PLXDC1/PLXDC2 ACTIVATORS AND THEIR USE IN THE TREATMENT OF BLOOD VESSEL DISORDERS

20250230226 ยท 2025-07-17

    Inventors

    Cpc classification

    International classification

    Abstract

    Pathogenic blood vessels are blood vessels that are not involved in the vascularization of normal organs but are in the pathogenic tissues such as the new blood vessels that drive vision diseases or the blood vessels in tumors that tumors depend on to survive. The current disclosure provides an advancement over typical anti-angiogenic strategies that target the generation of new blood vessels by providing compositions and methods that can selectively target and kill existing pathogenic blood vessels. The conventional antiangiogenic drugs or factors inhibit angiogenesis (the growth of new blood vessels), but cannot effectively kill existing pathogenic blood vessels. Agents, including small molecule compounds and antibodies, have been identified that bind to and activate PLXDC1 and PLXDC2 proteins, leading to effective killing of the endothelial cells in pathogenic blood vessels in vision diseases and in tumors that express these proteins. The disclosure thereby provides a novel modality for eliminating or reducing existing pathogenic blood vessels, thereby treating diseases such as diabetic retinopathy, age-related macular degeneration (AMD), retinopathy of prematurity, and cancer.

    Claims

    1. A method for treating a disorder in a patient, wherein the disorder is characterized with pathogenic blood vessels and the method comprises administering to the patient an antibody or antigen binding fragment thereof that is specific to and capable of activating a plexin domain-containing (PLXDC) protein expressed in the pathogenic blood vessels in the patient.

    2. The method of claim 1, wherein the PLXDC protein comprises PLXDC1 or PLXDC2.

    3-5. (canceled)

    6. The method of claim 1, wherein the antibody or antigen binding fragment thereof is not capable of mediating antibody-dependent cell-mediated cytotoxicity (ADCC).

    7. The method of claim 1, wherein the antibody or antigen binding fragment thereof binds to the PLXDC protein with a higher affinity in the presence of a small molecule compound that binds and activates the PLXDC protein, as compared to when the small molecule compound is not present.

    8. The method of claim 1, wherein the antibody or antigen binding fragment thereof binds to Domain A, C, D, or E of PLXDC1.

    9-12. (canceled)

    13. The method of claim 1, wherein the antibody or antigen binding fragment thereof does not bind to Domain B of PLXDC1.

    14. (canceled)

    15. The method of claim 1, wherein the agent binds to an amino acid residue of PLXDC that is not exposed in the basal state.

    16-18. (canceled)

    19. The method of claim 1, wherein the disorder is selected from the group consisting of diabetic retinopathy, age-related macular degeneration (AMD), retinopathy of prematurity, cancer and combinations thereof.

    20. The method of claim 19, wherein the disorder is a tumor.

    21. The method of claim 20, wherein the tumor comprises a solid tumor.

    22. The method of claim 20, wherein the tumor has a diameter of greater than 2 cm.

    23-32. (canceled)

