Compositions and methods concerning immune tolerance

12383617 · 2025-08-12

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure provides compositions comprising mannose-fused antigens to target mannose receptors. The compositions may be used to prevent immunity or reduce an immune response protein-based drugs that would otherwise elicit an immune response.

Claims

1. A compound of Formula 1:
X[Y(Z).sub.p].sub.mR.sup.2 Formula 1 where: X comprises an antigen, a tolerogenic portion thereof, or a mimetic thereof; Y comprises a linker moiety; Z comprises a moiety that specifically targets a mannose receptor; p is an integer from 2 to 250; m is an integer from 1 to 100; R.sup.2 is any of functional groups I-III: ##STR00047## where Ar is a substituted or unsubstituted aromatic group and one or more of: R.sup.3 is C.sub.1-6-alkyl; or R.sup.11 is C.sub.1-6-alkyl.

2. The compound of claim 1, wherein the moiety that specifically targets a mannose receptor is selected from the group consisting of -linked mannose, -linked mannose, substituted mannose, mannose-6-phosphate, N-acetyl mannosamine, and mannan having (1-4), (1-6), (1-2), and/or (1-3) linkages.

3. The compound of claim 1, wherein Y is a linker resulting from reaction of at least one of a N-hydroxysuccinamidyl linker, maleimide linker, PEG linker, vinylsulfone linker, pyridyl di-thiol-poly (ethylene glycol) linker, pyridyl di-thiol linker, n-nitrophenyl carbonate linker, NHS-ester linker, and nitrophenoxy poly (ethylene glycol) ester linker.

4. The compound of claim 3, wherein Y is covalently bound to X.

5. The compound of claim 1, wherein [Y(Z).sub.p] is represented by one of Formula Ya to Yr: ##STR00048## ##STR00049## where n is an integer from 1 to 100; q is an integer from 1 to 44; k is an integer from 1 to 12; i is an integer from 0 to 20; v is an integer from 1 to 4; p is an integer from 2 to 250; r is an integer from 0 to 250; R.sub.1 is CH.sub.2, (CH.sub.2).sub.2C(CH.sub.3)(CN), (CH.sub.2).sub.2C(CH.sub.3)(CH.sub.3), (CH.sub.2).sub.2CH(CH.sub.3) or CH(CH.sub.3); W.sup.1 and W.sup.2 are as defined below: ##STR00050## R.sup.9 is a direct bond, (CH2)2-NHC(O) (an ethylaceetamido group or EtAcN) or (CH2)2-(OCH2-CH2)t-NHC(O) (a pegylated ethylacetamido group or Et-PEGt-AcN) t is an integer from 1 to 5; Z is mannose or a mannose receptor-targeting moiety; and R.sup.10 is an aliphatic group, an alcohol, an aliphatic amine-containing group, or an aliphatic alcohol.

6. The compound of claim 1, wherein Y is an antibody, antibody fragment, peptide or other ligand that binds to X.

7. The compound of claim 1, wherein X is an antigen against which a patient may develop or has developed an unwanted immune response.

8. The compound of claim 7, wherein the antigen is a foreign transplant antigen, an alloantigen, an autoimmune antigen, a food antigen, an animal antigen, a plant antigen, an environmental antigen, a therapeutic antigen, a synthetic self-antigen, or a tolerogenic portion thereof.

9. The compound of claim 8, wherein X is an asparaginase antigen or an ovalbumin antigen.

10. The compound of claim 1, wherein the mannose receptor is mannose-6-phosphate receptor.

11. The compound of claim 1, wherein Y and X are connected through a bond configured to cleave when the compound reaches a target area.

12. The compound of claim 1, wherein Ar is selected from: ##STR00051## where each instance of R, where present, is independently selected from an optionally substituted C.sub.1-6-alkyl, optionally substituted C.sub.1-6 alkoxy, optionally substituted amino, OH, or halogen and wherein, X is a heteroatom.

13. The compound of claim 12 wherein X is N.

14. The compound of claim 1, wherein R.sup.11 is CH.sub.3.

15. A composition comprising the compound of claim 1.

16. A method of inducing immunological tolerance to an antigen target comprising administering to a subject a composition Formula 1:
X[Y(Z).sub.p].sub.mR.sup.2 Formula 1 where: X comprises an antigen, a tolerogenic portion thereof, or a mimetic thereof; Y comprises a linker moiety; Z comprises a moiety that specifically targets a mannose receptor; p is an integer from 2 to 250; m is an integer from 1 to 100; R.sup.2 is any of functional groups I-III: ##STR00052## where Ar is a substituted or unsubstituted aromatic group and one or more of: R.sup.3 is C.sub.1-6-alkyl; or R.sup.11 is C.sub.1-6- alkyl.

17. The method of claim 16, wherein the moiety that specifically targets a mannose receptor is selected from the group consisting of -linked mannose, -linked mannose, substituted mannose, mannose-6-phosphate, N-acetyl mannosamine, and mannan having (1-4), (1-6), (1-2), and/or (1-3) linkages.

Description

BRIEF DESCRIPTION OF THE FIGURES

(1) The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.

(2) FIGS. 1A-1G. OVA-p(Man) induces T cell deletion. BLK6 mice were treated with saline, or 10 g of OVA in the form of free OVA or OVA conjugated to p(Man) (OVA-p(Man)) one day and 7 days after an adoptive transfer of 7.0105 OTI and OTII T cells. The mice were challenged with an intradermal injection of LSP and OVA on 14 days after the initial OTI and OTII T cell transfer, then the immune response in the draining lymph nodes (dLNs) was assessed on day 19 via flow cytometry. FIG. 1A Fraction of OTII T cells in the dLNs on day 19. FIG. 1B Fraction of OTI T cells in the dLNs on day 19. FIG. 1C Fraction of OTII T cells in the liver on day 19. FIG. 1D Fraction of OTI T cells in the liver on day 19. FIG. 1E Fraction of Tregs in the dLN on day 19. FIG. 1F Fraction of Tregs in the liver on day 19. FIG. 1G Fraction of T follicular helper cells (Tfh) as a fraction of total CD4 T cells in the dLNs on day 19.

(3) FIGS. 2A-2B: OVA-p(Man) induces T cells Anergy in DLs. BLK6 mice were treated with saline, or 10 g of OVA in the form of free OVA or OVA conjugated to p(Man) (OVA-p(Man)) one day and 7 days after an adoptive transfer of 7.0105 OTI and OTII T cells. The mice were challenged with an intradermal injection of LPS and OVA on 14 days after the initial OTI and OTII T cell transfer, and immune response in the draining lymph nodes (dLNs) was assessed on day 19. Cells from the dLN were restimulated with OVA (A) or SIINFEKL (peptide) for 6 hours, then the percentage of IFN- producing cells was determined by flow cytometry. FIG. 2A Percentage of IFN- producing CD4+ T cells in the dLNs. FIG. 2B Percentage of IFN- producing CD8+ T cells in the dLNs.

(4) FIGS. 3A-3D. Tolerance induction to protein therapeutics. Five BALB/c mice per group were injected with 2.5 g of asparaginase formulated as free asparaginase (ASNase) or conjugated to p(Man) (ASNase-p(Man)) once a week for 3 weeks and then were switched to 15 g of ASNase i.v. one a week for 8 weeks. During the initial 3 weeks ASNase-p(Man) was administered via either i.v. or subcutaneous injection. Sera was taken from the mice and monitored weekly for the presence of ASNase. FIG. 3A Pan IgG ASNase titers of mice treated with ASNase and ASNase-p(Man) via i.v. and subcutaneous injection. FIG. 3B ASNase IgG1 titers of treatment groups on day 38. FIG. 3C ASNase IgG2a titers of treatment groups on day 38. FIG. 3D ASNase IgG2b titers of treatment groups on day 38. FIG. 3E. ASNase IgG3 titers of treatment groups on day 38.

(5) FIGS. 4A-4B. Response to p(Man) conjugates. FIG. 4A Bone marrow of animals treated with ASNase-p(Man) had fewer ASNase plasma cells than animals that were treated with ASNase. FIG. 4B Spleens of animals treated with ASNase-p(Man) had a greater percentage of IL-10 producing B regulatory cells.

(6) FIG. 5. Tolerance induction to protein therapeutics. FIG. 5 is a graph depicting tolerance induction to the protein therapeutic asparaginase conjugated to p(Man) linker and mannose. Five BALB/c mice per group were injected with 2.5 g of asparaginase formulated as free asparaginase (ASNase) or conjugated to p(Man) (ASNase-p(Man)) once a week for 3 weeks and then were switched to 15 g of ASNase i.v. one a week for 7 weeks. Sera was taken from the mice and monitored weekly for the presence of anti-ASNase. Over the entire time of analysis none of the animals treated with ASNase-p(Man) developed measureable levels of antibodies against ASNase.

(7) FIG. 6 p(Man)-ASNase administration regimen for assessment of p(Man)-protein conjugates on anti-asparaginase (anti-ASNase) humoral immune response.

(8) FIGS. 7A-7B. Assessment of p(Man)-protein conjugates on anti-asparaginase (anti-ASNase) humoral immune response. FIG. 7A is a graph depicting serum asparagine concentration for days 71, 73, and 76. Mice treated with only saline or p(Man)-ASNase have a significantly lower serum asparagine concentration as compared to animals that had been treated with saline and then administered wt ASNase. FIG. 7B is a graph depicting serum asparagine concentration vs the anti-ASNase titer for each animal in the study. A strong correlation (r=0.8) between serum asparagine concentration and anti-ASNase titer is evident.

DETAILED DESCRIPTION

(9) Several embodiments disclosed herein overcome the deficiencies of the prior art by providing compositions comprising mannose-fused antigens. The compositions may be used to prevent immunity or reduce an immune response protein-based drugs that would otherwise elicit an immune response.

(10) Multiple mannose binding receptors are expressed by antigen presenting cells (APCs) and serve as gateways for antigen uptake and antigen cross presentation by these cells to T cells. Antigens taken up by APCs and presented to T cells in the absence of co-stimulation leads to T cell deletion, inactivity, and the formation of T regulator cells, that control antigen specific immune responses.

(11) The present disclosure provides, in several embodiments, certain therapeutic compositions that are targeted for delivery to (and for uptake by) antigen presenting cells, particularly hepatocytes, LSECs, Kupffer cells and/or stellate cells, more particularly hepatocytes and/or LSECs, and even more particularly to specifically bind mannose-binding receptors.

(12) Liver targeting facilitates two mechanisms of treatment: tolerization and clearance. Tolerization takes advantage of the liver's role in clearing apoptotic cells and processing their proteins to be recognized by the immune system as self, as well as the liver's role in sampling peripheral proteins for immune tolerance. Clearance takes advantage of the liver's role in blood purification by rapidly removing and breaking down toxins, polypeptides and the like. Targeting of these compositions to the liver is accomplished by a mannosating moiety. The mannosylating moiety is chemically conjugated. The antigen can be endogenous (a self-antigen) or exogenous (a foreign antigen), including but not limited to: a foreign transplant antigen against which transplant recipients develop an unwanted immune response (e.g., transplant rejection), a foreign food, animal, plant or environmental antigen to which patients develop an unwanted immune (e.g., allergic or hypersensitivity) response, a therapeutic agent to which patients develop an unwanted immune response (e.g., hypersensitivity and/or reduced therapeutic activity), a self-antigen to which patients develop an unwanted immune response (e.g., autoimmune disease), or a tolerogenic portion (e.g., a fragment or an epitope) thereof; these compositions are useful for inducing tolerization to the antigen. Accordingly, the compositions of the present disclosure can be used for treating an unwanted immune response, e.g., transplant rejection, an immune response against a therapeutic agent, an autoimmune disease, and/or an allergy, depending on the embodiment. Also provided are pharmaceutical compositions containing a therapeutically effective amount of a composition of the disclosure admixed with at least one pharmaceutically acceptable excipient. In another aspect, the disclosure provides methods for the treatment of an unwanted immune response, such as transplant rejection, response against a therapeutic agent, autoimmune disease or allergy.

B. CHEMICAL DEFINITIONS

(13) As used herein, a small molecule refers to an organic compound that is either synthesized via conventional organic chemistry methods (e.g., in a laboratory) or found in nature. Typically, a small molecule is characterized in that it contains several carbon-carbon bonds, and has a molecular weight of less than about 1500 grams/mole. In certain embodiments, small molecules are less than about 1000 grams/mole. In certain embodiments, small molecules are less than about 550 grams/mole. In certain embodiments, small molecules are between about 200 and about 550 grams/mole. In certain embodiments, small molecules exclude peptides (e.g., compounds comprising 2 or more amino acids joined by a peptidyl bond). In certain embodiments, small molecules exclude nucleic acids.

(14) As used herein, the term amino means NH2; the term nitro means NO2; the term halo or halogen designates F, Cl, Br or I; the term mercapto means SH; the term cyano means CN; the term azido means N3; the term silyl means SiH3, and the term hydroxy means OH. In certain embodiments, a halogen may be Br or I.

(15) As used herein, a monovalent anion refers to anions of a 1 charge. Such anions are well-known to those of skill in the art. Non-limiting examples of monovalent anions include halides (e.g., F, Cl, Br and I), NO2-, NO3-, hydroxide (OH) and azide (N3-).

(16) As used herein, the structure indicates that the bond may be a single bond or a double bond. Those of skill in the chemical arts understand that in certain circumstances, a double bond between two particular atoms is chemically feasible and in certain circumstances, a double bond is not. The present invention therefore contemplates that a double bond may be formed only when chemically feasible.

(17) The term alkyl includes straight-chain alkyl, branched-chain alkyl, cycloalkyl (alicyclic), cyclic alkyl, heteroatom-unsubstituted alkyl, heteroatom-substituted alkyl, heteroatom-unsubstituted Cn-alkyl, and heteroatom-substituted Cn-alkyl. In certain embodiments, lower alkyls are contemplated. Examples of branched alkyl groups include, but are not limited to, iso-propyl, sec-butyl, t-butyl and the like. Examples of straight chain alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, n-butyl, n-pentyl, n-hexyl, n-heptyl and the like. The alkyl group may have 1 to 30 carbon atoms (whenever it appears herein, a numerical range such as 1 to 30 refers to each integer in the given range; e.g., 1 to 30 carbon atoms means that the alkyl group may consist of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 carbon atoms, although the present definition also covers the occurrence of the term alkyl where no numerical range is designated). The alkyl group may also be a medium size alkyl having 1 to 12 carbon atoms. The term lower alkyl refers to alkyls of 1-6 carbon atoms (that is, 1, 2, 3, 4, 5 or 6 carbon atoms). The term heteroatom-unsubstituted Cn-alkyl refers to a radical, having a linear or branched, cyclic or acyclic structure, further having no carbon-carbon double or triple bonds, further having a total of n carbon atoms, all of which are nonaromatic, 3 or more hydrogen atoms, and no heteroatoms. For example, a heteroatom-unsubstituted C1-C10-alkyl has 1 to 10 carbon atoms. The groups, CH3 (Me), CH2CH3 (Et), CH2CH2CH3 (n-Pr), CH(CH3)2 (iso-Pr), CH(CH2)2 (cyclopropyl), CH2CH2CH2CH3 (n-Bu), CH(CH3)CH2CH3 (sec-butyl), CH2CH(CH3)2 (iso-butyl), C(CH3)3 (tert-butyl), CH2C(CH3)3 (neo-pentyl), cyclobutyl, cyclopentyl, and cyclohexyl, are all non-limiting examples of heteroatom-unsubstituted alkyl groups. The term heteroatom-substituted Cn-alkyl refers to a radical, having a single saturated carbon atom as the point of attachment, no carbon-carbon double or triple bonds, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, all of which are nonaromatic, 0, 1, or more than one hydrogen atom, at least one heteroatom, wherein each heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C1-C10-alkyl has 1 to 10 carbon atoms. The following groups are all non-limiting examples of heteroatom-substituted alkyl groups: trifluoromethyl, CH2F, CH2Cl, CH2Br, CH2OH, CH2OCH3, CH2OCH2CF3, CH2OC(O)CH3, CH2NH2, CH2NHCH3, CH2N(CH3)2, CH2CH2Cl, CH2CH2OH, CH2CH2OC(O)CH3, CH2CH2NHCO2C(CH3)3, and CH2Si(CH3)3.

