subject to generate clonal populations of HSPC-iNKT cells. In some embodiments, the subject is in need of treatment with iNKT cells. As used herein, a subject in need of treatment with iNKT cells is one who suffers from a condition that may be treated, reduced, or alleviated by increasing the number of iNKT cells in the subject. Examples of such conditions include cancers such as melanoma, kidney cancer, lung cancer, prostate cancer, breast cancer, lymphoma, leukemia, and hematological malignancies, bacterial infections such as tuberculosis, viral infections such as HIV and hepatitis, and allergies and autoimmune diseases such as asthma, eczema, Type I diabetes, multiple sclerosis, and arthritis. In some embodiments, the subject is a host subject having thymus tissue suitable for thymic development of the TCR-transduced HSPCs into HSPC-iNKT cells. In some embodiments, the host subject is a BLT mouse, e.g., a mouse surgically implanted with human thymus tissue. In some embodiments, HSPC-iNKT cells are obtained from a host subject. In some embodiments, HSPC-iNKT cells obtained from a host subject are administered to a subject in need of treatment with iNKT cells.
[0065] In some embodiments, TCR-transduced HSPCs are cultured in vitro, e.g., with OP9-DL1 or MS5-DL4 stromal cells, to give rise to HSPC-iNKT cells, which are capable of expressing one or more cytokines and/or chemokines upon activation. These engineered iNKT cells can be administered to a subject in need of treatment with iNKT cells. In some embodiments, these engineered iNKT cells can be further expanded by secondary culture with irradiated donor PBMCs as antigen-presenting cells (APCs) or CD1d-expressing artificial antigen-presenting cells (aAPCs) in the presence of agonist antigen like -GalCer, which can then be administered to a subject in need of treatment with iNKT cells.
[0066] In some embodiments, the HSPC-iNKT cells are activated ex vivo for utilization as, for example, a source of active iNKT cells for immunotherapy. Therefore, in some embodiments, the present invention is directed to methods for generating active HSPC-iNKT cells by contacting HSPC-iNKT cells with anti-CD3/CD28, PMA/Ionomycin, or -GalCer presented by cells such as PBMCs, dendritic cells (DCs), and artificial APCs. When the DC-activated HSPC-iNKT cells are intended to be administered to humans, the -GalCer used to pulse DCs is desirably of GMP grade. Pulsation of DCs with -GalCer can be performed by methods in the art; for example, the pulsation can be performed by culturing the DCs in a serum-containing medium (for example, 10% FCS-containing RPMI-1640 medium and the like) containing -GalCer at a concentration of about 0.01 to about 5 g/mL for about 2 to about 48 hours. In some embodiments, the pulsation with -GalCer may be performed by adding -GalCer to the medium in the process of culturing and maturing the immature DC in the presence of GM-CSF (and IL-4), or post DC maturation induced by LPS-treatment. In some embodiments, the pulsation may be performed by adding -GalCer to the medium in the step of co-culturing the DC matured as described below with HSPC-iNKT cells. As used herein, an active or activated HSPC-iNKT cell refers to a HSPC-iNKT cell that at least produces a Th1 cytokine such as IFN- in response to -GalCer-presenting DC. The cell may further be capable of producing a Th2 cytokine such as IL-4 and/or be capable of proliferating.
[0067] TCR-transduced HSPCs and/or HSPC-iNKT cells according to the present invention may be locally or systemically administered to subjects. In some embodiments, the present invention provides compositions comprising TCR-transduced HSPCs and/or HSPC-iNKT cells according to the present invention. In some embodiments, the compositions comprising TCR-transduced HSPCs and/or HSPC-iNKT cells according to the present invention are formulated for injection, suspension, or drip infusion, by being blended with a pharmaceutically acceptable carrier. In some embodiments, the compositions of the present invention comprise TCR-transduced HSPCs and/or HSPC-iNKT cells suspended in a pharmaceutically acceptable carrier at a concentration of about 1.010.sup.5 to 1.010.sup.7 cells/ml. The term pharmaceutically acceptable carrier as used herein refers to a carrier or diluent, which are added to a composition by the hand of a human, which is generally non-toxic to an intended recipient, does not significantly inhibit the activity of the TCR-transduced HSPCs and/or HSPC-iNKT cells, and is not cytotoxic to the TCR-transduced HSPCs and/or HSPC-iNKT cells. Pharmaceutically acceptable carriers include physiological saline and isotonic solutions containing glucose or another auxiliary drug (e.g., D-sorbitol, D-mannitol, sodium chloride and the like). In some embodiments, compositions according to the present invention may include one or more excipients, diluents, auxiliaries, preservatives, solubilizing agents, buffers, thickening agents, gelling agents, foaming agents, surfactants, binders, suspending agents, disintegrating agents, wetting agents, solvents, plasticizers, fillers, colorants, dispersants, and the like. In some embodiments, the compositions further comprise an agent that activates the HSPC-iNKT cells, e.g., -GalCer or salts or esters thereof, -GalCer-presenting dendritic cells, or artificial APCs.
[0068] In some embodiments, a therapeutically effective amount of one or more of the TCR-transduced HSPCs and/or HSPC-iNKT cells according to the present invention are administered to a subject. The term therapeutically effective amount as used herein is intended to mean an amount which is effective to alleviate, ameliorate, or prevent a symptom or sign of a disease or condition to be treated.
[0069] The amount of a composition of the present invention administered to a subject and the route of administration depends on factors such as the severity of an infection affecting the subject, the activity and rate of clearance/proliferation of the TCR-transduced HSPCs and/or HSPC-iNKT cells, and the general physical characteristics of the subject including age, gender, and body weight. One of skill in the art may readily determine a therapeutically effective amount and route of administration in view of these and other considerations typical in medical practice. Therapeutically effective amounts of one or more TCR-transduced HSPCs and/or HSPC-iNKT cells according to the present invention may be readily determined by those skilled in the art without undue experimentation.