    33. The method of claim 1, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) comprising a complementarity-determining region 1 (CDR1), a VH CDR2, and a VH CDR3, and a light chain variable region (VH) comprising a VL CDR1, a VL CDR2 and a VL CDR3, wherein the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3, respectively, comprise the amino acid sequences of: (1) SEQ ID NO: 224, 248, 341, 435, 497, and 517; (2) SEQ ID NO: 225, 249, 342, 436, 498, and 518; (3) SEQ ID NO: 226, 250, 343, 437, 499, and 519; (4) SEQ ID NO: 227, 251, 344, 438, 500, and 520; (5) SEQ ID NO: 228, 252, 345, 439, 501, and 521; (6) SEQ ID NO: 229, 253, 346, 440, 501, and 522; (7) SEQ ID NO: 226, 254, 347, 441, 500, and 523; (8) SEQ ID NO: 230, 255, 348, 442, 502, and 524; (9) SEQ ID NO: 231, 256, 349, 443, 500, and 525; (10) SEQ ID NO: 232, 257, 350, 444, 500, and 526; (11) SEQ ID NO: 227, 258, 351, 445, 500, and 527; (12) SEQ ID NO: 226, 259, 352, 446, 502, and 528; (13) SEQ ID NO: 224, 260, 353, 445, 500, and 523; (14) SEQ ID NO: 224, 261, 354, 447, 500, and 529; (15) SEQ ID NO: 232, 262, 355, 448, 503, and 530; (16) SEQ ID NO: 229, 263, 356, 449, 500, and 531; (17) SEQ ID NO: 226, 264, 357, 450, 500, and 532; (18) SEQ ID NO: 224, 265, 358, 451, 504, and 523; (19) SEQ ID NO: 229, 266, 359, 448, 500, and 533; (20) SEQ ID NO: 226, 267, 360, 452, 502, and 534; (21) SEQ ID NO: 233, 268, 361, 439, 501, and 535; (22) SEQ ID NO: 226, 269, 362, 453, 502, and 536; (23) SEQ ID NO: 234, 270, 363, 454, 502, and 537; (24) SEQ ID NO: 226, 271, 364, 444, 500, and 538; (25) SEQ ID NO: 226, 272, 365, 455, 502, and 539; (26) SEQ ID NO: 226, 273, 366, 456, 501, and 540; (27) SEQ ID NO: 229, 274, 367, 457, 501, and 541; (28) SEQ ID NO: 224, 275, 368, 444, 503, and 542; (29) SEQ ID NO: 234, 270, 363, 446, 502, and 543; (30) SEQ ID NO: 229, 276, 369, 458, 502, and 544; (31) SEQ ID NO: 229, 277, 370, 454, 502, and 545; (32) SEQ ID NO: 232, 278, 371, 459, 500, and 531; (33) SEQ ID NO: 224, 279, 372, 460, 504, and 531; (34) SEQ ID NO: 231, 280, 373, 444, 505, and 546; (35) SEQ ID NO: 235, 281, 374, 461, 501, and 547; (36) SEQ ID NO: 226, 282, 375, 462, 500, and 523; (37) SEQ ID NO: 226, 283, 376, 463, 506, and 548; (38) SEQ ID NO: 226, 284, 377, 464, 501, and 549; (39) SEQ ID NO: 236, 285, 378, 435, 507, and 550; (40) SEQ ID NO: 226, 286, 379, 465, 508, and 551; (41) SEQ ID NO: 229, 287, 380, 435, 509, and 552; (42) SEQ ID NO: 237, 288, 381, 466, 509, and 553; (43) SEQ ID NO: 238, 289, 382, 467, 510, and 554; (44) SEQ ID NO: 226, 290, 376, 435, 511, and 555; (45) SEQ ID NO: 239, 291, 383, 435, 508, and 556; (46) SEQ ID NO: 224, 292, 384, 468, 512, and 557; (47) SEQ ID NO: 240, 293, 385, 469, 502, and 558; (48) SEQ ID NO: 231, 294, 386, 445, 500, and 559; (49) SEQ ID NO: 226, 295, 387, 470, 501, and 560; (50) SEQ ID NO: 229, 296, 388, 435, 498, and 561; (51) SEQ ID NO: 226, 297, 389, 435, 498, and 562; (52) SEQ ID NO: 241, 298, 390, 454, 513, and 563; (53) SEQ ID NO: 224, 299, 376, 459, 505, and 564; (54) SEQ ID NO: 229, 300, 391, 445, 500, and 565; (55) SEQ ID NO: 226, 301, 392, 471, 501, and 566; (56) SEQ ID NO: 226, 302, 393, 472, 500, and 567; (57) SEQ ID NO: 226, 303, 394, 473, 500, and 523; (58) SEQ ID NO: 226, 304, 395, 462, 500, and 523; (59) SEQ ID NO: 229, 305, 396, 444, 500, and 568; (60) SEQ ID NO: 224, 306, 397, 474, 505, and 569; (61) SEQ ID NO: 224, 307, 398, 463, 500, and 570; (62) SEQ ID NO: 224, 308, 399, 472, 503, and 531; (63) SEQ ID NO: 242, 309, 400, 442, 514, and 571; (64) SEQ ID NO: 224, 310, 376, 475, 500, and 530; (65) SEQ ID NO: 224, 311, 401, 476, 513, and 572; (66) SEQ ID NO: 243, 312, 402, 477, 515, and 573; (67) SEQ ID NO: 226, 313, 403, 478, 516, and 535; (68) SEQ ID NO: 229, 314, 404, 479, 513, and 574; (69) SEQ ID NO: 229, 315, 405, 439, 516, and 575; (70) SEQ ID NO: 226, 303, 394, 473, 500, and 523; (71) SEQ ID NO: 234, 316, 406, 438, 500, and 523; (72) SEQ ID NO: 224, 317, 407, 439, 516, and 576; (73) SEQ ID NO: 244, 318, 408, 458, 514, and 577; (74) SEQ ID NO: 234, 270, 363, 446, 502, and 543; (75) SEQ ID NO: 226, 304, 395, 462, 500, and 523; (76) SEQ ID NO: 229, 300, 391, 445, 500, and 565; (77) SEQ ID NO: 231, 280, 373, 438, 500, and 578; (78) SEQ ID NO: 224, 319, 409, 439, 516, and 579; (79) SEQ ID NO: 224, 317, 407, 439, 516, and 576; (80) SEQ ID NO: 245, 320, 410, 480, 516, and 580; (81) SEQ ID NO: 224, 317, 407, 439, 516, and 576; (82) SEQ ID NO: 242, 321, 411, 481, 500, and 581; (83) SEQ ID NO: 226, 322, 412, 482, 503, and 582; (84) SEQ ID NO: 224, 323, 413, 474, 500, and 583; (85) SEQ ID NO: 226, 324, 414, 445, 505, and 584; (86) SEQ ID NO: 226, 325, 415, 450, 500, and 585; (87) SEQ ID NO: 243, 312, 416, 477, 515, and 573; (88) SEQ ID NO: 226, 325, 415, 450, 503, and 585; (89) SEQ ID NO: 229, 300, 417, 445, 500, and 565; (90) SEQ ID NO: 224, 326, 418, 483, 500, and 531; (91) SEQ ID NO: 226, 327, 419, 484, 500, and 529; (92) SEQ ID NO: 226, 279, 420, 485, 500, and 531; (93) SEQ ID NO: 226, 304, 421, 486, 500, and 523; (94) SEQ ID NO: 224, 328, 422, 470, 501, and 586; (95) SEQ ID NO: 226, 329, 376, 484, 500, and 548; (96) SEQ ID NO: 229, 300, 417, 445, 500, and 565; (97) SEQ ID NO: 224, 330, 423, 487, 505, and 587; (98) SEQ ID NO: 229, 279, 424, 438, 500, and 588; (99) SEQ ID NO: 246, 331, 425, 488, 501, and 589; (100) SEQ ID NO: 226, 332, 426, 489, 516, and 566; (101) SEQ ID NO: 226, 333, 427, 490, 501, and 590; (102) SEQ ID NO: 247, 334, 428, 491, 516, and 535; (103) SEQ ID NO: 229, 335, 429, 492, 500, and 567; (104) SEQ ID NO: 224, 336, 430, 493, 502, and 591; (105) SEQ ID NO: 232, 337, 431, 494, 500, and 592; (106) SEQ ID NO: 241, 298, 390, 454, 513, and 563; (107) SEQ ID NO: 226, 338, 432, 495, 502, and 593; (108) SEQ ID NO: 229, 339, 433, 496, 503, and 529; (109) SEQ ID NO: 226, 340, 434, 438, 500, and 548; or (110) SEQ ID NO: 226, 269, 362, 454, 502, and 594.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0041] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure. The disclosure may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.