(18) As used herein, the term alkylene refers to a bivalent fully saturated straight chain aliphatic hydrocarbon group. Examples of alkylene groups include, but are not limited to, methylene, ethylene, propylene, butylene, pentylene hexylene, heptylene and octylene. An alkylene group may be represented by custom character, followed by the number of carbon atoms, followed by a *. For example,

(19) ##STR00032##
to represent ethylene. The alkylene group may have 1 to 30 carbon atoms (whenever it appears herein, a numerical range such as 1 to 30 refers to each integer in the given range; e.g., 1 to 30 carbon atoms means that the alkyl group may consist of 1 carbon atom, 2 carbon atoms, 3 carbon atoms, etc., up to and including 30 carbon atoms, although the present definition also covers the occurrence of the term alkylene where no numerical range is designated). The alkylene group may also be a medium size alkyl having 1 to 12 carbon atoms. The alkylene group could also be a lower alkyl having 1 to 4 carbon atoms. An alkylene group may be substituted or unsubstituted. For example, a lower alkylene group can be substituted by replacing one or more hydrogen of the lower alkylene group and/or by substituting both hydrogens on the same carbon with a C3-6 monocyclic cycloalkyl group (e.g.,

(20) ##STR00033##

(21) The term alkenyl includes straight-chain alkenyl, branched-chain alkenyl, cycloalkenyl, cyclic alkenyl, heteroatom-unsubstituted alkenyl, heteroatom-substituted alkenyl, heteroatom-unsubstituted Cn-alkenyl, and heteroatom-substituted Cn-alkenyl. In certain embodiments, lower alkenyls are contemplated. The term lower alkenyl refers to alkenyls of 1-6 carbon atoms (that is, 1, 2, 3, 4, 5 or 6 carbon atoms). The term heteroatom-unsubstituted Cn-alkenyl refers to a radical, having a linear or branched, cyclic or acyclic structure, further having at least one nonaromatic carbon-carbon double bond, but no carbon-carbon triple bonds, a total of n carbon atoms, three or more hydrogen atoms, and no heteroatoms. For example, a heteroatom-unsubstituted C2-C10-alkenyl has 2 to 10 carbon atoms. Heteroatom-unsubstituted alkenyl groups include: CHCH2 (vinyl), CHCHCH3, CHCHCH2CH3, CH2CHCH2 (allyl), CH2CHCHCH3, and CHCHC6H5. The term heteroatom-substituted Cn-alkenyl refers to a radical, having a single nonaromatic carbon atom as the point of attachment and at least one nonaromatic carbon-carbon double bond, but no carbon-carbon triple bonds, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, 0, 1, or more than one hydrogen atom, and at least one heteroatom, wherein each heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C2-C10-alkenyl has 2 to 10 carbon atoms. The groups, CHCHF, CHCHCl and CHCHBr, are non-limiting examples of heteroatom-substituted alkenyl groups.

(22) The term aryl includes heteroatom-unsubstituted aryl, heteroatom-substituted aryl, heteroatom-unsubstituted Cn-aryl, heteroatom-substituted Cn-aryl, heteroaryl, heterocyclic aryl groups, carbocyclic aryl groups, biaryl groups, and single-valent radicals derived from polycyclic fused hydrocarbons (PAHs). The term heteroatom-unsubstituted Cn-aryl refers to a radical, having a single carbon atom as a point of attachment, wherein the carbon atom is part of an aromatic ring structure containing only carbon atoms, further having a total of n carbon atoms, 5 or more hydrogen atoms, and no heteroatoms. For example, a heteroatom-unsubstituted C6-C10-aryl has 6 to 10 carbon atoms. Non-limiting examples of heteroatom-unsubstituted aryl groups include phenyl (Ph), methylphenyl, (dimethyl)phenyl, C6H4CH2CH3, C6H4CH2CH2CH3, C6H4CH(CH3)2, C6H4CH(CH2)2, C6H3(CH3)CH2CH3, C6H4CHCH2, C6H4CHCHCH3, C6H4CCH, C6H4CCCH3, naphthyl, and the radical derived from biphenyl. The term heteroatom-substituted Cn-aryl refers to a radical, having either a single aromatic carbon atom or a single aromatic heteroatom as the point of attachment, further having a total of n carbon atoms, at least one hydrogen atom, and at least one heteroatom, further wherein each heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-unsubstituted C1-C10-heteroaryl has 1 to 10 carbon atoms. Non-limiting examples of heteroatom-substituted aryl groups include the groups: C6H4F, C6H4Cl, C6H4Br, C6H4I, C6H4OH, C6H4OCH3, C6H4OCH2CH3, C6H4OC(O)CH3, C6H4NH2, C6H4NHCH3, C6H4N(CH3)2, C6H4CH2OH, C6H4CH2OC(O)CH3, C6H4CH2NH2, C6H4CF3, C6H4CN, C6H4CHO, C6H4CHO, C6H4C(O)CH3, C6H4C(O)C6H5, C6H4CO2H, C6H4CO2CH3, C6H4CONH2, C6H4CONHCH3, C6H4CON(CH3)2, furanyl, thienyl, pyridyl, pyrrolyl, pyrimidyl, pyrazinyl, quinolyl, indolyl, and imidazoyl. In certain embodiments, heteroatom-substituted aryl groups are contemplated. In certain embodiments, heteroatom-unsubstituted aryl groups are contemplate. In certain embodiments, an aryl group may be mono-, di-, tri-, tetra- or penta-substituted with one or more heteroatom-containing substitutents.

(23) The term aralkyl includes heteroatom-unsubstituted aralkyl, heteroatom-substituted aralkyl, heteroatom-unsubstituted Cn-aralkyl, heteroatom-substituted Cn-aralkyl, heteroaralkyl, and heterocyclic aralkyl groups. In certain embodiments, lower aralkyls are contemplated. The term lower aralkyl refers to aralkyls of 7-12 carbon atoms (that is, 7, 8, 9, 10, 11 or 12 carbon atoms). The term heteroatom-unsubstituted Cn-aralkyl refers to a radical, having a single saturated carbon atom as the point of attachment, further having a total of n carbon atoms, wherein at least 6 of the carbon atoms form an aromatic ring structure containing only carbon atoms, 7 or more hydrogen atoms, and no heteroatoms. For example, a heteroatom-unsubstituted C7-C10-aralkyl has 7 to 10 carbon atoms. Non-limiting examples of heteroatom-unsubstituted aralkyls are: phenylmethyl (benzyl, Bn) and phenylethyl. The term heteroatom-substituted Cn-aralkyl refers to a radical, having a single saturated carbon atom as the point of attachment, further having a total of n carbon atoms, 0, 1, or more than one hydrogen atom, and at least one heteroatom, wherein at least one of the carbon atoms is incorporated an aromatic ring structures, further wherein each heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C2-C10-heteroaralkyl has 2 to 10 carbon atoms.

(24) The term acyl includes straight-chain acyl, branched-chain acyl, cycloacyl, cyclic acyl, heteroatom-unsubstituted acyl, heteroatom-substituted acyl, heteroatom-unsubstituted Cn-acyl, heteroatom-substituted Cn-acyl, alkylcarbonyl, alkoxycarbonyl and aminocarbonyl groups. In certain embodiments, lower acyls are contemplated. The term lower acyl refers to acyls of 1-6 carbon atoms (that is, 1, 2, 3, 4, 5 or 6 carbon atoms). The term heteroatom-unsubstituted Cn-acyl refers to a radical, having a single carbon atom of a carbonyl group as the point of attachment, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, 1 or more hydrogen atoms, a total of one oxygen atom, and no additional heteroatoms. For example, a heteroatom-unsubstituted C1-C10-acyl has 1 to 10 carbon atoms. The groups, CHO, C(O)CH3, C(O)CH2CH3, C(O)CH2CH2CH3, C(O)CH(CH3)2, C(O)CH(CH2)2, C(O)C6H5, C(O)C6H4CH3, C(O)C6H4CH2CH3, and COC6H3(CH3)2, are non-limiting examples of heteroatom-unsubstituted acyl groups. The term heteroatom-substituted Cn-acyl refers to a radical, having a single carbon atom as the point of attachment, the carbon atom being part of a carbonyl group, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, 0, 1, or more than one hydrogen atom, at least one additional heteroatom, in addition to the oxygen of the carbonyl group, wherein each additional heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C1-C10-acyl has 1 to 10 carbon atoms. The groups, C(O)CH2CF3, CO2H, CO2-, CO2CH3, CO2CH2CH3, CO2CH2CH2CH3, CO2CH(CH3)2, CO2CH(CH2)2, C(O)NH2 (carbamoyl), C(O)NHCH3, C(O)NHCH2CH3, CONHCH(CH3)2, CONHCH(CH2)2, CON(CH3)2, and CONHCH2CF3, are non-limiting examples of heteroatom-substituted acyl groups.

(25) The term alkoxy includes straight-chain alkoxy, branched-chain alkoxy, cycloalkoxy, cyclic alkoxy, heteroatom-unsubstituted alkoxy, heteroatom-substituted alkoxy, heteroatom-unsubstituted Cn-alkoxy, and heteroatom-substituted Cn-alkoxy. In certain embodiments, lower alkoxys are contemplated. The term lower alkoxy refers to alkoxys of 1-6 carbon atoms (that is, 1, 2, 3, 4, 5 or 6 carbon atoms). The term heteroatom-unsubstituted Cn-alkoxy refers to a group, having the structure OR, in which R is a heteroatom-unsubstituted Cn-alkyl, as that term is defined above. Heteroatom-unsubstituted alkoxy groups include: OCH3, OCH2CH3, OCH2CH2CH3, OCH(CH3)2, and OCH(CH2)2. The term heteroatom-substituted Cn-alkoxy refers to a group, having the structure OR, in which R is a heteroatom-substituted Cn-alkyl, as that term is defined above. For example, OCH2CF3 is a heteroatom-substituted alkoxy group.

(26) The term alkenyloxy includes straight-chain alkenyloxy, branched-chain alkenyloxy, cycloalkenyloxy, cyclic alkenyloxy, heteroatom-unsubstituted alkenyloxy, heteroatom-substituted alkenyloxy, heteroatom-unsubstituted Cn-alkenyloxy, and heteroatom-substituted Cn-alkenyloxy. The term heteroatom-unsubstituted Cn-alkenyloxy refers to a group, having the structure OR, in which R is a heteroatom-unsubstituted Cn-alkenyl, as that term is defined above. The term heteroatom-substituted Cn-alkenyloxy refers to a group, having the structure OR, in which R is a heteroatom-substituted Cn-alkenyl, as that term is defined above.

(27) The term alkynyloxy includes straight-chain alkynyloxy, branched-chain alkynyloxy, cycloalkynyloxy, cyclic alkynyloxy, heteroatom-unsubstituted alkynyloxy, heteroatom-substituted alkynyloxy, heteroatom-unsubstituted Cn-alkynyloxy, and heteroatom-substituted Cn-alkynyloxy. The term heteroatom-unsubstituted Cn-alkynyloxy refers to a group, having the structure OR, in which R is a heteroatom-unsubstituted Cn-alkynyl, as that term is defined above. The term heteroatom-substituted Cn-alkynyloxy refers to a group, having the structure OR, in which R is a heteroatom-substituted Cn-alkynyl, as that term is defined above.

(28) The term aryloxy includes heteroatom-unsubstituted aryloxy, heteroatom-substituted aryloxy, heteroatom-unsubstituted Cn-aryloxy, heteroatom-substituted Cn-aryloxy, heteroaryloxy, and heterocyclic aryloxy groups. The term heteroatom-unsubstituted Cn-aryloxy refers to a group, having the structure OAr, in which Ar is a heteroatom-unsubstituted Cn-aryl, as that term is defined above. A non-limiting example of a heteroatom-unsubstituted aryloxy group is OC6H5. The term heteroatom-substituted Cn-aryloxy refers to a group, having the structure OAr, in which Ar is a heteroatom-substituted Cn-aryl, as that term is defined above.

(29) The term aralkyloxy includes heteroatom-unsubstituted aralkyloxy, heteroatom-substituted aralkyloxy, heteroatom-unsubstituted Cn-aralkyloxy, heteroatom-substituted Cn-aralkyloxy, heteroaralkyloxy, and heterocyclic aralkyloxy groups. The term heteroatom-unsubstituted Cn-aralkyloxy refers to a group, having the structure OAr, in which Ar is a heteroatom-unsubstituted Cn-aralkyl, as that term is defined above. The term heteroatom-substituted Cn-aralkyloxy refers to a group, having the structure OAr, in which Ar is a heteroatom-substituted Cn-aralkyl, as that term is defined above.

(30) The term acyloxy includes straight-chain acyloxy, branched-chain acyloxy, cycloacyloxy, cyclic acyloxy, heteroatom-unsubstituted acyloxy, heteroatom-substituted acyloxy, heteroatom-unsubstituted Cn-acyloxy, heteroatom-substituted Cn-acyloxy, alkylcarbonyloxy, arylcarbonyloxy, alkoxycarbonyloxy, aryloxycarbonyloxy, and carboxylate groups. The term heteroatom-unsubstituted Cn-acyloxy refers to a group, having the structure OAc, in which Ac is a heteroatom-unsubstituted Cn-acyl, as that term is defined above. For example, OC(O)CH.sub.3 is a non-limiting example of a heteroatom-unsubstituted acyloxy group. The term heteroatom-substituted Cn-acyloxy refers to a group, having the structure OAc, in which Ac is a heteroatom-substituted Cn-acyl, as that term is defined above. For example, OC(O)OCH.sub.3 and OC(O)NHCH.sub.3 are non-limiting examples of heteroatom-unsubstituted acyloxy groups.