[0070] In general, a therapeutically effective amount of one or more TCR-transduced HSPCs and/or HSPC-iNKT cells is about 10.sup.7 to about _10.sup.9 cells per kg body weight of the subject being treated. A therapeutically effective amount of one or more TCR-transduced HSPCs and/or HSPC-iNKT cells according to the present invention may be manufactured and/or administered in single or multiple unit dose forms. In some embodiments, the one or more TCR-transduced HSPCs and/or HSPC-iNKT cells are provided as a composition having a concentration of about 1.010.sup.5 to about 1.010.sup.7 cells/ml of a pharmaceutically acceptable carrier or diluent. In some embodiments, the composition comprises about 110.sup.7 to about 110.sup.9 of the one or more TCR-transduced HSPCs and/or HSPC-iNKT cells. In some embodiments, the composition comprises about 110.sup.7 to about 110.sup.8 of the one or more TCR-transduced HSPCs and/or HSPC-iNKT cells. In some embodiments, the composition comprises about 110.sup.8 to about 110.sup.9 of the one or more TCR-transduced HSPCs and/or HSPC-iNKT cells. In some embodiments, a subject is administered an agent that activates the HSPC-iNKT cells, e.g., -GalCer or salts or esters thereof, -GalCer-presenting dendritic cells before, during, and/or after administration of the one or more TCR-transduced HSPCs and/or HSPC-iNKT cells.
[0071] The following examples are intended to illustrate but not to limit the invention.
EXAMPLES
Cloning of iNKT TCR Genes and Construction of Retroviral Delivery Vectors
[0072] Disclosed herein is a robust and high-throughput single-cell TCR cloning method for obtaining iNKT TCR genes. Briefly, single iNKT cells were sorted from mouse spleen cells using flow cytometry based on a stringent collection of surface markers gated as CD3.sup.lomCD1d/PBS-57.sup.+TCR V8.sup.+NK1.1.sup.+ (See
Generation of Clonal HSPC-iNKT Cells Through Genetic Engineering of HSPCs
[0073] miNKT-transduced bone marrow transfer in B6 mice was performed to generate the recipient mice denoted as B6-miNKT (See
Functionality of HSPC-iNKT Cells
[0074] Then the functionality of the HSPC-iNKT cells was analyzed. When stimulated with -GalCer in vitro, the HSPC-iNKT cells proliferated vigorously by over 20-fold in 5 days and produced large amounts of the effector cytokines IFN- and IL-4 (See
Development of HSPC-iNKT Cells
[0075] Next, the development of the HSPC-iNKT cells was analyzed. iNKT cell progenitors gated as TCR.sup.lomCD1d/PBS-57.sup.+ were detected in the thymus of the B6-miNKT mice and were found to follow a classic developmental path similar to that observed for endogenous iNKT progenitor cells in the control B6-Mock mice (See
[0076] Overexpression of pre-rearranged TCR genes in HSPCs has been shown to induce allelic exclusion and block the rearrangements of endogenous TCR genes in the resulting conventional T cells. Study of the HSPC-iNKT cells generated in the B6-miNKT mice revealed that these cells expressed the transgenic TCR (V8.sup.+), but not the other TCR VB chains analyzed in the experiment (See
[0077] The lineage differentiation of HSPC-iNKT cells was also studied. By detecting intracellular expression of transgenic iNKT TCRs (gated as V8.sup.intra+), TCR-transduced HSPCs and their progeny cells could be tracked (See
Antitumor Capacity of HSPC-iNKT Cells
[0078] The cancer therapy potential of the HSPC-iNKT cells was then studied. B6-miNKT mice and control B6-Mock mice were challenged with B16.F10 melanoma cells through i.v. injections and analyzed for lung metastasis 2 weeks later (See
Human HSPC-iNKT Cells
[0079] Human HSPC-iNKT cells were successfully generated in BLT mice. Briefly, human iNKT TCR genes were cloned and inserted into an expression vector. Then human fetal liver CD34.sup.+ HSPCs were transduced with the TCR expression vector and transplanted into NOD/SCID/IL-2r.sup./ mice that were pre-implanted with human fetal liver and thymus. Two to three months later, clonal human HSPC-iNKT cells were generated in the BLT mice. Thus, the present invention can be used to generate human HSPC-iNKT cells for cell therapies.
[0080] The following examples are intended to illustrate but not to limit the invention.
MATERIALS AND METHODS
Mice and Materials
[0081] C57BL/6J (B6) mice were purchased from the Jackson Laboratory. Six-to ten-week-old females were used for all experiments unless otherwise indicated. All animal experiments were approved by the Institutional Animal Care and Use Committee of the University of California, Los Angeles.
[0082] -Galactosylceramide (-GalCer, KRN7000) was purchased from Avanti Polar Lipids; lipopolysaccharides (LPS) and 5-fluorouracil (5-FU) from Sigma; recombinant murine IL-3, IL-6 and stem cell factor (SCF) from PeproTech; and polybrene from Millipore. Fluorochrome-conjugated mCD1d/PBS-57 tetramer reagents were provided by the NIH Tetramer Core Facility (Emory University, Atlanta, GA). Fixable Viability Dye eFluor455UV was purchased from Affymetrix eBioscience.
Antibodies and Flow Cytometry
[0083] Fluorochrome-conjugated antibodies specific for mouse CD3, CD4, CD8, CD19, CD11b, CD24, CD62L, CD44, DX5, F4/80, Gr-1, TCR, TCR V7, TCR V8, and TCR V8.3 were purchased from BioLegend; for mouse NK1.1, IFN-, IL-4, TCR V2, TCR V3.2, TCR V3, TCR V4, TCR V5, TCR V6, TCR V11, and TCR V13, from BD Biosciences. Fc Block (anti-mouse CD16/32) was purchased from BD Biosciences. Cells were stained as previously described (Yang & Baltimore (2005) PNAS USA 102 (12): 4518-4523) and analyzed using an LSRFortessa flow cytometer (BD Biosciences). FlowJo software was used to analyze the data.