    [0042] FIG. 1A-H. Expression of PLXDC1 in pathogenic blood vessels in choroidal neovascularization (CNV) and ischemia-induced retinopathy. Red channel shows blood vessel marker Griffonia Simplicifolia Lectin I-isolectin B4. Green channel shows anti-PLXDC1 signal. A-D. Highly enriched PLXDC1 expression in pathogenic blood vessels in a mouse model of CNV (laser-induced CNV). A&B, retina sections. Arrowheads indicate examples of normal inner retinal blood vessels (in A) that are negative for PLXDC1 signal (in B). C&D, staining done on flat-mounted eye cup. E-H. High expression of PLXDC1 in pathogenic blood vessels in a mouse model of ischemia-induced retinopathy, but not in blood vessels of healthy retina. E&F. P17 retina of ischemia-induced retinopathy (E and F are the same section stained by endothelial cell marker and PLXDC1 antibody, respectively). Examples of pathogenic blood vessels expressing PLXDC1 are indicated by white arrows. G&H. P17 healthy retina (G and H are the same section stained by endothelial cell marker and PLXDC1 antibody, respectively). Examples of healthy blood vessels showing no detectable PLXDC1 expression are indicated by white arrows in G (there is no corresponding PLXDC1 signals in H). CH, choroid. ON, outer nuclear layer. IN, inner nuclear layer. GC, ganglion cell layer.