(31) The term alkylamino includes straight-chain alkylamino, branched-chain alkylamino, cycloalkylamino, cyclic alkylamino, heteroatom-unsubstituted alkylamino, heteroatom-substituted alkylamino, heteroatom-unsubstituted Cn-alkylamino, and heteroatom-substituted Cn-alkylamino. The term heteroatom-unsubstituted Cn-alkylamino refers to a radical, having a single nitrogen atom as the point of attachment, further having one or two saturated carbon atoms attached to the nitrogen atom, further having a linear or branched, cyclic or acyclic structure, containing a total of n carbon atoms, all of which are nonaromatic, 4 or more hydrogen atoms, a total of 1 nitrogen atom, and no additional heteroatoms. For example, a heteroatom-unsubstituted C1-C10-alkylamino has 1 to 10 carbon atoms. The term heteroatom-unsubstituted Cn-alkylamino includes groups, having the structure NHR, in which R is a heteroatom-unsubstituted Cn-alkyl, as that term is defined above. A heteroatom-unsubstituted alkylamino group would include NHCH.sub.3, NHCH.sub.2CH.sub.3, NHCH.sub.2CH.sub.2CH.sub.3, NHCH(CH.sub.3).sub.2, NHCH(CH.sub.2).sub.2, NHCH.sub.2CH.sub.2CH.sub.2CH.sub.3, NHCH(CH.sub.3)CH.sub.2CH.sub.3, NHCH.sub.2CH(CH.sub.3).sub.2, NHC(CH.sub.3).sub.3, N(CH.sub.3).sub.2, N(CH.sub.3)CH.sub.2CH.sub.3, N(CH.sub.2CH.sub.3).sub.2, N-pyrrolidinyl, and N-piperidinyl. The term heteroatom-substituted Cn-alkylamino refers to a radical, having a single nitrogen atom as the point of attachment, further having one or two saturated carbon atoms attached to the nitrogen atom, no carbon-carbon double or triple bonds, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, all of which are nonaromatic, 0, 1, or more than one hydrogen atom, and at least one additional heteroatom, that is, in addition to the nitrogen atom at the point of attachment, wherein each additional heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C.sub.1-C.sub.10-alkylamino has 1 to 10 carbon atoms. The term heteroatom-substituted Cn-alkylamino includes groups, having the structure NHR, in which R is a heteroatom-substituted Cn-alkyl, as that term is defined above.

(32) The term alkenylamino includes straight-chain alkenylamino, branched-chain alkenylamino, cycloalkenylamino, cyclic alkenylamino, heteroatom-unsubstituted alkenylamino, heteroatom-substituted alkenylamino, heteroatom-unsubstituted Cn-alkenylamino, heteroatom-substituted Cn-alkenylamino, dialkenylamino, and alkyl(alkenyl)amino groups. The term heteroatom-unsubstituted Cn-alkenylamino refers to a radical, having a single nitrogen atom as the point of attachment, further having one or two carbon atoms attached to the nitrogen atom, further having a linear or branched, cyclic or acyclic structure, containing at least one nonaromatic carbon-carbon double bond, a total of n carbon atoms, 4 or more hydrogen atoms, a total of one nitrogen atom, and no additional heteroatoms. For example, a heteroatom-unsubstituted C2-C10-alkenylamino has 2 to 10 carbon atoms. The term heteroatom-unsubstituted Cn-alkenylamino includes groups, having the structure NHR, in which R is a heteroatom-unsubstituted Cn-alkenyl, as that term is defined above. The term heteroatom-substituted Cn-alkenylamino refers to a radical, having a single nitrogen atom as the point of attachment and at least one nonaromatic carbon-carbon double bond, but no carbon-carbon triple bonds, further having one or two carbon atoms attached to the nitrogen atom, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, 0, 1, or more than one hydrogen atom, and at least one additional heteroatom, that is, in addition to the nitrogen atom at the point of attachment, wherein each additional heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C.sub.2-C.sub.10-alkenylamino has 2 to 10 carbon atoms. The term heteroatom-substituted Cn-alkenylamino includes groups, having the structure NHR, in which R is a heteroatom-substituted Cn-alkenyl, as that term is defined above.

(33) The term alkynylamino includes straight-chain alkynylamino, branched-chain alkynylamino, cycloalkynylamino, cyclic alkynylamino, heteroatom-unsubstituted alkynylamino, heteroatom-substituted alkynylamino, heteroatom-unsubstituted Cn-alkynylamino, heteroatom-substituted Cn-alkynylamino, dialkynylamino, alkyl(alkynyl)amino, and alkenyl(alkynyl)amino groups. The term heteroatom-unsubstituted Cn-alkynylamino refers to a radical, having a single nitrogen atom as the point of attachment, further having one or two carbon atoms attached to the nitrogen atom, further having a linear or branched, cyclic or acyclic structure, containing at least one carbon-carbon triple bond, a total of n carbon atoms, at least one hydrogen atoms, a total of one nitrogen atom, and no additional heteroatoms. For example, a heteroatom-unsubstituted C2-C10-alkynylamino has 2 to 10 carbon atoms. The term heteroatom-unsubstituted Cn-alkynylamino includes groups, having the structure NHR, in which R is a heteroatom-unsubstituted Cn-alkynyl, as that term is defined above. The term heteroatom-substituted Cn-alkynylamino refers to a radical, having a single nitrogen atom as the point of attachment, further having one or two carbon atoms attached to the nitrogen atom, further having at least one nonaromatic carbon-carbon triple bond, further having a linear or branched, cyclic or acyclic structure, and further having a total of n carbon atoms, 0, 1, or more than one hydrogen atom, and at least one additional heteroatom, that is, in addition to the nitrogen atom at the point of attachment, wherein each additional heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C.sub.2-C.sub.10-alkynylamino has 2 to 10 carbon atoms. The term heteroatom-substituted Cn-alkynylamino includes groups, having the structure NHR, in which R is a heteroatom-substituted Cn-alkynyl, as that term is defined above.

(34) The term arylamino includes heteroatom-unsubstituted arylamino, heteroatom-substituted arylamino, heteroatom-unsubstituted Cn-arylamino, heteroatom-substituted Cn-arylamino, heteroarylamino, heterocyclic arylamino, and alkyl(aryl)amino groups. The term heteroatom-unsubstituted Cn-arylamino refers to a radical, having a single nitrogen atom as the point of attachment, further having at least one aromatic ring structure attached to the nitrogen atom, wherein the aromatic ring structure contains only carbon atoms, further having a total of n carbon atoms, 6 or more hydrogen atoms, a total of one nitrogen atom, and no additional heteroatoms. For example, a heteroatom-unsubstituted C.sub.6-C.sub.10-arylamino has 6 to 10 carbon atoms. The term heteroatom-unsubstituted Cn-arylamino includes groups, having the structure NHR, in which R is a heteroatom-unsubstituted Cn-aryl, as that term is defined above. The term heteroatom-substituted Cn-arylamino refers to a radical, having a single nitrogen atom as the point of attachment, further having a total of n carbon atoms, at least one hydrogen atom, at least one additional heteroatoms, that is, in addition to the nitrogen atom at the point of attachment, wherein at least one of the carbon atoms is incorporated into one or more aromatic ring structures, further wherein each additional heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C.sub.6-C.sub.10-arylamino has 6 to 10 carbon atoms. The term heteroatom-substituted Cn-arylamino includes groups, having the structure NHR, in which R is a heteroatom-substituted Cn-aryl, as that term is defined above.

(35) The term aralkylamino includes heteroatom-unsubstituted aralkylamino, heteroatom-substituted aralkylamino, heteroatom-unsubstituted Cn-aralkylamino, heteroatom-substituted Cn-aralkylamino, heteroaralkylamino, heterocyclic aralkylamino groups, and diaralkylamino groups. The term heteroatom-unsubstituted Cn-aralkylamino refers to a radical, having a single nitrogen atom as the point of attachment, further having one or two saturated carbon atoms attached to the nitrogen atom, further having a total of n carbon atoms, wherein at least 6 of the carbon atoms form an aromatic ring structure containing only carbon atoms, 8 or more hydrogen atoms, a total of one nitrogen atom, and no additional heteroatoms. For example, a heteroatom-unsubstituted C.sub.7-C.sub.10-aralkylamino has 7 to 10 carbon atoms. The term heteroatom-unsubstituted Cn-aralkylamino includes groups, having the structure NHR, in which R is a heteroatom-unsubstituted Cn-aralkyl, as that term is defined above. The term heteroatom-substituted Cn-aralkylamino refers to a radical, having a single nitrogen atom as the point of attachment, further having at least one or two saturated carbon atoms attached to the nitrogen atom, further having a total of n carbon atoms, 0, 1, or more than one hydrogen atom, at least one additional heteroatom, that is, in addition to the nitrogen atom at the point of attachment, wherein at least one of the carbon atom incorporated into an aromatic ring, further wherein each heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C.sub.7-C.sub.10-aralkylamino has 7 to 10 carbon atoms. The term heteroatom-substituted Cn-aralkylamino includes groups, having the structure NHR, in which R is a heteroatom-substituted Cn-aralkyl, as that term is defined above.

(36) The term amido includes straight-chain amido, branched-chain amido, cycloamido, cyclic amido, heteroatom-unsubstituted amido, heteroatom-substituted amido, heteroatom-unsubstituted Cn-amido, heteroatom-substituted Cn-amido, alkylcarbonylamino, arylcarbonylamino, alkoxycarbonylamino, aryloxycarbonylamino, acylamino, alkylaminocarbonylamino, arylaminocarbonylamino, and ureido groups. The term heteroatom-unsubstituted Cn-amido refers to a radical, having a single nitrogen atom as the point of attachment, further having a carbonyl group attached via its carbon atom to the nitrogen atom, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, 1 or more hydrogen atoms, a total of one oxygen atom, a total of one nitrogen atom, and no additional heteroatoms. For example, a heteroatom-unsubstituted C.sub.1-C.sub.10-amido has 1 to 10 carbon atoms. The term heteroatom-unsubstituted Cn-amido includes groups, having the structure NHR, in which R is a heteroatom-unsubstituted Cn-acyl, as that term is defined above. The group, NHC(O)CH.sub.3, is a non-limiting example of a heteroatom-unsubstituted amido group. The term heteroatom-substituted Cn-amido refers to a radical, having a single nitrogen atom as the point of attachment, further having a carbonyl group attached via its carbon atom to the nitrogen atom, further having a linear or branched, cyclic or acyclic structure, further having a total of n aromatic or nonaromatic carbon atoms, 0, 1, or more than one hydrogen atom, at least one additional heteroatom in addition to the oxygen of the carbonyl group, wherein each additional heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C.sub.1-C.sub.10-amido has 1 to 10 carbon atoms. The term heteroatom-substituted Cn-amido includes groups, having the structure NHR, in which R is a heteroatom-unsubstituted Cn-acyl, as that term is defined above. The group, NHCO.sub.2CH.sub.3, is a non-limiting example of a heteroatom-substituted amido group.

(37) The term alkylthio includes straight-chain alkylthio, branched-chain alkylthio, cycloalkylthio, cyclic alkylthio, heteroatom-unsubstituted alkylthio, heteroatom-substituted alkylthio, heteroatom-unsubstituted Cn-alkylthio, and heteroatom-substituted Cn-alkylthio. The term heteroatom-unsubstituted Cn-alkylthio refers to a group, having the structure SR, in which R is a heteroatom-unsubstituted Cn-alkyl, as that term is defined above. The group, SCH3, is an example of a heteroatom-unsubstituted alkylthio group. The term heteroatom-substituted Cn-alkylthio refers to a group, having the structure SR, in which R is a heteroatom-substituted Cn-alkyl, as that term is defined above.

(38) The term alkenylthio includes straight-chain alkenylthio, branched-chain alkenylthio, cycloalkenylthio, cyclic alkenylthio, heteroatom-unsubstituted alkenylthio, heteroatom-substituted alkenylthio, heteroatom-unsubstituted Cn-alkenylthio, and heteroatom-substituted Cn-alkenylthio. The term heteroatom-unsubstituted Cn-alkenylthio refers to a group, having the structure SR, in which R is a heteroatom-unsubstituted Cn-alkenyl, as that term is defined above. The term heteroatom-substituted Cn-alkenylthio refers to a group, having the structure SR, in which R is a heteroatom-substituted Cn-alkenyl, as that term is defined above.

(39) The term alkynylthio includes straight-chain alkynylthio, branched-chain alkynylthio, cycloalkynylthio, cyclic alkynylthio, heteroatom-unsubstituted alkynylthio, heteroatom-substituted alkynylthio, heteroatom-unsubstituted Cn-alkynylthio, and heteroatom-substituted Cn-alkynylthio. The term heteroatom-unsubstituted Cn-alkynylthio refers to a group, having the structure SR, in which R is a heteroatom-unsubstituted Cn-alkynyl, as that term is defined above. The term heteroatom-substituted Cn-alkynylthio refers to a group, having the structure SR, in which R is a heteroatom-substituted Cn-alkynyl, as that term is defined above.

(40) The term arylthio includes heteroatom-unsubstituted arylthio, heteroatom-substituted arylthio, heteroatom-unsubstituted Cn-arylthio, heteroatom-substituted Cn-arylthio, heteroarylthio, and heterocyclic arylthio groups. The term heteroatom-unsubstituted Cn-arylthio refers to a group, having the structure SAr, in which Ar is a heteroatom-unsubstituted Cn-aryl, as that term is defined above. The group, SC.sub.6H.sub.5, is an example of a heteroatom-unsubstituted arylthio group. The term heteroatom-substituted Cn-arylthio refers to a group, having the structure SAr, in which Ar is a heteroatom-substituted Cn-aryl, as that term is defined above.

(41) The term aralkylthio includes heteroatom-unsubstituted aralkylthio, heteroatom-substituted aralkylthio, heteroatom-unsubstituted Cn-aralkylthio, heteroatom-substituted Cn-aralkylthio, heteroaralkylthio, and heterocyclic aralkylthio groups. The term heteroatom-unsubstituted Cn-aralkylthio refers to a group, having the structure SAr, in which Ar is a heteroatom-unsubstituted Cn-aralkyl, as that term is defined above. The group, SCH.sub.2C.sub.6H.sub.5, is an example of a heteroatom-unsubstituted aralkyl group. The term heteroatom-substituted Cn-aralkylthio refers to a group, having the structure SAr, in which Ar is a heteroatom-substituted Cn-aralkyl, as that term is defined above.

(42) The term acylthio includes straight-chain acylthio, branched-chain acylthio, cycloacylthio, cyclic acylthio, heteroatom-unsubstituted acylthio, heteroatom-substituted acylthio, heteroatom-unsubstituted Cn-acylthio, heteroatom-substituted Cn-acylthio, alkylcarbonyloxy, arylcarbonyloxy, alkoxycarbonyloxy, aryloxycarbonyloxy, and carboxylate groups. The term heteroatom-unsubstituted Cn-acylthio refers to a group, having the structure SAc, in which Ac is a heteroatom-unsubstituted Cn-acyl, as that term is defined above. The group, SCOCH.sub.3, is an example of a heteroatom-unsubstituted acylthio group. The term heteroatom-substituted Cn-acylthio refers to a group, having the structure SAc, in which Ac is a heteroatom-substituted Cn-acyl, as that term is defined above.

(43) The term alkylsilyl includes straight-chain alkylsilyl, branched-chain alkylsilyl, cycloalkylsilyl, cyclic alkylsilyl, heteroatom-unsubstituted alkylsilyl, heteroatom-substituted alkylsilyl, heteroatom-unsubstituted Cn-alkylsilyl, and heteroatom-substituted Cn-alkylsilyl. The term heteroatom-unsubstituted Cn-alkylsilyl refers to a radical, having a single silicon atom as the point of attachment, further having one, two, or three saturated carbon atoms attached to the silicon atom, further having a linear or branched, cyclic or acyclic structure, containing a total of n carbon atoms, all of which are nonaromatic, 5 or more hydrogen atoms, a total of 1 silicon atom, and no additional heteroatoms. For example, a heteroatom-unsubstituted C1-C10-alkylsilyl has 1 to 10 carbon atoms. An alkylsilyl group includes dialkylamino groups. The groups, Si(CH.sub.3).sub.3 and Si(CH.sub.3).sub.2C(CH.sub.3).sub.3, are non-limiting examples of heteroatom-unsubstituted alkylsilyl groups. The term heteroatom-substituted Cn-alkylsilyl refers to a radical, having a single silicon atom as the point of attachment, further having at least one, two, or three saturated carbon atoms attached to the silicon atom, no carbon-carbon double or triple bonds, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, all of which are nonaromatic, 0, 1, or more than one hydrogen atom, and at least one additional heteroatom, that is, in addition to the silicon atom at the point of attachment, wherein each additional heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-substituted C.sub.1-C.sub.10-alkylsilyl has 1 to 10 carbon atoms.