ELISA
[0084] The ELISAs for detecting mouse cytokines were performed following a standard protocol from BD Biosciences. The capture and biotinylated antibody pairs for detecting mouse IFN- and IL-4 were also purchased from BD Biosciences. The streptavidin-HRP conjugate and mouse IFN- and IL-4 Single-Use ELISA Ready-Set-Go (RSG) Standards were purchased from Affymetrix eBioscience. The 3,3,5,5-Tetramethylbenzidine (TMB) substrate was purchased from KPL. The samples were analyzed for absorbance at 450 nm using an Infinite M1000 microplate reader (Tecan).
Single-Cell iNKT TCR Cloning
[0085] The single-cell iNKT TCR RT-PCR was performed based on an established protocol (Smith, et al. (2009) Nat Protoc 4(3):372-384), with certain modifications. iNKT cells were sorted from mouse spleen cells based on a stringent forum of surface markers (CD3.sup.lomCD1d/PBS-57.sup.+TCR V8.sup.+NK1.1.sup.hi) using a FACSAria II flow cytometer (BD Biosciences) (lo, low; hi, high). Single cells were sorted directly into PCR plates containing cell lysis buffer. The plates were then immediately flash frozen and stored at 80 C. until use. Upon thawing, the cell lysate from each cell was split in half on the same PCR plate and processed directly into iNKT TCR cloning for both and chain genes using a OneStep RTPCR kit (QIAGEN), following the manufacturer's instructions and using the iNKT TCR gene-specific primers. These primers were designed to amplify the 200 bps spanning the CDR3 regions of the iNKT TCR and chain cDNAs and were customer-synthesized by Integrated DNA Technologies (IDT): for TCR60 (forward primer: 5-GGG AGA TAC TCA GCA ACT CTG GAT AAA GAT GC-3 (SEQ ID NO: 14); reverse primer: 5-CCA GAT TCC ATG GTT TTC GGC ACA TTG-3 (SEQ ID NO: 15)) and for TCR (forward primer: 5-GGA GAT ATC CCT GAT GGA TAC AAG GCC TCC-3 (SEQ ID NO: 16); reverse primer: 5-GGG TAG CCT TTT GTT TGT TTG CAA TCT CTG-3 (SEQ ID NO: 17)). Verified sequences (productive germline V14-J18-C assembly for TCR and V8-D/J/N-C assembly for TCR) were used to construct the complete cDNA sequences encoding the TCR and chains from a single cell, based on information about murine TCR genomic segments (the international ImMuno-GeneTics information system (IMGT), see WorldWideWebDOTimgtDOTorg, wherein WorldWideWeb is www and DOT is .. The selected iNKT TCR and pair cDNAs were then synthesized as a single bicistonic gene, with codon optimization and a F2A sequence linking the TCR and TCR cDNAs to enable their coexpression (GenScript).
The 293.T/mCD3 Stable Cell Line
[0086] HEK293.T human embryonic kidney epithelial cells (ATCC) were stably transduced with a lentiviral vector (Yang L, et al. (2008) Nat Biotechnol 26 (3): 326-334) co-expressing all four chains of mouse CD3 complex (CD3, CD3, CD3e, and CD3), through linking the four cDNAs with three different 2A sequences (F2A, foot-and-mouth disease virus 2A; P2A, porcine teschovirus-1 2A; and T2A, Thosea asigna virus 2A). The transduced cells were then transiently transfected with an MOT1 vector encoding a mouse CD8 TCR, using a standard calcium precipitation procedure (Yang & Baltimore (2005) PNAS USA 102(12): 4518-4523). Single cells supporting the high surface expression of OT1 TCRs (gated as CD3.sup.+TCR V5.sup.+) were sorted out using flow cytometry and grown into single-cell clones. A stable, single-cell clone, which lost OT1 TCR expression, but retained the capacity to support mouse TCR surface expression, was selected and designated as the 293.T/mCD3 stable cell line.
Mock and miNKT Retroviruses
[0087] Mock (MIG) retroviral vector was reported previously (Yang & Baltimore (2005) PNAS USA 102(12): 4518-4523). miNKT retroviral vector was constructed by inserting the synthetic bicistronic gene (iNKT TCR-F2ATCR) into the MIG vector, replacing the IRES-EGFP segment. Retroviruses were made using HEK293.T cells, following a standard calcium precipitation protocol as previously described (Yang & Baltimore (2005) PNAS USA 102(12): 4518-4523).
HSPC Isolation, Transduction, Adoptive Transfer, and Secondary Bone Marrow Transfer
[0088] The procedures were reported previously (Yang & Baltimore (2005) PNAS USA 102(12): 4518-4523). In brief, B6 mice were treated with 5-fluorouracil (250 g per gram body weight). Five days later, bone marrow (BM) cells were harvested and cultured for 4 days in BM cell culture medium containing recombinant murine IL-3 (20 ng/mL), IL-6 (50 ng/mL), and SCF (50 ng/ml). On Days 2 and 3, BM cells were spin-infected with retroviruses supplemented with 8 g/mL of polybrene, at 770g, 30 C. for 90 minutes on Day 4, BM cells were collected and i.v. injected into B6 recipients that had received 1,200 rads of total body irradiation (about 1-210.sup.6 transduced BM cells per recipient). For secondary BM transfer, fresh total BM cells harvested from the primary BM recipients were i.v. injected into secondary B6 recipient mice that had received 1,200 rads of total body irradiation (about 1010.sup.6 total BM cells per recipient). The BM recipient mice were maintained on the combined antibiotics sulfamethoxazole and trimethoprim oral suspension (Septra; Hi-Tech Pharmacal) in a sterile environment for 6-8 weeks until analysis or use for further experiments.