(44) The term phosphonate includes straight-chain phosphonate, branched-chain phosphonate, cyclophosphonate, cyclic phosphonate, heteroatom-unsubstituted phosphonate, heteroatom-substituted phosphonate, heteroatom-unsubstituted Cn-phosphonate, and heteroatom-substituted Cn-phosphonate. The term heteroatom-unsubstituted Cn-phosphonate refers to a radical, having a single phosphorous atom as the point of attachment, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, 2 or more hydrogen atoms, a total of three oxygen atom, and no additional heteroatoms. The three oxygen atoms are directly attached to the phosphorous atom, with one of these oxygen atoms doubly bonded to the phosphorous atom. For example, a heteroatom-unsubstituted C.sub.0-C.sub.10-phosphonate has 0 to 10 carbon atoms. The groups, P(O)(OH)2, P(O)(OH)OCH.sub.3, P(O)(OH)OCH.sub.2CH.sub.3, P(O)(OCH.sub.3).sub.2, and P(O)(OH)(OC.sub.6H.sub.5) are non-limiting examples of heteroatom-unsubstituted phosphonate groups. The term heteroatom-substituted Cn-phosphonate refers to a radical, having a single phosphorous atom as the point of attachment, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, 2 or more hydrogen atoms, three or more oxygen atoms, three of which are directly attached to the phosphorous atom, with one of these three oxygen atoms doubly bonded to the phosphorous atom, and further having at least one additional heteroatom in addition to the three oxygen atoms, wherein each additional heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-unsubstituted C.sub.0-C.sub.10-phosphonate has 0 to 10 carbon atoms.

(45) The term phosphinate includes straight-chain phosphinate, branched-chain phosphinate, cyclophosphinate, cyclic phosphinate, heteroatom-unsubstituted phosphinate, heteroatom-substituted phosphinate, heteroatom-unsubstituted Cn-phosphinate, and heteroatom-substituted Cn-phosphinate. The term heteroatom-unsubstituted Cn-phosphinate refers to a radical, having a single phosphorous atom as the point of attachment, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, 2 or more hydrogen atoms, a total of two oxygen atom, and no additional heteroatoms. The two oxygen atoms are directly attached to the phosphorous atom, with one of these oxygen atoms doubly bonded to the phosphorous atom. For example, a heteroatom-unsubstituted C0-C10-phosphinate has 0 to 10 carbon atoms. The groups, P(O)(OH)H, P(O)(OH)CH3, P(O)(OH)CH2CH3, P(O)(OCH3)CH3, and P(O)(OC6H5)H are non-limiting examples of heteroatom-unsubstituted phosphinate groups. The term heteroatom-substituted Cn-phosphinate refers to a radical, having a single phosphorous atom as the point of attachment, further having a linear or branched, cyclic or acyclic structure, further having a total of n carbon atoms, 2 or more hydrogen atoms, two or more oxygen atoms, two of which are directly attached to the phosphorous atom, with one of these two oxygen atoms doubly bonded to the phosphorous atom, and further having at least one additional heteroatom in addition to the two oxygen atoms, wherein each additional heteroatom is independently selected from the group consisting of N, O, F, Cl, Br, I, Si, P, and S. For example, a heteroatom-unsubstituted C0-C10-phosphinate has 0 to 10 carbon atoms.

(46) Any apparently unfulfilled valency is to be understood to be properly filled by hydrogen atom(s). For example, a compound with a substituent of O or N is to be understood to be OH or NH2, respectively.

(47) Any genus, subgenus, or specific compound discussed herein is specifically contemplated as being excluded from any embodiment described herein.

(48) Compounds described herein may be prepared synthetically using conventional organic chemistry methods known to those of skill in the art and/or are commercially available (e.g., ChemBridge Co., San Diego, Calif.).

(49) The claimed invention is also intended to encompass salts of any of the compounds of the present invention. The term salt(s) as used herein, is understood as being acidic and/or basic salts formed with inorganic and/or organic acids and bases. Zwitterions (internal or inner salts) are understood as being included within the term salt(s) as used herein, as are quaternary ammonium salts such as alkylammonium salts. Nontoxic, pharmaceutically acceptable salts are preferred, although other salts may be useful, as for example in isolation or purification steps during synthesis. Salts include, but are not limited to, sodium, lithium, potassium, amines, tartrates, citrates, hydrohalides, phosphates and the like. A salt may be a pharmaceutically acceptable salt, for example. Thus, pharmaceutically acceptable salts of compounds of the present invention are contemplated.

(50) The term pharmaceutically acceptable salts, as used herein, refers to salts of compounds of this invention that are substantially non-toxic to living organisms. Typical pharmaceutically acceptable salts include those salts prepared by reaction of a compound of this invention with an inorganic or organic acid, or an organic base, depending on the substituents present on the compounds of the invention.

(51) Non-limiting examples of inorganic acids which may be used to prepare pharmaceutically acceptable salts include: hydrochloric acid, phosphoric acid, sulfuric acid, hydrobromic acid, hydroiodic acid, phosphorous acid and the like. Examples of organic acids which may be used to prepare pharmaceutically acceptable salts include: aliphatic mono- and dicarboxylic acids, such as oxalic acid, carbonic acid, citric acid, succinic acid, phenyl-heteroatom-substituted alkanoic acids, aliphatic and aromatic sulfuric acids and the like. Pharmaceutically acceptable salts prepared from inorganic or organic acids thus include hydrochloride, hydrobromide, nitrate, sulfate, pyrosulfate, bisulfate, sulfite, bisulfate, phosphate, monohydrogenphosphate, dihydrogenphosphate, metaphosphate, pyrophosphate, hydroiodide, hydrofluoride, acetate, propionate, formate, oxalate, citrate, lactate, p-toluenesulfonate, methanesulfonate, maleate, and the like.

(52) Suitable pharmaceutically acceptable salts may also be formed by reacting the agents of the invention with an organic base such as methylamine, ethylamine, ethanolamine, lysine, ornithine and the like.

(53) Pharmaceutically acceptable salts include the salts formed between carboxylate or sulfonate groups found on some of the compounds of this invention and inorganic cations, such as sodium, potassium, ammonium, or calcium, or such organic cations as isopropylammonium, trimethylammonium, tetramethylammonium, and imidazolium.

(54) Derivatives of compounds of the present invention are also contemplated. In certain aspects, derivative refers to a chemically modified compound that still retains the desired effects of the compound prior to the chemical modification. Such derivatives may have the addition, removal, or substitution of one or more chemical moieties on the parent molecule. Non-limiting examples of the types modifications that can be made to the compounds and structures disclosed herein include the addition or removal of lower alkanes such as methyl, ethyl, propyl, or substituted lower alkanes such as hydroxymethyl or aminomethyl groups; carboxyl groups and carbonyl groups; hydroxyls; nitro, amino, amide, and azo groups; sulfate, sulfonate, sulfono, sulfhydryl, sulfonyl, sulfoxido, phosphate, phosphono, phosphoryl groups, and halide substituents. Additional modifications can include an addition or a deletion of one or more atoms of the atomic framework, for example, substitution of an ethyl by a propyl; substitution of a phenyl by a larger or smaller aromatic group. Alternatively, in a cyclic or bicyclic structure, heteroatoms such as N, S, or O can be substituted into the structure instead of a carbon atom.

(55) Compounds employed in methods may contain one or more asymmetrically-substituted carbon or nitrogen atoms, and may be isolated in optically active or racemic form. Thus, all chiral, diastereomeric, racemic form, epimeric form, and all geometric isomeric forms of a structure are intended, unless the specific stereochemistry or isomeric form is specifically indicated. Compounds may occur as racemates and racemic mixtures, single enantiomers, diastereomeric mixtures and individual diastereomers. In some embodiments, a single diastereomer is obtained. The chiral centers of the compounds of the present invention can have the S- or the R-configuration, as defined by the IUPAC 1974 Recommendations. Compounds may be of the D- or L-form, for example. It is well known in the art how to prepare and isolate such optically active forms. For example, mixtures of stereoisomers may be separated by standard techniques including, but not limited to, resolution of racemic form, normal, reverse-phase, and chiral chromatography, preferential salt formation, recrystallization, and the like, or by chiral synthesis either from chiral starting materials or by deliberate synthesis of target chiral centers.

(56) In addition, atoms making up the compounds described herein are intended to include all isotopic forms of such atoms. Isotopes, as used herein, include those atoms having the same atomic number but different mass numbers. By way of general example and without limitation, isotopes of hydrogen include tritium and deuterium, and isotopes of carbon include 13C and 14C.

(57) As noted above, compounds described herein may exist in prodrug form. As used herein, prodrug is intended to include any covalently bonded carriers which release the active parent drug or compounds that are metabolized in vivo to an active drug or other compounds employed in the methods described herein in vivo when such prodrug is administered to a subject. Since prodrugs are known to enhance numerous desirable qualities of pharmaceuticals (e.g., solubility, bioavailability, manufacturing, etc.), the compounds employed in some methods described herein may, if desired, be delivered in prodrug form. Thus, the invention contemplates prodrugs of compounds described herein as well as methods of delivering prodrugs. Prodrugs of the compounds employed in embodiments may be prepared by modifying functional groups present in the compound in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent compound.

(58) Accordingly, prodrugs include, for example, compounds described herein in which a hydroxy, amino, or carboxy group is bonded to any group that, when the prodrug is administered to a subject, cleaves to form a free hydroxyl, free amino, or carboxylic acid, respectively. Other examples include, but are not limited to, acetate, formate, and benzoate derivatives of alcohol and amine functional groups; and alkyl, carbocyclic, aryl, and alkylaryl esters such as methyl, ethyl, propyl, iso-propyl, butyl, isobutyl, sec-butyl, tert-butyl, cyclopropyl, phenyl, benzyl, and phenethyl esters, and the like.

(59) It should be recognized that the particular anion or cation forming a part of any salt in any embodiment is not critical, so long as the salt, as a whole, is pharmacologically acceptable. Additional examples of pharmaceutically acceptable salts and their methods of preparation and use are presented in Handbook of Pharmaceutical Salts: Properties, Selection and Use (2002), which is incorporated herein by reference.

C. PHARMACEUTICAL FORMULATIONS AND ADMINISTRATION THEREOF

(60) 1. Pharmaceutical Formulations and Routes of Administration

(61) Pharmaceutical compositions disclosed herein comprise an effective amount of one or more candidate substance or additional agent dissolved or dispersed in a pharmaceutically acceptable carrier. The phrases pharmaceutical or pharmacologically acceptable refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate. The preparation of a pharmaceutical composition that contains at least one candidate substance or additional active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, incorporated herein by reference. Moreover, for animal (e.g., human) administration, it will be understood that preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biological Standards.

(62) As used herein, pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329). Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the therapeutic or pharmaceutical compositions is contemplated.

(63) The compounds administered according to embodiments disclosed herein may comprise different types of carriers depending on whether it is to be administered in solid, liquid or aerosol form, and whether it need to be sterile for such routes of administration as injection. Embodiments can be administered intravenously, intradermally, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostaticaly, intrapleurally, intratracheally, intranasally, intravitreally, intravaginally, intrarectally, topically, intratumorally, intramuscularly, systemically, subcutaneously, subconjunctival, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, orally, locally, via inhalation (e.g., aerosol inhalation), via injection, via infusion, via continuous infusion, via localized perfusion bathing target cells directly, via a catheter, via a lavage, in cremes, in lipid compositions (e.g., liposomes), or by other method or any combination of the foregoing as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 1990).

(64) The actual dosage amount of a composition of embodiments disclosed herein that are administered to an animal patient can be determined by physical and physiological factors such as body weight, severity of condition, the type of disease being treated, previous or concurrent therapeutic interventions, idiopathy of the patient and on the route of administration. The practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject.

(65) In certain embodiments, pharmaceutical compositions may comprise, for example, at least about 0.1% of a compound of the present disclosure. In other embodiments, the compound may comprise between about 2% to about 75% of the weight of the unit, or between about 25% to about 60%, for example, and any range derivable therein. In other non-limiting examples, a dose may also comprise from about 1 microgram/kg/body weight, about 5 microgram/kg/body weight, about 10 microgram/kg/body weight, about 50 microgram/kg/body weight, about 100 microgram/kg/body weight, about 200 microgram/kg/body weight, about 350 microgram/kg/body weight, about 500 microgram/kg/body weight, about 1 milligram/kg/body weight, about 5 milligram/kg/body weight, about 10 milligram/kg/body weight, about 50 milligram/kg/body weight, about 100 milligram/kg/body weight, about 200 milligram/kg/body weight, about 350 milligram/kg/body weight, about 500 milligram/kg/body weight, to about 1000 mg/kg/body weight or more per administration, and any range derivable therein. In non-limiting examples of a derivable range from the numbers listed herein, a range of about 5 mg/kg/body weight to about 100 mg/kg/body weight, about 5 microgram/kg/body weight to about 500 milligram/kg/body weight, etc., can be administered, based on the numbers described above.

(66) In any case, the composition may comprise various antioxidants to retard oxidation of one or more component. Additionally, the prevention of the action of microorganisms can be brought about by preservatives such as various antibacterial and antifungal agents, including but not limited to parabens (e.g., methylparabens, propylparabens), chlorobutanol, phenol, sorbic acid, thimerosal, or combinations thereof.

(67) The candidate substance may be formulated into a composition in a free base, neutral or salt form. Pharmaceutically acceptable salts, include the acid addition salts, e.g., those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids such as for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric or mandelic acid. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as for example, sodium, potassium, ammonium, calcium or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine, or procaine.

(68) In embodiments where the composition is in a liquid form, a carrier can be a solvent or dispersion medium comprising but not limited to, water, ethanol, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol, etc.), lipids (e.g., triglycerides, vegetable oils, liposomes) and combinations thereof. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin; by the maintenance of the required particle size by dispersion in carriers such as, for example liquid polyol or lipids; by the use of surfactants such as, for example hydroxypropylcellulose; or combinations thereof such methods. It may be preferable to include isotonic agents, such as, for example, sugars, sodium chloride or combinations thereof.

(69) In other embodiments, one may use eye drops, nasal solutions or sprays, aerosols or inhalants. Such compositions are generally designed to be compatible with the target tissue type. In a non-limiting example, nasal solutions are usually aqueous solutions designed to be administered to the nasal passages in drops or sprays. Nasal solutions are prepared so that they are similar in many respects to nasal secretions, so that normal ciliary action is maintained. Thus, in certain embodiments the aqueous nasal solutions usually are isotonic or slightly buffered to maintain a pH of about 5.5 to about 6.5. In addition, antimicrobial preservatives, similar to those used in ophthalmic preparations, drugs, or appropriate drug stabilizers, if required, may be included in the formulation. For example, various commercial nasal preparations are known and include drugs such as antibiotics or antihistamines.

(70) In certain embodiments the candidate substance is prepared for administration by such routes as oral ingestion. In these embodiments, the solid composition may comprise, for example, solutions, suspensions, emulsions, tablets, pills, capsules (e.g., hard or soft shelled gelatin capsules), sustained release formulations, buccal compositions, troches, elixirs, suspensions, syrups, wafers, or combinations thereof. Oral compositions may be incorporated directly with the food of the diet. In certain embodiments, carriers for oral administration comprise inert diluents, assimilable edible carriers or combinations thereof. In other aspects, the oral composition may be prepared as a syrup or elixir. A syrup or elixir, and may comprise, for example, at least one active agent, a sweetening agent, a preservative, a flavoring agent, a dye, a preservative, or combinations thereof.

(71) In certain embodiments an oral composition may comprise one or more binders, excipients, disintegration agents, lubricants, flavoring agents, and combinations thereof. In certain embodiments, a composition may comprise one or more of the following: a binder, such as, for example, gum tragacanth, acacia, cornstarch, gelatin or combinations thereof, an excipient, such as, for example, dicalcium phosphate, mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate or combinations thereof; a disintegrating agent, such as, for example, corn starch, potato starch, alginic acid or combinations thereof; a lubricant, such as, for example, magnesium stearate; a sweetening agent, such as, for example, sucrose, lactose, saccharin or combinations thereof; a flavoring agent, such as, for example peppermint, oil of wintergreen, cherry flavoring, orange flavoring, etc.; or combinations thereof the foregoing. When the dosage unit form is a capsule, it may contain, in addition to materials of the above type, carriers such as a liquid carrier. Various other materials may be present as coatings or to otherwise modify the physical form of the dosage unit. For instance, tablets, pills, or capsules may be coated with shellac, sugar, or both.

(72) Additional formulations which are suitable for other modes of administration include suppositories. Suppositories are solid dosage forms of various weights and shapes, usually medicated, for insertion into the rectum, vagina, or urethra. After insertion, suppositories soften, melt or dissolve in the cavity fluids. In general, for suppositories, traditional carriers may include, for example, polyalkylene glycols, triglycerides, or combinations thereof. In certain embodiments, suppositories may be formed from mixtures containing, for example, the active ingredient in the range of about 0.5% to about 10%, and preferably about 1% to about 2%.

(73) Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and/or the other ingredients. In the case of sterile powders for the preparation of sterile injectable solutions, suspensions or emulsion, certain methods of preparation may include vacuum-drying or freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered liquid medium thereof. The liquid medium should be suitably buffered if necessary and the liquid diluent first rendered isotonic prior to injection with sufficient saline or glucose. The preparation of highly concentrated compositions for direct injection is also contemplated, where the use of DMSO as solvent is envisioned to result in extremely rapid penetration, delivering high concentrations of the active agents to a small area.

(74) The composition must be stable under the conditions of manufacture and storage, and preserved against the contaminating action of microorganisms, such as bacteria and fungi. It will be appreciated that endotoxin contamination should be kept minimally at a safe level, for example, less than 0.5 ng/mg protein.

(75) In particular embodiments, prolonged absorption of an injectable composition can be brought about by the use in the compositions of agents delaying absorption, such as, for example, aluminum monostearate, gelatin, or combinations thereof.

(76) 2. Combination Therapy

(77) In some embodiments, it is contemplated that the tolerance-inducing compositions disclosed herein may be used in conjunction with the compositions for which a tolerance is being induced as part of a treatment regimen. This process may involve contacting the cell(s) with the agents at the same time or within a period of time wherein separate administration of the agents produces a desired therapeutic benefit. This may be achieved by contacting the cell, tissue or organism with a single composition or pharmacological formulation that includes two or more agents, or by contacting the cell with two or more distinct compositions or formulations, wherein one composition includes one agent and the other includes another.

(78) Compounds discussed herein may precede, be co-current with and/or follow the other agents by intervals ranging from minutes to weeks. In embodiments where the agents are applied separately to a cell, tissue or organism, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that the agents would still be able to exert an advantageously combined effect on the cell, tissue or organism. For example, in such instances, it is contemplated that one may contact the cell, tissue or organism with two, three, four or more modalities substantially simultaneously (i.e., within less than about a minute) as the candidate substance. In other aspects, one or more tolerance-inducing compositions may be administered or provided within 1 minute, 5 minutes, 10 minutes, 20 minutes, 30 minutes, 45 minutes, 60 minutes, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 22 hours, 23 hours, 24 hours, 25 hours, 26 hours, 27 hours, 28 hours, 29 hours, 30 hours, 31 hours, 32 hours, 33 hours, 34 hours, 35 hours, 36 hours, 37 hours, 38 hours, 39 hours, 40 hours, 41 hours, 42 hours, 43 hours, 44 hours, 45 hours, 46 hours, 47 hours, 48 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, or 8 weeks or more, and any range derivable therein, prior to administering the compositions for which a tolerance is being induced. In some embodiments, more than one course of therapy may be employed. It is contemplated that multiple courses may be implemented.

D. ORGANISMS AND CELL SOURCE

(79) Cells that may be used in some methods can be from a variety of sources. Embodiments include the use of mammalian cells, such as cells from monkeys, chimpanzees, rabbits, mice, rats, ferrets, dogs, pigs, humans, and cows. Alternatively, the cells may be from fruit flies, yeast, or E. coli, which are all model systems for evaluating homologous recombination.

(80) Methods can involve cells, tissues, or organs involving the heart, lung, kidney, liver, bone marrow, pancreas, skin, bone, vein, artery, cornea, blood, small intestine, large intestine, brain, spinal cord, smooth muscle, skeletal muscle, ovary, testis, uterus, and umbilical cord.

(81) Moreover, methods can be employed in cells of the following type: platelet, myelocyte, erythrocyte, lymphocyte, adipocyte, fibroblast, epithelial cell, endothelial cell, smooth muscle cell, skeletal muscle cell, endocrine cell, glial cell, neuron, secretory cell, barrier function cell, contractile cell, absorptive cell, mucosal cell, limbus cell (from cornea), stem cell (totipotent, pluripotent or multipotent), unfertilized or fertilized oocyte, or sperm.

(82) Moreover, methods can be implemented with or in plants or parts of plants, including fruit, flowers, leaves, stems, seeds, cuttings. Plants can be agricultural, medicinal, or decorative.

E. ANTIGENS

(83) The antigen employed as X in the compositions of Formula 1, or in any of the compositions or methods of the current disclosure, can be a protein or a peptide, e.g. the antigen may be a complete or partial therapeutic agent, a full-length transplant protein or peptide thereof, a full-length autoantigen or peptide thereof, a full-length allergen or peptide thereof, and/or a nucleic acid, or a mimetic of an aforementioned antigen. Combinations of multiple fragments may also be used, depending on the embodiment. For example, if a longer peptide identified as P has antigenic regions A, B, C, and D, compositions disclosed herein for induction of tolerance to P can comprise any combination of A, B, C, and D, and repeats of any of A, B, C, and D. A listing of any particular antigen in a category or association with any particular disease or reaction does not preclude that antigen from being considered part of another category or associated with another disease or reaction.

(84) In several embodiments, the antigen comprises one or more therapeutic agents that are proteins, peptides, antibodies and antibody-like molecules (including antibody fragments and fusion proteins with antibodies and antibody fragments), and gene therapy vectors. These include human, non-human (such as mouse) and non-natural (e.g., engineered) proteins, antibodies, chimeric antibodies, humanized antibodies, viruses and virus-like particles, and non-antibody binding scaffolds, such as fibronectins, DARPins, knottins, and the like. In several embodiments, human allograft transplantation antigens against which transplant recipients develop an unwanted immune response are used. In several embodiments, the antigen comprises one or more self-antigens that cause an unwanted, autoimmune response. While self-antigens are of an endogenous origin in an autoimmune disease patient, according to several embodiments, the polypeptides employed in the disclosed compositions are, depending on the embodiment, synthesized exogenously (as opposed to being purified and concentrated from a source of origin).

(85) In several embodiments, the antigen to which tolerance is desired comprises one or more foreign antigens, such as food, animal, plant and environmental antigens, against which a patient experiences an unwanted immune response. While a therapeutic protein can also be considered a foreign antigen due to its exogenous origin, for purposes of clarity in the description of the present disclosure such therapeutics are described as a separate group. Similarly, a plant or an animal antigen can be eaten and considered a food antigen, and an environmental antigen may originate from a plant. They are, however, considered foreign antigens. In the interest of simplicity no attempt will be made to describe distinguish and define all of such potentially overlapping groups, as those skilled in the art can appreciate the antigens that can be employed in the compositions of the disclosure, particularly in light of the detailed description and examples.

(86) In several embodiments, X is selected from the group consisting of insulin, proinsulin, preproinsulin, gluten, gliadin, myelin basic protein, myelin oligodendrocyte glycoprotein and proteolipid protein, Factor VIII, Factor IX, asparaginase, uricase and fragments of any of the preceding. In several embodiments, the antigen X is not a full length protein. For example, in some embodiments, the antigen is not full length gliadin, insulin, or proinsulin. In several embodiments, the antigen is not full length myelin basic protein, not full length myelin oligodendrocyte protein, or not full length proteolipid protein. In several embodiments, the antigen X is not a fragment of a protein. As discussed in more detail below, there exist a variety of antigens to which tolerance may be desired. These may include, but are not limited to, exogenous antigens that result in an adverse immune response when a subject is exposed to the antigen. In several embodiments, the adverse immune response could be a result of ingestion of the antigen, e.g., orally or nasally, or via some other mucosal route. These routes could be the case, for example, with food antigens. In some embodiments, the antigen may be purposefully administered to a subject, for example, with the administration of a therapeutic composition to treat a disease or condition that the subject is affected by. In still additional embodiments, the antigen may be produced by the subject, e.g., an autoimmune antigen. For example, in several embodiments, X comprises a foreign transplant antigen against which transplant recipients develop an unwanted immune response or a tolerogenic portion thereof. In several embodiments, X comprises a foreign food, animal, plant or environmental antigen against which patients develop an unwanted immune response or a tolerogenic portion thereof. In several embodiments, X comprises a foreign therapeutic agent against which patients develop an unwanted immune response or a tolerogenic portion thereof. In several embodiments, X comprises a synthetic self-antigen against the endogenous version of which patients develop an unwanted immune response or a tolerogenic portion thereof.

(87) In further detail to the above, there are provided in several embodiments, compounds where X is a food antigen. In some such embodiments, X is one or more of conarachin (Ara h 1), allergen II (Ara h 2), arachis agglutinin, conglutin (Ara h 6), -lactalbumin (ALA), lactotransferrin, Pen a 1 allergen (Pen a 1), allergen Pen m 2 (Pen m 2), tropomyosin fast isoform, high molecular weight glutenin, low molecular weight glutenin, alpha-gliadin, gamma-gliadin, omega-gliadin, hordein, seclain, and avenin. Fragment of any of these antigens and/or mimotopes of any of these antigens are also used, in several embodiments. In several embodiments, X is selected from the group consisting of gluten, high molecular weight glutenin, low molecular weight glutenin, alpha-gliadin, gamma-gliadin, omega-gliadin, hordein, seclain, and avenin and fragments thereof. In several embodiments, X is selected from the group consisting of gluten, high molecular weight glutenin, low molecular weight glutenin, alpha-gliadin, gamma-gliadin, and omega-gliadin and fragments thereof. In several embodiments, X is gluten or fragment thereof. In several embodiments, X is gliadin or fragment thereof.

(88) In several embodiments, there are provided compounds where X is a therapeutic agent. In several embodiments, X is selected from the group consisting of Factor VII, Factor IX, asparaginase, and uricase and fragments thereof. In several embodiments, X is a therapeutic agent selected from the group consisting of Factor VII and Factor IX and fragments thereof. In several embodiments, X is a therapeutic agent selected from the group consisting of Factor VIII or fragment thereof. In several embodiments, when X is a therapeutic agent, the compound can be used in the treatment, prevention, reduction, or otherwise amelioration of an immune response developed against a therapeutic agent for hemophilia. As discussed herein, mimotopes of any antigenic portion of the antigens above can be used in several embodiments.

(89) In several embodiments, X comprises asparaginase or a fragment thereof. In several embodiments, X comprises uricase or a fragment thereof. In several such embodiments, the compound can be used in the treatment, prevention, reduction, or otherwise amelioration of an immune response developed against an anti-neoplastic agent. As discussed herein, mimotopes of any antigenic portion of the antigens above can be used in several embodiments.

(90) In several embodiments, X is associated with an autoimmune disease. For example, in several embodiments, the associated autoimmune disease is one or more of Type I diabetes, multiple sclerosis, rheumatoid arthritis, vitiligo, uveitis, pemphis vulgaris and neuromyelitis optica.

(91) In several embodiments, the autoimmune disease is Type I diabetes and X comprises insulin or a fragment thereof. In several embodiments, the autoimmune disease is Type I diabetes and X comprises proinsulin or a fragment thereof. In several embodiments, the autoimmune disease is Type I diabetes and X comprises preproinsulin or a fragment thereof. As discussed herein, mimotopes of any antigenic portion of the antigens above can be used in several embodiments. In several embodiments, combinations of these antigens can be incorporated into the tolerogenic compound which may aid in reducing immune responses to self-antigens at multiple points along the insulin pathway.

(92) In several embodiments, the autoimmune disease is multiple sclerosis and X comprises myelin basic protein or a fragment thereof. In several embodiments, the autoimmune disease is multiple sclerosis and X comprises myelin oligodendrocyte glycoprotein or a fragment thereof. In several embodiments, the autoimmune disease is multiple sclerosis and X comprises proteolipid protein or a fragment thereof. As discussed herein, mimotopes of any antigenic portion of the antigens above can be used in several embodiments. In several embodiments, combinations of these antigens can be incorporated into the tolerogenic compound (e.g., a mixture of antigens or fragments of MOG, MBP and/or PLP) which may aid in reducing immune responses to self-antigens at multiple points along the enzymatic pathways that control myelination or myelin repair.

(93) As discussed herein, mimotopes of any antigenic portion of the self-antigens above (or otherwise disclosed herein) can be used in several embodiments.

(94) In several embodiments, the pharmaceutically acceptable composition consists of, or consists essentially of a compound wherein X is a food antigen, therapeutic agent, a self antigen, or fragment thereof, a linker Y, and a liver targeting moiety Z selected from mannose and/or a mannose receptor-targeting moiety (including, but not limited to, one or more of mannosamine, N-acetylmannosamine, or N-acetylglucosamine).

(95) The tolerogenic antigen can be a complete protein, a portion of a complete protein, a peptide, or the like, and can be derivatized (as discussed above) for attachment to a linker and/or antigen-binding moiety, can be a variant and/or can contain conservative substitutions, particularly maintaining sequence identity, and/or can be desialylated.