Bone Marrow-Derived Dendritic Cell Generation, Antigen Loading, and Mouse Immunization
[0089] B6 mouse BMDCs were generated from BM cell cultures and matured with LPS as described previously (Yang & Baltimore (2005) PNAS USA 102(12): 4518-4523). The LPS-matured BMDCs were then cultured at 37 C. in a 6-well plate at 1010.sup.6 cells/well/2 mL BMDC culture medium containing 5 g/mL of -GalCer for 2 hours, with gentle shaking every 30 minutes. The -GalCer-loaded BMDCs were then washed twice with PBS and used to immunize mice through i.v. injection (about 110.sup.6 BMDCs/mouse).
In Vitro iNKT Cell Functional Assays
[0090] Spleen cells containing iNKT cells were cultured in vitro in a 24-well plate at 210.sup.6 cells per well in regular mouse lymphocyte culture medium, with or without the addition of -GalCer (100 ng/ml), for 5 days. On Days 3 and 5, cells were collected and assayed for iNKT cell expansion using flow cytometry, and the cell culture supernatants were collected and assayed for effector cytokine (IFN- and IL-4) production by ELISA. On Day 3, some cells were also treated with 4 L/6 mL BD GolgiStop for 4-6 hours and then assayed for intracellular cytokine production using flow cytometry via intracellular staining using the BD Cytofix/Cytoperm Fixation/Permeabilization Kit (BD Biosciences).
In Vivo iNKT Cell Functional Assay
[0091] Mice were immunized with -GalCer-loaded BMDCs through i.v. injection (about 110.sup.6 BMDCs per mouse) and then periodically bled to monitor the in vivo iNKT cell responses using flow cytometry.
B16 Melanoma Lung Metastasis Mouse Model
[0092] Mice that received i.v. injection of 0.5110.sup.6 B16.F10 melanoma cells were allowed to develop lung metastasis over the course of 2 weeks (Fujii S, et al. (2002) Nat Immunol 3(9):867-874). On day 3 post tumor challenge, the experimental mice received i.v. injection of 110.sup.6 BMDCs that were either unloaded or loaded with -GalCer. On Day 14, mice were euthanized, and their lungs were harvested and analyzed for melanoma metastasis by counting tumor nodules under a Zeiss Stemi 2000-CS microscope (Carl Zeiss AG) at 10 magnification. Representative lungs were also analyzed by immunohistology.
Immunohistology
[0093] Lung tissues collected from the experimental mice were fixed in 10% neutral-buffered formalin and embedded in paraffin for sectioning (5 m thickness), followed by hematoxylin and eosin staining using standard procedures (UCLA Translational Pathology Core Laboratory, Los Angeles, CA). The sections were imaged using an Olympus BX51 upright microscope equipped with an Optronics Macrofire CCD camera (AU Optronics) at 40 and 100 magnifications. The images were analyzed using Optronics PictureFrame software (AU Optronics). Statistical analysis. Student's two-tailed t test was used for paired comparisons. Data are presented as meanSEM, unless otherwise indicated. P<0.01 was considered significant.
Cloning of Human iNKT TCR Genes
[0094] Human iNKT TCR genes were cloned as above and with the following modifications. iNKT cells were sorted from fresh PBMCs of healthy human donors using flow cytometry based on a stringent forum of markers (gated as CD161.sup.+CD3.sup.+CD1d/-GalCer.sup.+V24-J18.sup.30 V11.sup.+). Single iNKT cells were sorted directly into PCR plates containing cell lysis buffer. The cell lysate from each single cells was then split into half on the same PCR plate, and be processed directly into iNKT TCR cloning for both a and B chains using a OneStep RT-PCR kit (Qiagen) following the manufacturer's instructions, and using the gene-specific primers verified by the preliminary study. The PCR products were then examined by electrophoresis and the amplicons corresponding to iNKT TCR a and B chains were sequenced. For each single cell, verification that it expressed an invariant alpha chain (V24-J18-C) and a semi- invariant beta chain (V11-D/J/N-C) helped to certify its iNKT identity, as well as reveal its unique TCR D/J/N sequence, with which a unique iNKT TCR clone was established. This cloning strategy exemplified in
Construction of Human iNKT TCR Delivery Lentivectors
[0095] Human iNKT TCR genes were cloned into a chosen lentivector to generate lentiviral vectors that co-deliver the iNKT TCR genes as well as an EGFP reporter gene, denoted as phiNKT-EGFP (
Generation of Human HSPC-iNKT cells
[0096] Human fetal liver CD34.sup.+ HSPCs were transduced with a selected phiNKT-EGFP lentivector. They were then transplanted into NOD/SCID/IL-2r.sup./ mice that were pre-implanted with human fetal liver and thymus, to generate iNKT TCR-engineered BLT mice (denoted as BLT-iNKT) following an established protocol. Two to three months later, the BLT mice were analyzed for the presence of human HSPC-iNKT cells (FIG. 9A). The data in
iNKT TCR Sequences
[0097] Because invariant natural killer T (iNKT) cells express T cell receptors (TCRs) comprising the identical alpha chains and beta chains of limited diversity, the full sequence of one alpha chain is listed as being exemplary, however, other alpha chains can be implemented according to the present invention. Similarly, for the beta chains, the full sequence of one beta chain and the sequences of the diverse region (D/J/N region) of a variety of beta chains are listed for exemplary purposes, but other beta chains can be implemented according to the present invention. As an example, beta chains that utilize the human TCR V beta 11 segment were used. Therefore, the TCR beta V regions of these beta chains are identical, leaving the D/J/N segment the only diverse regions in these iNKT TCR beta chains. The genomic sequence, codon-optimized gene sequence and protein sequence of each iNKT TCR alpha and beta chains are listed below. Each unique D/J/N region makes a unique beta chain, which in combination with the identical alpha chain forms a unique iNKT TCR pair.