(96) In the embodiments where the antigen is a therapeutic protein, peptide, antibody or antibody-like molecule, specific antigens can be selected from: Abatacept, Abciximab, Adalimumab, Adenosine deaminase, Ado-trastuzumab emtansine, Agalsidase alfa, Agalsidase beta, Aldeslukin, Alglucerase, Alglucosidase alfa, -1-proteinase inhibitor, Anakinra, Anistreplase (anisoylated plasminogen streptokinase activator complex), Antithrombin III, Antithymocyte globulin, Ateplase, Bevacizumab, Bivalirudin, Botulinum toxin type A, Botulinum toxin type B, C1-esterase inhibitor, Canakinumab, Carboxypeptidase G2 (Glucarpidase and Voraxaze), Certolizumab pegol, Cetuximab, Collagenase, Crotalidae immune Fab, Darbepoetin-, Denosumab, Digoxin immune Fab, Dornase alfa, Eculizumab, Etanercept, Factor VIIa, Factor VIII, Factor IX, Factor XI, Factor XIII, Fibrinogen, Filgrastim, Galsulfase, Golimumab, Histrelin acetate, Hyaluronidase, Idursulphase, Imiglucerase, Infliximab, Insulin [including recombinant human insulin (rHu insulin) and bovine insulin], Interferon-2a, Interferon-2b, Interferon-1a, Interferon-1b, Interferon-1b, Ipilimumab, L-arginase, L-asparaginase, L-methionase, Lactase, Laronidase, Lepirudin/hirudin, Mecasermin, Mecasermin rinfabate, Methoxy Natalizumab, Octreotide, Ofatumumab, Oprelvekin, Pancreatic amylase, Pancreatic lipase, Papain, Peg-asparaginase, Peg-doxorubicin HCl, PEG-epoetin-, Pegfilgrastim, Peg-Interferon-2a, Peg-Interferon-2b, Pegloticase, Pegvisomant, Phenylalanine ammonia-lyase (PAL), Protein C, Rasburicase (uricase), Sacrosidase, Salmon calcitonin, Sargramostim, Streptokinase, Tenecteplase, Teriparatide, Tocilizumab (atlizumab), Trastuzumab, Type 1 alpha-interferon, Ustekinumab, vW factor. The therapeutic protein can be obtained from natural sources (e.g., concentrated and purified) or synthesized, e.g., recombinantly, and includes antibody therapeutics that are typically IgG monoclonal or fragments or fusions.

(97) Particular therapeutic protein, peptide, antibody or antibody-like molecules include, but are not limited to, Abciximab, Adalimumab, Agalsidase alfa, Agalsidase beta, Aldeslukin, Alglucosidase alfa, Factor VIII, Factor IX, Infliximab, Insulin (including rHu Insulin), L-asparaginase, Laronidase, Natalizumab, Octreotide, Phenylalanine ammonia-lyase (PAL), or Rasburicase (uricase) and generally IgG monoclonal antibodies in their varying formats.

(98) Some embodiments employ hemostatic agents (e.g., Factor VIII and IX), Insulin (including rHu Insulin), and the non-human therapeutics uricase, PAL and asparaginase.

(99) In several embodiments, therapeutic agents are delivered through the use of, e.g., a gene therapy vector. In some such embodiments, an immune response may be developed against a portion of such vectors and/or their cargo (e.g., the therapeutic agent). Thus, in several embodiments, the antigen to which tolerance is desired comprises a gene therapy vector, including, but are not limited to: adenoviruses and adeno-associated virus (and corresponding variants-1, -2, -5, -6, -8, -9, and/or other parvoviruses), lentiviruses, and retroviruses.

(100) Unwanted immune response in hematology and transplant includes autoimmune aplastic anemia, transplant rejection (generally), and Graft vs. Host Disease (bone marrow transplant rejection). In the embodiments where the tolerogenic antigen is a human allograft transplantation antigen, specific sequences can be selected from: subunits of the various MHC class I and MHC class II haplotype proteins (for example, donor/recipient differences identified in tissue cross-matching), and single-amino-acid polymorphisms on minor blood group antigens including RhCE, Kell, Kidd, Duffy and Ss. Such compositions can be prepared individually for a given donor/recipient pair.

(101) In type 1 diabetes mellitus, antigens include, but are not limited to: insulin, proinsulin, preproinsulin, glutamic acid decarboxylase-65 (GAD-65 or glutamate decarboxylase 2), GAD-67, glucose-6 phosphatase 2 (IGRP or islet-specific glucose 6 phosphatase catalytic subunit related protein), insulinoma-associated protein 2 (IA-2), and insulinoma-associated protein 2 (IA-2); other antigens include ICA69, ICA12 (SOX-13), carboxypeptidase H, Imogen 38, GLIMA 38, chromogranin-A, HSP-60, carboxypeptidase E, peripherin, glucose transporter 2, hepatocarcinoma-intestine-pancreas/pancreatic associated protein, S100, glial fibrillary acidic protein, regenerating gene II, pancreatic duodenal homeobox 1, dystrophia myotonica kinase, islet-specific glucose-6-phosphatase catalytic subunit-related protein, and SST G-protein coupled receptors 1-5, or immunogenic fragments or portions of any of such antigens. It should be noted that insulin is an example of an antigen that can be characterized both as a self-antigen and a therapeutic protein antigen. For example, rHu Insulin and bovine insulin are therapeutic protein antigens (that are the subject of unwanted immune attack), whereas endogenous human insulin is a self-antigen (that is the subject of an unwanted immune attack). Because endogenous human insulin is not available to be employed in a pharmaceutical composition, a recombinant form is employed in certain embodiments of the compositions of the disclosure.

(102) Human insulin, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT P01308):

(103) TABLE-US-00001 (SEQIDNO:1) MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFF YTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS ICSLYQLENYCN

(104) GAD-65, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT Q05329):

(105) TABLE-US-00002 (SEQIDNO:2) MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLY GDAEKPAESGGSQPPRAAARKAACACDQKPCSCSKVDVNYAFLHATDLL PACDGERPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNELLQEYNW ELADQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWL TSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAI SNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEHSHFSLKKGAAALGI GTDSVILIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGA FDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTW NPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGD KALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREG YEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMME YGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL

(106) IGRP, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT QN9QR9):

(107) TABLE-US-00003 (SEQIDNO:3) MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQF NQTVGTKMIWVAVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCL EQFPTTCETGPGSPSGHAMGASCVWYVMVTAALSHTVCGMDKFSITLHR LTWSFLWSVFWLIQISVCISRVFIATHEPHQVILGVIGGMLVAEAFEHT PGIQTASLGTYLKTNLFLFLFAVGFYLLLRVLNIDLLWSVPIAKKWCAN PDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRL LCALTSLTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSV HMLMKQSGKKSQ.

(108) In several embodiments, human proinsulin, including an exogenously obtained form useful in the tolerogenic compositions of the disclosure, has the following sequence:

(109) TABLE-US-00004 (SEQIDNO:4) FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPG AGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN.

(110) Depending on the embodiment, peptides/epitopes useful in the tolerogenic compositions of the disclosure for treating type 1 diabetes include some or all of the following sequences, individually in a tolerogenic composition or together in a cocktail of tolerogenic compositions:

(111) Human Proinsulin 1-70:

(112) TABLE-US-00005 (SEQIDNO:5) FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPG AGSLQPLALEGSLQKRGIVEQ;
Human Proinsulin 9-70:

(113) TABLE-US-00006 HumanProinsulin1-70: (SEQIDNO:6) SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLA LEGSLQKRGIVEQ; HumanProinsulin9-38: (SEQIDNO:7) SHLVEALYLVCGERGFFYTPKTRREAEDLQ; HumanProinsulin1-38: (SEQIDNO:8) FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQ; HumanProinsulin9-23: (SEQIDNO:9) SHLVEALYLVCGERG; HumanProinsulin45-71(C13-A6): (SEQIDNO:10) GGGPGAGSLQPLALEGSLQKRGIVEQC; HumanProinsulinC24-A1: (SEQIDNO:11) LALEGSLQKRG; HumanProinsulinC19-A3: (SEQIDNO:12) GSLQPLALEGSLQKRGIV; HumanProinsulinC13-32: (SEQIDNO:13) GGGPGAGSLQPLALEGSLQK; HumanProinsulinB9-C4: (SEQIDNO:14) SHLVEALYLVCGERGFFYTPKTRREAED; HumanProinsulinC22-A5: (SEQIDNO:15) QPLALEGSLQKRGIVEQ; HumanIA-2718-782: (SEQIDNO:16) AYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYIN ASPIIEHDPRMPAYIA; HumanIA-2785-819: (SEQIDNO:17) GPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQ; HumanIA-2828-883: (SEQIDNO:18) GASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWP AEGTPAS; HumanIA-2943-979: (SEQIDNO:19) EHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQCG.

(114) In autoimmune diseases of the thyroid, including Hashimoto's thyroiditis and Graves' disease, main antigens include, but are not limited to, thyroglobulin (TG), thyroid peroxidase (TPO) and thyrotropin receptor (TSHR); other antigens include sodium iodine symporter (NIS) and megalin. In thyroid-associated ophthalmopathy and dermopathy, in addition to thyroid autoantigens including TSHR, an antigen is insulin-like growth factor 1 receptor. In hypoparathyroidism, a main antigen is calcium sensitive receptor.

(115) In Addison's Disease, main antigens include, but are not limited to, 21-hydroxylase, 17-hydroxylase, and P450 side chain cleavage enzyme (P450scc); other antigens include ACTH receptor, P450c21 and P450c17.

(116) In premature ovarian failure, main antigens include, but are not limited to, FSH receptor and -enolase.

(117) In autoimmune hypophysitis, or pituitary autoimmune disease, main antigens include, but are not limited to, pituitary gland-specific protein factor (PGSF) 1a and 2; another antigen is type 2 iodothyronine deiodinase.

(118) In multiple sclerosis, main antigens include, but are not limited to, myelin basic protein (MBP), myelin oligodendrocyte glycoprotein (MOG) and myelin proteolipid protein (PLP).

(119) MBP, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT P02686):

(120) TABLE-US-00007 (SEQIDNO:20) MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEA DANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRD APGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSK YLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHH PARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSL SRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRD SRSGSPMARR.

(121) MOG, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT Q16653):

(122) TABLE-US-00008 (SEQIDNO:21) MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEV ELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRT ELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDP FYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRT FDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRN PF.

(123) PLP, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT P60201):

(124) TABLE-US-00009 (SEQIDNO:22) MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIET YFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVR QIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLG HPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSAS IGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFV GAAATLVSLLTFMIAATYNFAVLKLMGRGTKF.

(125) Peptides/epitopes useful in the compositions of the disclosure for treating multiple sclerosis include some or all of the following sequences, individually in a tolerogenic composition as disclosed herein or together in a combination (e.g., a cocktail) of tolerogenic compositions:

(126) TABLE-US-00010 MBP13-32: (SEQIDNO:23) KYLATASTMDHARHGFLPRH; MBP83-99: (SEQIDNO:24) ENPWHFFKNIVTPRTP; MBP111-129: (SEQIDNO:25) LSRFSWGAEGQRPGFGYGG; MBP146-170: (SEQIDNO:26) AQGTLSKIFKLGGRDSRSGSPMARR; MOG1-20: (SEQIDNO:27) GQFRVIGPRHPIRALVGDEV; MOG35-55: (SEQIDNO:28) MEVGWYRPPFSRWHLYRNGK; PLP139-154: (SEQIDNO:29) HCLGKWLGHPDKFVGI; MOG30-60: (SEQIDNO:30) KNATGMEVGWYRSPFSRVVHLYRNGKDQDAE; MBP83-99: (SEQIDNO:31) ENPVVHFFKNIVTPRTP; MOG35-55: (SEQIDNO:32) MEVGWYRPPFSRVVHLYRNGK; MBP82-98: (SEQIDNO:33) DENPVVHFFKNIVTPRT; MBP82-99: (SEQIDNO:34) DENPVVHFFKNIVTPRTP; MBP82-106: (SEQIDNO:35) DENPVVHFFKNIVTPRTPPPSQGKG; MBP87-106: (SEQIDNO:36) VHFFKNIVTPRTPPPSQGKG; MBP131-155: (SEQIDNO:37) ASDYKSAHKGLKGVDAQGTLSKIFK; PLP41-58: (SEQIDNO:38) GTEKLIETYFSKNYQDYE; PLP89-106: (SEQIDNO:39) GFYTTGAVRQIFGDYKTT; PLP95-116: (SEQIDNO:40) AVRQIFGDYKTTICGKGLSATV; PLP178-197: (SEQIDNO:41) NTWTTCQSIAFPSKTSASIG; PLP190-209: (SEQIDNO:42) SKTSASIGSLCADARMYGVL; MOG11-30: (SEQIDNO:43) PIRALVGDEVELPCRISPGK; MOG21-40: (SEQIDNO:44) ELPCRISPGKNATGMEVGWY; MOG64-86: (SEQIDNO:45) EYRGRTELLKDAIGEGKVTLRIR; MOG1-62: (SEQIDNO.46) GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVH LYRNGKDQDGDQA MBP76-136: (SEQIDNO:47) SHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPG FGYGGRASDYKSCG

(127) In rheumatoid arthritis, main antigens include, but are not limited to, collagen II, immunoglobulin binding protein, the fragment crystallizable region of immunoglobulin G, double-stranded DNA, and the natural and cirtullinated forms of proteins implicated in rheumatoid arthritis pathology, including fibrin/fibrinogen, vimentin, collagen I and II, and alpha-enolase.

(128) In autoimmune gastritis, a main antigen is H+, K+-ATPase.

(129) In pernicious angemis, a main antigen is intrinsic factor.

(130) In celiac disease, main antigens include, but are not limited to, tissue transglutaminase and the natural and deamidated forms of gluten or gluten-like proteins, such as alpha-, gamma-, and omega-gliadin, glutenin, hordein, secalin, and avenin. Those skilled in the art will appreciate, for example, that while the main antigen of celiac disease is alpha gliadin, alpha gliadin turns more immunogenic in the body through deamidation by tissue glutaminase converting alpha gliadin's glutamines to glutamic acid. Thus, while alpha gliadin is originally a foreign food antigen, once it has been modified in the body to become more immunogenic it can be characterized as a self-antigen, depending on the embodiment.

(131) In vitiligo, a main antigen is tyrosinase, and tyrosinase related protein 1 and 2.

(132) MART1, Melanoma antigen recognized by T cells 1, Melan-A, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT Q16655):

(133) TABLE-US-00011 (SEQIDNO:48) MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCR RRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVP NAPPAYEKLSAEQSPPPYSP.

(134) Tyrosinase, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT P14679):

(135) TABLE-US-00012 (SEQIDNO:49) MLLAVLYCLLWSFQTSAGHFPRACVSSKNLMEKECCPPWSGDRSPCGQL SGRGSCQNILLSNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGF NCGNCKFGFWGPNCTERRLLVRRNIFDLSAPEKDKFFAYLTLAKHTISS DYVIPIGTYGQMKNGSTPMENDINIYDLFVWMHYYVSMDALLGGSEIWR DIDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCD ICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPE GPLRRNPGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNT LEGFASPLTGIADASQSSMHNALHIYMNGTMSQVQGSANDPIFLLHHAF VDSIFEQWLRRHRPLQEVYPEANAPIGHNRESYMVPFIPLYRNGDFFIS SKDLGYDYSYLQDSDPDSFQDYIKSYLEQASRIWSWLLGAAMVGAVLTA LLAGLVSLLCRHKRKQLPEEKQPLLMEKEDYHSLYQSHL

(136) Melanocyte protein PMEL, gp100, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT P40967):

(137) TABLE-US-00013 (SEQIDNO:50) MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLY PEWTEAQRLDCWRGGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLP DGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKR SFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRS YVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLH DPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTYLEPGPVTAQVVLQA AIPLTSCGSSPVPGTTDGHRPTAEAPNTTAGQVPTTEVVGTTPGQAPTA EPSGTTSVQVPTTEVISTAPVQMPTAESTGMTPEKVPVSEVMGTTLAEM STPEATGMTPAEVSIVVLSGTTAAQVTTTEWVETTARELPIPEPEGPDA SSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRYGSFSVTLDIV QGIESAEILQAVPSGEGDAFELTVSCQGGLPKEACMEISSPGCQPPAQR LCQPVLPSPACQLVLHQILKGGSGTYCLNVSLADTNSLAVVSTQLIMPG QEAGLGQVPLIVGILLVLMAVVLASLIYRRRLMKQDFSVPQLPHSSSHW LRLPRIFCSCPIGENSPLLSGQQV.