TABLE-US-00001 HumaniNKTTCRAlphaChainFullSequence (IdenticalforAllHumaniNKTTCRs) cDNAGenomicSequence(831bp) (SEQIDNO:18) atgaaaaagcatctgacgaccttcttggtgattttgtggctttattttt atagggggaatggcaaaaaccaagtggagcagagtcctcagtccctgat catcctggagggaaagaactgcactcttcaatgcaattatacagtgagc cccttcagcaacttaaggtggtataagcaagatactgggagaggtcctg tttccctgacaatcatgactttcagtgagaacacaaagtcgaacggaag atatacagcaactctggatgcagacacaaagcaaagctctctgcacatc acagcctcccagctcagcgattcagcctcctacatctgtgtggtgagcg acagaggctcaaccctggggaggctatactttggaagaggaactcagtt gactgtctggcctgatatccagaaccctgaccctgccgtgtaccagctg agagactctaaatccagtgacaagtctgtctgcctattcaccgattttg attctcaaacaaatgtgtcacaaagtaaggattctgatgtgtatatcac agacaaaactgtgctagacatgaggtctatggacttcaagagcaacagt gctgtggcctggagcaacaaatctgactttgcatgtgcaaacgccttca acaacagcattattccagaagacaccttcttccccagcccagaaagttc ctgtgatgtcaagctggtcgagaaaagctttgaaacagatacgaaccta aactttcaaaacctgtcagtgattgggttccgaatcctcctcctgaaag tggccgggtttaatctgctcatgacgctgcggctgtggtccagctga cDNACodon-OptimizedSequence(831bp) (SEQIDNO:19) atgaaaaagcatctgacaacattcctggtcattctgtggctgtacttct accgaggcaacggcaaaaatcaggtggagcagtccccacagtccctgat cattctggaggggaagaactgcactctgcagtgtaattacaccgtgtct ccctttagtaacctgcgctggtataaacaggacaccggacgaggacccg tgagcctgacaatcatgactttctcagagaacacaaagagcaatggacg gtacaccgctacactggacgcagataccaaacagagctccctgcacatc acagcatctcagctgtcagatagcgcctcctacatttgcgtggtctctg accgagggagtaccctgggccgactgtattttggaagggggacccagct gacagtgtggcccgacatccagaacccagatcccgccgtctaccagctg cgcgacagcaagtctagtgataaaagcgtgtgcctgttcacagactttg attctcagactaatgtctctcagagtaaggacagtgacgtgtacattac tgacaaaaccgtcctggatatgaggagcatggacttcaagtcaaacagc gccgtggcttggtcaaacaagagcgacttcgcatgcgccaatgctttta acaattcaatcattccagaggataccttctttcctagcccagaatcaag ctgtgacgtgaagctggtcgagaaaagtttcgaaactgataccaacctg aattttcagaacctgtctgtgatcggcttcagaatcctgctgctgaagg tcgccggctttaatctgctgatgacactgagactgtggtcctcttga ProteinSequence(276aa) (SEQIDNO:20) MKKHLTTFLVILWLYFYRGNGKNQVEQSPQSLIILEGKNCTLQCNYTVS PFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHI TASQLSDSASYICVVSDRGSTLGRLYFGRGTQLTVWPDIQNPDPAVYQL RDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNS AVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNL NFQNLSVIGFRILLLKVAGFNLLMTLRLWSS HumaniNKTTCRBetaChainFullSequence (theD/J/Nregionsareinbold) cDNAGenomicSequence(870bp+D/J/N) (SEQIDNO:21) atgactatcaggctcctctgctacatgggcttttattttctgggggcag gcctcatggaagctgacatctaccagaccccaagataccttgttatagg gacaggaaagaagatcactctggaatgttctcaaaccatgggccatgac aaaatgtactggtatcaacaagatccaggaatggaactacacctcatcc actattcctatggagttaattccacagagaagggagatctttcctctga gtcaacagtctccagaataaggacggagcattttcccctgaccctggag tctgccaggccctcacatacctctcagtacctctgtgccagc(D/J/N) gaggacctgaacaaggtgttcccacccgaggtcgctgtgtttgagccat cagaagcagagatctcccacacccaaaaggccacactggtgtgcctggc cacaggcttcttccctgaccacgtggagctgagctggtgggtgaatggg aaggaggtgcacagtggggtcagcacggacccgcagcccctcaaggagc agcccgccctcaatgactccagatactgcctgagcagccgcctgagggt ctcggccaccttctggcagaacccccgcaaccacttccgctgccaagtc cagttctacgggctctcggagaatgacgagtggacccaggatagggcca aacccgtcacccagatcgtcagcgccgaggcctggggtagagcagactg tggctttacctcggtgtcctaccagcaaggggtcctgtctgccaccatc ctctatgagatcctgctagggaaggccaccctgtatgctgtgctggtca gcgcccttgtgttgatggccatggtcaagagaaaggatttctga cDNACodon-OptimizedSequence(870bp+D/J/N) (SEQIDNO:22) atgaccatccggctgctgtgctacatgggcttctattttctgggggcag gcctgatggaagccgacatctaccagactcccagatacctggtcatcgg aaccgggaagaaaattacactggagtgttcccagacaatgggccacgat aagatgtactggtatcagcaggaccctgggatggaactgcacctgatcc attactcctatggcgtgaactctaccgagaagggcgacctgagcagcga atccaccgtctctcgaattaggacagagcactttcctctgactctggaa agcgcccgaccaagtcatacatcacagtacctgtgcgctagc(D/J/N) gaggacctgaataaggtgttcccccctgaggtggctgtctttgaaccaa gtgaggcagaaatttcacatacacagaaagccaccctggtgtgcctggc taccggcttctttcccgatcacgtggagctgagctggtgggtcaacggc aaggaagtgcatagcggagtctccacagacccacagcccctgaaagagc agcctgctctgaatgattccagatactgcctgtctagtagactgcgggt gtctgccaccttctggcagaacccaaggaatcatttcagatgtcaggtg cagttttatggcctgagcgagaacgatgaatggactcaggacagggcta agccagtgacccagatcgtcagcgcagaggcctggggaagagcagactg cgggtttacaagcgtgagctatcagcagggcgtcctgagcgccacaatc ctgtacgaaattctgctgggaaaggccactctgtatgctgtgctggtct ccgctctggtgctgatggcaatggtcaagcggaaagatttctga ProteinSequence(289aa+D/J/N) (SEQIDNO:23) MTIRLLCYMGFYFLGAGLMEADIYQTPRYLVIGTGKKITLECSQTMGHD KMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLE SARPSHTSQYLCAS(D/J/N)EDLNKVFPPEVAVFEPSEAEISHTQKAT LVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLS SRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAW GRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRK DF HumaniNKTTCRBetaChainDiverseRegion (D/J/N)Sequence HumaniNKTTCRBetaChainClonedfromthe CD4+CD8(CD4SP)Subpopulation cDNAGenomicSequence(60bp) (SEQIDNO:24) GTAGCGGTTGGGCCCCAAGAGACCCAGTACTTCGGGCCAGGCACGCGGC TCCTGGTGCTC cDNACodon-OptimizedSequence(60bp) (SEQIDNO:25) GTGGCAGTCGGACCTCAGGAGACCCAGTACTTCGGACCCGGCACCCGCC TGCTGGTGCTG ProteinSequence(20aa) (SEQIDNO:26) VAVGPQETQYFGPGTRLLVL HumaniNKTTCRBetaChainClonedfromthe CD4+CD8-(CD4SP)Subpopulation cDNAGenomicSequence(54bp) (SEQIDNO:27) AGTGGGCCAGGGTACGAGCAGTACTTCGGGCCGGGCACCAGGCTCACGG TCACA cDNACodon-OptimizedSequence(54bp) (SEQIDNO:28) TCAGGACCCGGCTACGAGCAGTATTTCGGCCCCGGAACTCGGCTGACCG TGACC ProteinSequence(18aa) (SEQIDNO:29) SGPGYEQYFGPGTRLTVT HumaniNKTTCRBetaChainClonedfromthe CD4+CD8(CD4SP)Subpopulation cDNAGenomicSequence(57bp) (SEQIDNO:30) AGTCCCCAATTAAACACTGAAGCTTTCTTTGGACAAGGCACCAGACTCA CAGTTGTA cDNACodon-OptimizedSequence(57bp) (SEQIDNO:31) TCTCCACAGCTGAACACCGAGGCCTTCTTCGGGCAGGGCACAAGGCTTA CCGTGGTG ProteinSequence(19aa) (SEQIDNO:32) SPQLNTEAFFGQGTRLTVV HumaniNKTTCRBetaChainClonedfromthe CD4+CD8(CD4SP)Subpopulation cDNAGenomicSequence(78bp) (SEQIDNO:33) AGTGAATTGCGGGCGCTCGGGCCCAGCTCCTATAATTCACCCCTCCACT TTGGGAACGGGACCAGGCTCACTGTGACA cDNACodon-OptimizedSequence(78bp) (SEQIDNO:34) TCCGAACTCCGAGCCCTGGGGCCTAGCTCCTACAATAGCCCCCTGCACT TTGGCAACGGAACCAGGCTGACGGTCACC ProteinSequence(26aa) (SEQIDNO:35) SELRALGPSSYNSPLHFGNGTRLTVT HumaniNKTTCRBetaChainClonedfromthe CD4+CD8(CD4SP)Subpopulation cDNAGenomicSequence(60bp) (SEQIDNO:36) AGTGAACAGGGGACTACTGCGGGAGCTTTCTTTGGACAAGGCACCAGAC TCACAGTTGTA cDNACodon-OptimizedSequence(60bp) (SEQIDNO:37) TCCGAACAGGGAACCACAGCAGGAGCCTTCTTCGGTCAGGGAACAAGAC TGACAGTCGTG ProteinSequence(20aa) (SEQIDNO:38) SEQGTTAGAFFGQGTRLTVV HumaniNKTTCRBetaChainClonedfromthe CD4CD8+(CD8SP)Subpopulation cDNAGenomicSequence(66bp) (SEQIDNO:39) AGTGAGTCACGACATGCGACAGGAAACACCATATATTTTGGAGAGGGAA GTTGGCTCACTGTTGTA cDNACodon-OptimizedSequence(66bp) (SEQIDNO:40) AGCGAGAGCAGGCACGCAACCGGGAACACCATATACTTTGGCGAGGGCT CCTGGCTGACTGTGGTG ProteinSequence(22aa) (SEQIDNO:41) SESRHATGNTIYFGEGSWLTVV HumaniNKTTCRBetaChainClonedfromthe CD4CD8+(CD8SP)Subpopulation cDNAGenomicSequence(69bp) (SEQIDNO:42) AGTGTACCCGGGAACGACAGGGGCAATGAAAAACTGTTTTTTGGCAGTG GAACCCAGCTCTCTGTCTTG cDNACodon-OptimizedSequence(69bp) (SEQIDNO:43) TCCGTGCCTGGCAACGATAGAGGTAACGAGAAGCTGTTTTTCGGATCCG GCACACAGCTGTCTGTCCTG ProteinSequence(23aa) (SEQIDNO:44) SVPGNDRGNEKLFFGSGTQLSVL HumaniNKTTCRBetaChainClonedfromthe CD4CD8+(CD8SP)Subpopulation cDNAGenomicSequence(72bp) (SEQIDNO:45) AGTGAAGGGGGGGGCCTTAAGCTAGCCAAAAACATTCAGTACTTCGGCG CCGGGACCCGGCTCTCAGTGCTG