(138) In myasthenia gravis, a main antigen is acetylcholine receptor.

(139) In pemphigus vulgaris and variants, main antigens include, but are not limited to, desmoglein 3, 1 and 4; other antigens include pemphaxin, desmocollins, plakoglobin, perplakin, desmoplakins, and acetylcholine receptor.

(140) In bullous pemphigoid, main antigens include BP180 and BP230; other antigens include plectin and laminin 5.

(141) In dermatitis herpetiformis Duhring, main antigens include, but are not limited to, endomysium and tissue transglutaminase.

(142) In epidermolysis bullosa acquisita, a main antigen is collagen VII.

(143) In systemic sclerosis, main antigens include, but are not limited to, matrix metalloproteinase 1 and 3, the collagen-specific molecular chaperone heat-shock protein 47, fibrillin-1, and PDGF receptor; other antigens include Scl-70, U1 RNP, Th/To, Ku, Jo1, NAG-2, centromere proteins, topoisomerase I, nucleolar proteins, RNA polymerase I, II and III, PM-Slc, fibrillarin, and B23.

(144) In mixed connective tissue disease, a main antigen is U1snRNP.

(145) In Sjogren's syndrome, the main antigens include, but are not limited to, nuclear antigens SS-A and SS-B; other antigens include fodrin, poly(ADP-ribose) polymerase and topoisomerase, muscarinic receptors, and the Fc-gamma receptor IIIb.

(146) In systemic lupus erythematosus, main antigens include nuclear proteins including the Smith antigen, SS-A, high mobility group box 1 (HMGB1), nucleosomes, histone proteins and double-stranded DNA (against which auto-antibodies are made in the disease process).

(147) In Goodpasture's syndrome, main antigens include, but are not limited to, glomerular basement membrane proteins including collagen IV.

(148) In rheumatic heart disease, a main antigen is cardiac myosin.

(149) In autoimmune polyendocrine syndrome type 1 antigens include aromatic L-amino acid decarboxylase, histidine decarboxylase, cysteine sulfinic acid decarboxylase, tryptophan hydroxylase, tyrosine hydroxylase, phenylalanine hydroxylase, hepatic P450 cytochromes P4501A2 and 2A6, SOX-9, SOX-10, calcium-sensing receptor protein, and the type 1 interferons interferon alpha, beta and omega.

(150) In neuromyelitis optica, a main antigen is AQP4.

(151) Aquaporin-4, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT P55087):

(152) TABLE-US-00014 (SEQIDNO:51) MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFV LLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINP AVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGV TMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFS VAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAG GLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLIL KPGVVHVIDVDRGEEKKGKDQSGEVLSSV.

(153) In uveitis, main antigens include Retinal S-antigen or S-arrestin and interphotoreceptor retinoid binding protein (IRBP) or retinol-binding protein 3.

(154) S-arrestin, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT P10523):

(155) TABLE-US-00015 (SEQIDNO:52) MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVV LVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPV GAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSC GVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEA AWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFV EQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRER RGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFL GELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGE AEEGKRDKNDVDE.

(156) IRBP, including an exogenously obtained form useful in the compositions of the disclosure, has the following sequence (UNIPROT P10745):

(157) TABLE-US-00016 (SEQIDNO:53) MMREWVLLMSVLLCGLAGPTHLFQPSLVLDMAKVLLDNYCFPENLLGMQ EAIQQAIKSHEILSISDPQTLASVLTAGVQSSLNDPRLVISYEPSTPEP PPQVPALTSLSEEELLAWLQRGLRHEVLEGNVGYLRVDSVPGQEVLSMM GEFLVAHVWGNLMGTSALVLDLRHCTGGQVSGIPYIISYLHPGNTILHV DTIYNRPSNTTTEIWTLPQVLGERYGADKDVVVLTSSQTRGVAEDIAHI LKQMRRAIVVGERTGGGALDLRKLRIGESDFFFTVPVSRSLGPLGGGSQ TWEGSGVLPCVGTPAEQALEKALAILTLRSALPGVVHCLQEVLKDYYTL VDRVPTLLQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGP TETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGY LRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVP LLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYL LTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGS LALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVLEFHQSLG ALVEGTGHLLEAHYARPEVVGQTSALLRAKLAQGAYRTAVDLESLASQL TADLQEVSGDHRLLVFHSPGELVVEEAPPPPPAVPSPEELTYLIEALFK TEVLPGQLGYLRFDAMAELETVKAVGPQLVRLVWQQLVDTAALVIDLRY NPGSYSTAIPLLCSYFFEAEPRQHLYSVFDRATSKVTEVWTLPQVAGQR YGSHKDLYILMSHTSGSAAEAFAHTMQDLQRATVIGEPTAGGALSVGIY QVGSSPLYASMPTQMAMSATTGKAWDLAGVEPDITVPMSEALSIAQDIV ALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVA LAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIPSPEVFEELI KFSFHTNVLEDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMI IDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQ VVGERYGSKKSMVILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQ PPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALAR AKEMLQHNQLRVKRSPGLQDHL.

(158) In the embodiments where the tolerogenic antigen is a foreign antigen against which an unwanted immune response can be developed, such as food antigens, specific antigens include, but are not limited to: from peanut: conarachin (Ara h 1), allergen II (Ara h 2), arachis agglutinin, conglutin (Ara h 6); conarachin, for example has the sequence identified as UNIPROT Q6PSU6; from apple: 31 kda major allergen/disease resistance protein homolog (Mal d 2), lipid transfer protein precursor (Mal d 3), major allergen Mal d 1.03D (Mal d 1); from milk: -lactalbumin (ALA), lactotransferrin; from kiwi: actinidin (Act c 1, Act d 1), phytocystatin, thaumatin-like protein (Act d 2), kiwellin (Act d 5); from egg whites: ovomucoid, ovalbumin, ovotransferrin, and lysozyme; from egg yolks: livetin, apovitillin, and vosvetin; from mustard: 2S albumin (Sin a 1), 11S globulin (Sin a 2), lipid transfer protein (Sin a 3), profilin (Sin a 4); from celery: profilin (Api g 4), high molecular weight glycoprotein (Api g 5); from shrimp: Pen a 1 allergen (Pen a 1), allergen Pen m 2 (Pen m 2), tropomyosin fast isoform; from wheat and/or other cereals: high molecular weight glutenin, low molecular weight glutenin, alpha-, gamma- and omega-gliadin, hordein, secalin and/or avenin; peptides/epitopes useful in the compositions of the disclosure for treating Celiac Disease include some or all of the following sequences, individually in a composition of Formula 1 or together in a cocktail of compositions of Formula 1: DQ-2 relevant, Alpha-gliadin 33-mer native: LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF (SEQ ID NO: 54); DQ-2 relevant, Alpha-gliadin 33-mer deamidated: LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF (SEQ ID NO: 55); DQ-8 relevant, Alpha-gliadin: QQYPSGQGSFQPSQQNPQ (SEQ ID NO: 56); DQ-8 relevant, Omega-gliadin (wheat, U5UA46): QPFPQPEQPFPW (SEQ ID NO: 57); Alpha-gliadin 15-mer fragment: ELQPFPQPELPYPQP (SEQ ID NO: 58); Gliadin linker: GCRGGGPQPQPFPSQQPY (SEQ ID NO: 59); Gliadin extended: GCRGGGPQPQPFPSQQPYLQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF (SEQ ID NO: 60); Gliadin deamidated extended: GCRGGGPQPQPFPSQQPYLQLQPFPQPELPYPQPELPYPQPELPYPQPQPF (SEQ ID NO: 61); from strawberry: major strawberry allergy Fra a 1-E (Fra a 1); and from banana: profilin (Mus xp 1).

(159) In the embodiments where the antigen is a foreign antigen against which an unwanted immune response is developed, such as to animal, plant and environmental antigens, specific antigens can, for example, be: cat, mouse, dog, horse, bee, dust, tree and goldenrod, including the following proteins or peptides derived from: weeds, (including ragweed allergens amb a 1, 2, 3, 5, and 6, and Amb t 5; pigweed Che a 2 and 5; and other weed allergens Par j 1, 2, and 3, and Par o 1); grass (including major allergens Cyn d 1, 7, and 12; Dac g 1, 2, and 5; Hol I 1.01203; Lol p 1, 2, 3, 5, and 11; Mer a 1; Pha a 1; Poa p 1 and 5); pollen from ragweed and other weeds (including curly dock, lambs quarters, pigweed, plantain, sheep sorrel, and sagebrush), grass (including Bermuda, Johnson, Kentucky, Orchard, Sweet vernal, and Timothy grass), and trees (including catalpa, elm, hickory, olive, pecan, sycamore, and walnut); dust (including major allergens from species Dermatophagoides pteronyssinus, such as Der p 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 14, 15, 18, 20, 21, and 23; from species Dermatophagoides farina, such as Der f 1, 2, 3, 6, 7, 10, 11, 13, 14, 15, 16, 18, 22, and 24; from species Blomia tropicalis such as Blo t 1, 2, 3, 4, 5, 6, 10, 11, 12, 13, 19, and 21; also allergens Eur m 2 from Euroglyphus maynei, Tyr p 13 from Tyrophagus putrescentiae, and allergens Bla g 1, 2, and 4; Per a 1, 3, and 7 from cockroach); pets (including cats, dogs, rodents, and farm animals; major cat allergens include Fel d 1 through 8, cat IgA, BLa g 2, and cat albumin; major dog allergens include Can f 1 through 6, and dog albumin); bee stings, including major allergens Api m 1 through 12; and fungus, including allergens derived from, species of Aspergillus and Penicillium, as well as the species Alternaria alternata, Davidiella tassiana, and Trichophyton rubrum.

(160) In Parkinson's disease, the main antigen is alpha synuclein. Alpha synuclein, including an exogenously obtained form useful in the tolerogenic compositions of the disclosure, has the following sequence (UNIPROT P37840):

(161) TABLE-US-00017 (SEQIDNO:62) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVV HGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKD QLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA.

(162) The antigen can be a complete protein, a portion of a complete protein, a peptide, or the like, and can be derivatized (as discussed above) for attachment to a linker and/or mannosylating moiety, can be a variant and/or can contain conservative substitutions, particularly maintaining sequence identity, and/or can be desilylated.

F. EXAMPLES

(163) The following examples are included to demonstrate non-limiting embodiments of the invention disclosed herein. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the embodiments of the invention. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the embodiments of the invention disclosed herein.

Example 1

Polymer and Conjugate Synthesis

(164) All reactions were carried out at room temperature unless specified. Unless otherwise stated, chemicals were reagent grade and purchased from Sigma-Aldrich (Saint Louis, Mo., USA). Size exclusion chromatography was carried out on an KTA protein purification system (General Electric Healthcare Lifesciences), using a Superdex 200 10/300 column (General Electric Healthcare Lifesciences). All NMR spectra were collected on a Bruker Avance-II 400 MHz NMR, unless otherwise noted, and NMR spectra were analyzed with MnovaNMR (Mestrelab). High pressure size exclusion chromatography was performed on a Dionex Ultimate 3000 UHPLC (Thermo Fisher Scientific). Gels were imaged using a Biorad Universal Hood Gel Doc 2000 System (Biorad). Antigens conjugated to polymers as disclosed in the Examples are non-limiting examples of tolerogenic antigens according to embodiments disclosed herein, including embodiments using immunogenic fragments of antigens.

Compound 1: 1-(2-chloroethyl)--D-mannose

(165) Acetyl chloride (4.35 mL, 61.05 mmol) was added dropwise to the ice-cold solution of D-mannose (10.0 g, 55.51 mmol) in chloroethanol (40 mL, 413.68 mmol). The mixture was stirred for 15 minutes at 4 C. and then was transferred to the oil bath at 70 C. The reaction was then stirred for 4 h. After cooling to room temperature, a dark brown solution was poured into a 400 mL solution of ethyl acetate and DCM (3:1, v/v) in order to remove excess chloroethanol. The mixture was placed at 20 C. for 30 minutes and then a dark brown sticky precipitate was collected from the supernatant. The precipitate was dissolved in anhydrous ethanol and 3 spoons of activated charcoal was added. The suspension was mixed for 1.5 h and then filtered through Celite and washed with ethanol. In the last step, ethanol was evaporated via rotary evaporation to provide 12.8 g (95.24%) of product: C.sub.8H.sub.15ClO.sub.6, ESI-MS [M+Na].sup.+.sub.theor=m/z 265.0455, [M+Na].sup.+.sub.found=m/z 265.0458; .sup.1H NMR (400 MHz, D.sub.2O) 4.86 (s, C1, 1H), 3.92 (dd, C2, 1H), 3.62-3.85 (multiple signals from 7H: C3, C4, C5, C6, C6, ethoxy group); .sup.13C NMR (100 MHz, D.sub.2O) 99.84, 76.32, 72.94, 70.52, 69.94, 69.65, 67.76, 66.75, 60.96, 43.39.

(166) ##STR00034##

(167) Compound 1 (12.7 g, 52.48 mmol) was dissolved in 15 mL of N,N-dimethylformamide. To that solution, sodium azide was added (5.0 g, 76.92 mmol) and the suspension was placed in an oil bath and stirred over night at 90 C. After 16 h, the reaction mixture was filtered through Celite and the solvent was then removed via rotary evaporation to provide a oily, brown substance. The residual was adsorbed on silica gel and purified using flash chromatography (DCM:MeOH 92:8, v/v) to yield 5.6 g (42.86%) of pure product: C.sub.8H.sub.15N.sub.3O.sub.6, ESI-MS [M+Na].sup.+.sub.theor=m/z 272.2578, [M+Na].sup.+.sub.found=m/z 272.0850; .sup.1H NMR (400 MHz, D.sub.2O) 4.84 (s, C1, 1H), 3.91 (dd, C2, 1H), 3.39-3.87 (multiple signals from 7H: C3, C4, C5, C6, C6, ethoxy group); .sup.13C NMR (100 MHz, D.sub.2O) 99.85, 72.94, 70.44, 69.98, 66.73, 66.34, 50.24.

(168) ##STR00035##

(169) A suspension of 2 (5.5 g, 22.09 mmol) and 10% palladium on carbon (one spoon, ca. 500 mg) in 10 mL of ethanol was hydrogenated in a Shlenk flask with an initial pressure of 2 bars of hydrogen gas. The reduction process was monitored by TLC. After 3 h reaction was completed and the suspension was filtered through Celite. The solvent was evaporated in vacuo to give 4.9 g (99.48%) of product: C8H17NO6, ESI-MS [M+Na]+theor=m/z 246.0954, [M+Na]+found=m/z 246.0955; 1H NMR (400 MHz, D2O) 4.80 (s, C1, 1H), 3.89 (dd, C2, 1H), 3.83-3.44 (multiple signals from 7H: C3, C4, C5, C6, C6, ethoxy group); 13C NMR (100 MHz, D2O) 99.87, 72.74, 70.55, 70.03, 68.82, 66.81, 60.97, 39.94.