cDNACodon-OptimizedSequence(72bp) (SEQIDNO:46) AGTGAGGGAGGGGGACTGAAGCTGGCTAAGAATATTCAGTACTTCGGCG CCGGCACTAGACTGTCTGTGCTG ProteinSequence(24aa) (SEQIDNO:47) SEGGGLKLAKNIQYFGAGTRLSVL HumaniNKTTCRBetaChainClonedfromthe CD4CD8-(DN)Subpopulation cDNAGenomicSequence(69bp) (SEQIDNO:48) AGTGAATTCGCCTCTTCGGTACGTGGAAACACCATATATTTTGGAGAGG GAAGTTGGCTCACTGTTGTA cDNACodon-OptimizedSequence(69bp) (SEQIDNO:49) TCTGAGTTCGCGAGCAGCGTCCGGGGTAATACCATTTACTTCGGGGAAG GCAGCTGGCTGACCGTGGTG ProteinSequence(23aa) (SEQIDNO:50) SEFASSVRGNTIYFGEGSWLTVV HumaniNKTTCRBetaChainClonedfromthe CD4CD8-(DN)Subpopulation cDNAGenomicSequence(60bp) (SEQIDNO:51) AGTGCGGCATTAGGCCGGGAGACCCAGTACTTCGGGCCAGGCACGCGGC TCCTGGTGCTC cDNACodon-OptimizedSequence(60bp) (SEQIDNO:52) TCTGCAGCCCTTGGCCGAGAGACTCAGTACTTCGGCCCTGGCACAAGAC TGCTCGTGCTC ProteinSequence(20aa) (SEQIDNO:53) SAALGRETQYFGPGTRLLVL HumaniNKTTCRBetaChainClonedfromthe CD4CD8-(DN)Subpopulation cDNAGenomicSequence(63bp) (SEQIDNO:54) AGTGCCTCCGGGGGTGAATCCTACGAGCAGTACTTCGGGCCGGGCACCA GGCTCACGGTCACA cDNACodon-OptimizedSequence(63bp) (SEQIDNO:55) AGCGCCTCCGGAGGAGAGTCATACGAACAGTATTTCGGCCCTGGCACAC GCCTCACTGTGACC ProteinSequence(21aa) (SEQIDNO:56) SASGGESYEQYFGPGTRLTVT HumaniNKTTCRBetaChainClonedfromthe CD4CD8-(DN)Subpopulation cDNAGenomicSequence(90bp) (SEQIDNO:57) AGCGGTCGGGTCTCGGGGGGCGATTCCCTCATAGCGTTTCTAGGCCAAG AGACCCAGTACTTCGGGCCAGGCACGCGGCTCCTGGTGCTC cDNACodon-OptimizedSequence(90bp) (SEQIDNO:58) TCAGGACGAGTGTCCGGAGGGGATAGCCTCATCGCATTTCTGGGGCAGG AAACTCAGTACTTCGGACCCGGAACACGCCTCCTGGTGCTG ProteinSequence(30aa) (SEQIDNO:59) SGRVSGGDSLIAFLGQETQYFGPGTRLLVL HumaniNKTTCRBetaChainClonedfromthe CD4CD8-(DN)Subpopulation cDNAGenomicSequence(69bp) (SEQIDNO:60) AGTGTACCCGGGAACGACAGGGGCAATGAAAAACTGTTTTTTGGCAGTG GAACCCAGCTCTCTGTCTTG cDNACodon-OptimizedSequence(69bp) (SEQIDNO:61) TCCGTGCCTGGCAACGATAGAGGTAACGAGAAGCTGTTTTTCGGATCCG GCACACAGCTGTCTGTCCTG ProteinSequence(23aa) (SEQIDNO:62) SVPGNDRGNEKLFFGSGTQLSVL
Statistical Analysis
[0098] Student's two-tailed t test was used for paired comparisons. Data are presented as meanSEM, unless otherwise indicated. P<0.01 was considered significant.
[0099] To the extent necessary, the following are herein incorporated by reference:
[0100] Restifo, N. P., Dudley, M. E. & Rosenberg, S. A. Adoptive immunotherapy for cancer: harnessing the T cell response. Nat Rev Immunol 12, 269-281, doi: 10.1038/nri3191 (2012).
[0101] Vivier, E., Ugolini, S., Blaise, D., Chabannon, C. & Brossay, L. Targeting natural killer cells and natural killer T cells in cancer. Nat Rev Immunol 12, 239-252,doi: 10.1038/nri3174 (2012).
[0102] Berzins, S. P., Smyth, M. J. & Baxter, A. G. Presumed guilty: natural killer T cell defects and human disease. Nat Rev Immunol 11, 131-142, doi: 10.1038/nri2904 (2011).
[0103] Bendelac, A., Savage, P. B. & Teyton, L. The biology of NKT cells. Annu Rev Immunol 25, 297-336, doi: 10.1146/annurev.immunol.25.022106.141711 (2007).
[0104] Yang, L. & Baltimore, D. Long-term in vivo provision of antigen-specific T cell immunity by programming hematopoietic stem cells. PNAS USA 102, 4518-4523, doi: 10.1073/pnas.0500600102 (2005).
[0105] Giannoni, F. et al. Allelic exclusion and peripheral reconstitution by TCR transgenic T cells arising from transduced human hematopoietic stem/progenitor cells. Molecular therapy: the journal of the American Society of Gene Therapy 21, 1044-1054, doi: 10.1038/mt.2013.8 (2013).
[0106] Vatakis, D. N. et al. Antitumor activity from antigen-specific CD8 T cells generated in vivo from genetically engineered human hematopoietic stem cells. PNAS USA 108, E1408-1416, doi: 10.1073/pnas. 1115050108 (2011).
[0107] Fujii, S., Shimizu, K., Kronenberg, M. & Steinman, R. M. Prolonged IFN-gamma-producing NKT response induced with alph-galactosylceramide-loaded DCs. Nat Immunol 3, 867-874, doi: 10.1038/ni827 (2002).
[0108] Lockridge, J. L. et al. Analysis of the CD1 antigen presenting system in humanized SCID mice. PLOS One 6, e21701, doi: 10.1371/journal.pone.0021701 (2011).
[0109] Sondergaard, J. N. et al. Differential sensitivity of melanoma cell lines with BRAFV600E mutation to the specific Raf inhibitor PLX4032. J Transl Med 8, 39, doi: 10.1186/1479-5876-8-39 (2010).
[0110] Godfrey, D. I. & Berzins, S. P. Control points in NKT-cell development. Nat Rev Immunol 7, 505-518, doi: 10.1038/nri2116 (2007).
[0111] Watarai, H., Nakagawa, R., Omori-Miyake, M., Dashtsoodol, N. & Taniguchi, M. Methods for detection, isolation and culture of mouse and human invariant NKT cells. Nat Protoc 3, 70-78, doi: 10.1038/nprot.2007.515 (2008).
[0112] Mattarollo, S. R. et al. NKT cell adjuvant-based tumor vaccine for treatment of myc oncogene-driven mouse B-cell lymphoma. Blood 120, 3019-3029, doi: 10.1182/blood-2012-04-426643 (2012).
[0113] Sznol, M. & Chen, L. Antagonist antibodies to PD-1 and B7-H1 (PD-L1) in the treatment of advanced human cancer. Clinical cancer research: an official journal of the American Association for Cancer Research 19, 1021-1034, doi: 10.1158/1078-0432.CCR-12-2063 (2013).
[0114] Morrison, S. J., Uchida, N. & Weissman, I. L. The biology of hematopoietic stem cells. Annu Rev Cell Dev Biol
[0115] 11, 35-71, doi: 10.1146/annurev.cb.11.110195.000343 (1995).
[0116] Baltimore, D., Witte, O. N., Yang, L., Economou, J. & Ribas, A. Overcoming barriers to programming a therapeutic cellular immune response to fight melanoma. Pigment Cell Melanoma Res 23, 288-289, doi: 10.1111/j.1755-148X.2010.00666.x (2010).
[0117] Chodon, T. et al. Adoptive transfer of MART-1 T-cell receptor transgenic lymphocytes and dendritic cell vaccination in patients with metastatic melanoma. Clinical cancer research: an official journal of the American Association for Cancer Research 20, 2457-2465, doi: 10.1158/1078-0432.CCR-13-3017 (2014).
[0118] OConnell, R. M. et al. Lentiviral vector delivery of human interleukin-7 (hIL-7) to human immune system (HIS) mice expands T lymphocyte populations. PLOS One 5, e12009, doi: 10.1371/journal.pone.0012009 (2010).
[0119] Chung B.A.H, G. S., Blumberg G., Klein S., Zhu J., Parekh C., Arumugam B., Yang O., Crooks G.M. Engineering the human thymic microenvironment to manipulate thymopoiesis in vivo. Stem Cells 32 (9): 2386-2396 (2014).
[0120] Blumenthal, M. et al. Effective suicide gene therapy for leukemia in a model of insertional oncogenesis in mice. Molecular therapy: the journal of the American Society of Gene Therapy 15, 183-192, doi: 10.1038/sj.mt.6300015 (2007).
[0121] Bendelac, A., Savage, P. B. & Teyton, L. The biology of NKT cells. Annu Rev Immunol 25, 297-336 (2007).
[0122] Luo, X. M. et al. Engineering human hematopoietic stem/progenitor cells to produce a broadly neutralizing anti-HIV antibody after in vitro maturation to human B lymphocytes. Blood 113, 1422-31 (2009).
[0123] Hur, E. M. et al. Inhibitory effect of HIV-specific neutralizing IgA on mucosal transmission of HIV in humanized mice. Blood 120, 4571-82 (2012).
[0124] Sun et al. Invariant natural killer T cells generated from human adult hematopoietic stem-progenitor cells are poly-functional. Cytokine 72:48-57 (2015).
[0125] Tian et al. The development of genetically modified K562 cells as artificial antigen presenting cells for NKT cells J. Immunol., 190:45.3 (2013).
[0126] All scientific and technical terms used in this application have meanings commonly used in the art unless otherwise specified.
[0127] As used herein, the term subject includes humans and non-human animals. The term non-human animal includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, horses, sheep, dogs, cows, pigs, chickens, and other veterinary subjects and test animals.
[0128] The use of the singular can include the plural unless specifically stated otherwise. As used in the specification and the appended claims, the singular forms a, an, and the can include plural referents unless the context clearly dictates otherwise. The use of or can mean and/or unless stated otherwise. As used herein, and/or means and or or. For example, A and/or B means A, B, or both A and B and A, B, C, and/or D means A, B, C, D, or a combination thereof and said combination thereof means any subset of A, B, C, and D, for example, a single member subset (e.g., A or B or C or D), a two-member subset (e.g., A and B; A and C; etc.), or a three-member subset (e.g., A, B, and C; or A, B, and D; etc.), or all four members (e.g., A, B, C, and D).
[0129] To the extent necessary to understand or complete the disclosure of the present invention, all publications, patents, and patent applications mentioned herein are expressly incorporated by reference therein to the same extent as though each were individually so incorporated.
[0130] Having thus described exemplary embodiments of the present invention, it should be noted by those skilled in the art that the within disclosures are exemplary only and that various other alternatives, adaptations, and modifications may be made within the scope of the present invention. Accordingly, the present invention is not limited to the specific embodiments as illustrated herein, but is only limited by the following claims.