(170) ##STR00036##

(171) Compound 3 (4.5 g, 20.17 mmol) was dissolved in 10 mL of N,N-dimethylformamide. To that solution, triethylamine (3 mL, 22.28 mmol) was added and the mixture was cooled down to 4 C. Subsequently, pentafluorophenyl methacrylate (4.38 mL, 24.21 mmol) was added drop-wise with constant stirring. After 30 minutes, ice-bath was removed and the reaction was allowed to stir at room temperature for the next 4 h. Next, the solvent was evaporated and the residual was adsorbed on silica gel. The purification of crude material using flash chromatography (DCM:MeOH 95:5, v/v) provided 3.8 g (64.73%) of mannose monomer: C12H21NO7, ESI-MS [M+Na]+theor=m/z 314.1216, [M+Na]+found=m/z 314.1208; 1H NMR (400 MHz, D2O) 5.6 (s, 1H), 5.38 (s, 1H), 4.78 (s, 1H), 3.84 (s, C2, 1H), 3.77-3.34 (multiple signals from 7H: C3, C4, C5, C6, C6, ethoxy group), 1.85 (s, 3H); 13C NMR (100 MHz, D2O) 172.06, 139.06, 121.00, 99.63, 72.78, 70.47, 69.99, 66.58, 65.73, 60.78, 39.04, 17.68.

(172) ##STR00037##

(173) Tetraethylene glycol (2.5 g, 12.9 mmol) and pyridine (1.0 g, 12.6 mmol) were added to 50 mL of DCM and stirred for 20 minutes at 0 C. To that solution, p-toluenesulfonyl chloride (2.37 g, 10 mmol) in 15 mL of DCM was added slowly. The reaction mixture was then stirred for 2 h at 0 C. followed by 4 h at room temperature. After that time, the solvent was evaporated and crude product was purified via flash chromatography (ethyl acetate:hexane 6:4, v/v). The final yield was 1.95 g (72.22%): C15H24O7S, ESI-MS [M+H]+theor=m/z 349.1321, [M+H]+found=m/z 349.1325; 1H NMR (400 MHz, CDCl3) 7.68 (d, 2H), 7.24 (d, 2H), 4.00-4.12 (m, 2H), 3.42-3.70 (m, 14H), 2.89 (t, 1H), 2.33 (s, 3H); 13C NMR (100 MHz, DMSO-d6) 144.68, 132.76, 129.68, 127.73, 72.34, 70.46, 70.41, 70.22, 70.10, 69.17, 68.44, 61.40, 21.41.

(174) ##STR00038##

(175) Sodium azide (1.5 g, 23.1 mmol) was added to a solution of 17 (1.5 g, 4.3 mmol) in N,N-dimethylformamide (75 mL) at room temperature. The reaction mixture was stirred overnight at 90 C. The reaction was then filtered and the solvent was removed in vacuo. The resulting viscous liquid was then purified by flash column chromatography (ethyl acetate:hexane 6:4, v/v) to yield a pure product (1.25 g, 83%): C8H17N3O4, ESI-MS [M+Na]+theor=m/z 242.1117, [M+Na]+found=m/z 242.1171; 1H NMR (400 MHz, DMSO-d6) 3.49-3.65 (m, 14H), 3.30 (t, 2H), 2.91 (t, 1H); 13C NMR (100 MHz, DMSO-d6) 72.43, 70.56, 70.52, 70.46, 70.21, 69.91, 61.51, 50.54.

(176) ##STR00039##

(177) 4-Cyano-4-[(dodecylsulfanylthiocarbonyl)sulfanyl]pentanoic acid (500 mg, 1.24 mmol), compound 18 (226 mg, 1.03 mmol) and DCC (255 mg, 1.24 mmol) were dissolved in 4 mL of DCM. The solution was placed in an ice bath and let stir for 30 minutes. After that time, 4-dimethylaminopyridine (12.6 mg, 0.10 mmol) dissolved in 1 mL of DCM was added drop-wise. The solution was stirred at 0 C. for 2 h and then at room temperature for 1 hour. Once reaction was completed, DCM was evaporated in vacuum. The crude product was purified via column chromatography (DCM:ethyl acetate 97:3, v/v) to yield 300 mg (88.57%) of the pure product: C27H48N4O5S3, ESI-MS [M+H]+theor=m/z 604.2865 [M+H]+found=m/z 604.2862; 1H NMR (400 MHz, CDCl3) 4.26 (t, 2H), 3.76-3.65 (m, 12H), 3.39 (t, 2H), 3.33 (t, 2H), 2.66 (dd, 2H), 2.53 (m, 1H), 2.38 (m, 1H), 1.88 (s, 3H), 1.69 (dt, 2H), 1.38 (m, 2H), 1.26 (s, 16H), 0.88 (t, 3H); 13C NMR (100 MHz, CDCl3) 216.92, 171.46, 119.00, 70.72, 70.68, 70.61, 70.07, 68.96, 64.16, 50.69, 46.35, 37.06, 33.81, 31.91, 29.71, 29.62, 29.54, 29.42, 29.34, 29.07, 28.93, 27.68, 24.84, 22.69, 14.13.

(178) ##STR00040##

(179) The mannose monomer (4) (150.0 mg, 0.51 mmol) and (20) (130.0 mg, 1.03 mmol) were dissolved in 600 l of anhydrous DMF and added to a schlenk tube. Then, RAFT agent (19) (18.5 mg, 0.03 mmol) in 100 l of DMF and AIBN (1 mg, 0.006 mmol) in 10 l of DMF were added to the schlenk tube. The tube was degassed via four freeze-pump-thaw cycles and then immersed in an oil bath preheated at 70 C. to initiate polymerization. The reaction was left stirring for 14 hours. After that time, the polymer was precipitated by transferring its viscous solution into 20 mL of cold acetone. The light-yellow suspension was placed in the freezer for 30 minutes. The precipitate was then centrifuged and re-suspended in fresh acetone. The processed was repeated 3 times. In the final step, the resultant glycopolymer (150 mg, 47.6%) was dried in a vacuum oven at reduced pressure and characterized by means of 1H NMR and GPC. The p(HPMA-TLR7) used in the biological studies had a number average molecular weight of 15,425 Da, as determined by size exclusion chromatography, using a dextran standard, a degree of polymerization of 82.1, and were composed of a 1:2.25 molar ratio of Mannose:HPMA, as determined by 1H NMR.

(180) ##STR00041##

(181) A solution of thiol polyethylene glycol amine (JenKem Technology, USA) (1.0 g, 0.5 mmol) in DCM (5 ml) was added dropwise to a stirred solution of 2-(2-pyridinyldithio)ethanol (24) (467.5 mg, 2.5 mmol) in MeOH (3 ml). The solution was stirred at room temperature for 10 h then approximately half the solvent was removed via rotary evaporation. The remaining crude product was then decanted into ice cold hexanes (40 ml) and placed at 20 C. for 4 h. The precipitate and solvent mixture was centrifuged at 2000 g for 3 min. The solvent was then decanted and excess solvent was removed from the pelleted precipitate under reduced pressure. The crude product was then used in the next step without further purification (65% crude yield). The final structure was characterized by 1H NMR and reverse phase chromatography.

(182) ##STR00042##

(183) A solution of (1R,8S,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyl N-succinimidyl carbonate (90 mg, 0.30 mmol) in DCM (0.5 ml) was added dropwise to an ice-cooled stirred solution of ethanol disulfanyl polyethylene glycol amine 25 (0.5 g, 0.24 mmol) and trimethylamine (48 mg, 0.48 mmol) in DCM (5 ml). After the addition of (1R,8S,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyl N-succinimidyl carbonate, the reaction was allowed to come to room temperature and stirred for another 6 h. The reaction mixture was then poured into ice-cold hexanes (40 ml) and placed at 20 C. for 4 h. The precipitate and solvent mixture was centrifuged at 2000 g for 3 min. The solvent was then decanted and excess solvent was removed from the pelleted precipitate under reduced pressure. The crude product was then used in the next step without further purification (75% crude yield). The final structure was characterized by 1H NMR and reverse phase chromatography.

(184) ##STR00043##

(185) A solution of Ethanol disulfanyl polyethylene glycol (1R,8S,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyl carbamate (300 mg, 0.13 mmol) in anhydrous acetonitrile (ACN) (1.5 ml) was added dropwise to a stirred solution of N,N-Disuccinimidyl carbonate 26 (0.5 g, 0.24 mmol) and trimethylamine (48 mg, 0.48 mmol) in anhydrous ACN (5 ml). The reaction mixture was stirred overnight and was then poured into ice-cold hexanes (40 ml) and placed at 20 C. for 4 h. The precipitate and solvent mixture was centrifuged at 2000 g for 3 min. The solvent was then decanted and excess solvent was removed from the pelleted precipitate under reduced pressure. The crude product was purified via silica gel flash chromatography trough a thin pad of silica DCM:MeOH (85:15) (yield: 43%, 129 mg). The final structure was characterized by 1H NMR and reverse phase chromatography.

(186) ##STR00044##

(187) EndoGrade Ovalbumin (OVA) (Hyglos) (10 mg, 222.2 nmol), recombinant asparaginase (7.2 mg, 222.2 nmol) and self-immolative Linker (27) (5 mg) were added to an endotoxin free tube. Phosphate buffer at pH 7.7 (200 L) was added to the tube and the tube was stirred at 1 h at room temperature. The reaction mixture was then filtered (0.22 M) and the conjugates were purified via Zeba Spin Desalting Columns with a 30 kDa cutoff limit (Thermo Fisher). Chemical conjugation was verified via gel electrophoresis and high pressure size exclusion chromatography.

(188) ##STR00045##

(189) Compound 28 in PBS, prepared as described above, was added to an endotoxin free tube and p(Man) (21) (30 mg) was added and the reaction was stirred for 30 min at room temperature. The reaction mixture was then filtered (0.22 M) and the final product was purified via size exclusion chromatography. Chemical conjugation was verified via gel electrophoresis and high pressure size exclusion chromatography.

(190) ##STR00046##

Example 2

OTI/OTII Challenge to Tolerance Model

(191) BLK6 mice were treated with saline, or 10 g of OVA (as a non-limiting example of an immunogenic antigen) in the form of free OVA or OVA conjugated to p(Man) (OVA-p(Man)) one day and 7 days after an adoptive transfer of 7.010.sup.5 OTI and OTII T cells. These mice were challenged with an intradermal injection of LPS and OVA 14 days after the initial OTI and OTII T cell transfer and then the immune response in the draining lymph nodes (dLNs) was assessed on day 19 and compared to mice that were treated with saline, but did not receive the challenge of LPS and OVA (No-challenge).

(192) Profound tolerance was induced in the CD4+ T cell compartment, as shown in FIGS. 1-2. In terms of total cell frequencies, both dosing regimens of both OVA-p(Man) resulted in equivalent low levels of OTII cells after challenge, statistically lower than by treatment of OVA (* indicates p<0.05, ** indicates p<0.01), as shown in FIG. 1. When the cells that remained were analyzed by flow cytometry for the presence of the transcription factor FoxP3 and the receptor CD25, the numbers of FoxP3+CD25+ cells (markers of T regulatory cells) was statistically significantly elevated compared to treatment with OVA alone, as shown in FIG. 1. Additionally, the spleens of animals treated with OVA-p(Man) contained a lower percentage of T follicular helper cells (Tfh) as compared to other groups that were challenged with LPS and OVA. When the cells that remained were analyzed by flow cytometry for the expression of IFN- after exposure to OVA antigen, the frequency of CD4+ T cells expressing this inflammatory cytokine was decreased in the groups receiving OVA-p(Man), as shown in FIG. 2.

(193) Profound tolerance was also induced in the CD8+ T cell compartment, as shown in FIG. 1. In terms of total cell frequencies, OVA-p(Man) resulted in equivalent low levels of OTI cells after challenge, statistically lower than by treatment of OVA (* indicates p<0.05, ** and indicates p<0.01), as shown in FIG. 1. When the cells that remained were analyzed by flow cytometry for the expression of IFN- after exposure to SIINFEKLE antigen, the frequency of CD8+ T cells expressing this inflammatory cytokine was decreased in the groups receiving OVA-p(Man), as shown in FIG. 2.

Example 3

Tolerance Induction to Intravenously Administered Asparaginase

(194) Five BALB/c mice per group were injected with 2.5 g of asparaginase (as a non-limiting example of an immunogenic antigen) formulated as free asparaginase (ASNase) or conjugated to p(Man) (ASNase-p(Man)) once a week for 3 weeks and then, at week 4, were switched to 15 g of ASNase i.v. once a week for 8 weeks. During the initial 3 weeks ASNase-p(Man) was administered via either i.v. or subcutaneous injection. Sera was taken from the mice and monitored weekly for the presence of ASNase.

(195) Upon intravenous injection of ASNase at week 4, animals treated with saline and subcutaneously administered ASNase-p(Man) experienced a rapid increase in serum ASNase IgG (FIG. 3), animals treated with i.v. administered ASNase-p(Man) did not incur an increase in serum ASNase IgG for the duration of the experiment. Furthermore, after 38 days of treatment, animals treated with ASNase-p(Man) via intravenous infusion, experienced significantly lower ASNase IgG subclass titers (FIG. 3).

(196) At week 22 (3 weeks of tolerization, 8 weeks of ASNase treatment, and 11 weeks after last dose of Asnase), animals treated with saline and ASNase-p(Man) via intravenous infusion were sacrificed and the spleens, livers, and bone marrow of these animals was collected and processed into single cell suspensions. The cells from these organs were stimulated in vitro with recombinant ASNase lacking activity for 3 days. After three days the cells were analyzed via flow cytometry for the existence of ASNase producing cells (plasma cells) and IL-10 producing B regulatory cells. The results show that the bone marrow of animals treated with ASNase-p(Man) had a fewer ASNase plasma cells than animals that were treated with ASNase (FIG. 4). On the contrary, the spleens of animals treated with ASNase-p(Man) had a greater percentage of IL-10 producing B regulatory cells.

Example 4

Effect on Anti-Asparaginase (Anti-ASNase) Humoral Immune Response

(197) To assess the ability of p(Man)-protein conjugates to prevent an anti-asparaginase (anti-ASNase) humoral immune response and thus avoid the loss of efficacy that is the result of rapid antibody-mediated clearance of biological therapeutics form the serum, mice were treated on days 21, 14, and 7 with saline or 2.5 g of ASNase conjugated to p(Man) (p(Man)-ASNase) via iv infusion (n=5 animals per group). After 7 days, the mice were then treated with weekly iv infusions of 15 g of wt ASNase for 4 weeks. The mice were then treated with 15 g of wt ASNase on day 49. On day 70, mice that had been treated with saline on days 21, 14, 7, 0, 14, 21, and 49 were treated with 15 g of wt ASNase to assess the efficacy of ASNase in nave mice (FIG. 6). On day 70, the mice that had received saline or p(Man)-ASNase then treated with wt ASNase were also administered 15 g of wt ASNase. The serum asparagine concentration of each animal was assessed on days 71, 73, and 76.

(198) The results show that one day after being treated with ASNase, animals in each group have a similar serum concentration of asparagine. However, three days after being administered asparagine on day 7, animals treated with only saline or p(Man)-ASNase have a significantly lower serum asparagine concentration as compared to animals that had been treated with saline and then administered wt ASNase on days 0, 7, 14, 21, and 49 (FIG. 7A). In addition, animals treated with p(Man)-ASNase had significantly lower asparagine serum concentrations on day 76 than the animals in other groups. When serum asparagine concentration is plotted against the anti-ASNase titer for each animal in the study, a strong correlation (r=0.8) between serum asparagine concentration and anti-ASNase titer becomes evident (FIG. 7B). These results demonstrate that p(Man)-ASNase inhibits the loss of efficacy associated with an anti-ASNase immune response.

(199) All of the methods and compositions disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the methods and apparatuses and in the steps or in the sequence of steps of the methods described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.