    [0043] FIG. 2A-E. Comparison of compound 369 (Table 3) with the current anti-angiogenic drug in an ex vivo model of choroidal angiogenesis. A. A schematic diagram of the timeframe of the experiment. Treatment does not start until choroidal angiogenesis occurs for 7 days. Treatment lasts for two days before cell death and survival are analyzed. B. Control experiment without any drug treatment at day 7. The white circle in the middle delineates the piece of choroid/RPE that was embedded to initiate neovascularization. C. The most commonly used drug for choroidal neovascularization, Eylea, can inhibit choroidal endothelial cell growth (as expected of an antiangiogenesis drug). Eylea was added at 10 M. D. Compound 369 that targets PLXDC1/PLXDC2 can kill the new endothelial cells in choroidal angiogenesis. Choroid and RPE are still alive after the treatment, demonstrating the high specificity of the treatment. The compound was added at 10 M. In B-D, green cells are live cells and red cells are dead cells. E. Quantitation of the experiments described in B-D. The amount of new endothelial cells in the untreated control is defined as 100%.

    [0044] FIG. 3A-B. Choroidal neovascularization in an AMD patient treated by a commonly used anti-VEGF drug (Eylea). After 24 injections between 2015 and 2018, the pathogenic blood vessels still grew slightly and are not killed by the treatment. Fundus pictures of the pathogenic blood vessels in 2015 (A) and 2018 (B) are shown.

    [0045] FIG. 4A-F. A comparison between an anti-VEGF drug, PEDF and two compounds that target PLXDC1/PLXDC2 in an ex vivo model of tumor angiogenesis. PEDF can inhibit tumor endothelial cell growth (as expected of an antiangiogenesis factor), but two compounds that target PLXDC1/PLXDC2 can kill tumor endothelial cells. Anti-VEGF drug (VEGF trap) is not very effective in this experiment due to the presence of other angiogenic factors such as bFGF and EGF in the culture media. Tumor endothelial cells were grown for 5 days before test reagents were added for 2 days. Green cells are live cells and red cells are dead cells.

    [0046] FIG. 5A-C. Killing of human tumor endothelial cells by antibodies against human PLXDC1. In 3D ex vivo model of human tumor endothelial cells, anti-human PLXDC1 monoclonal antibody clones AA03 and AA94 kill human tumor endothelial cells. The tumor is a from human colon cancer. Green cells represent live cells. Red cells represent dead cells.

    [0047] FIG. 6A-B. Killing of human tumor endothelial cells by antibodies against human PLXDC1. In 3D ex vivo model of human tumor endothelial cells, anti-human PLXDC1 monoclonal antibody clones AA02, but a control antibody, kills human tumor endothelial cells. The tumor is from human liver cancer. Green cells represent live cells. Red cells represent dead cells.

    [0048] FIG. 7A-D. Systemic administration of a compound that targets PLXDC1 and PLXDC2 kills existing tumor blood vessels and leads to massive tumor necrosis. A. A control mouse that received systemic vehicle treatment has a live tumor, which shows reddish appearance indicative of a rich blood supply. B. A mouse that received systemic treatment by compound 369 that targets PLXDC1/PLXDC2 has a dead tumor, which shows yellowish appearance indicative of a dead tissue without blood supply. The high specificity of the treatment is illustrated by the healthy skin blood vessels that cover the dead yellow tumor. C. The tumor from control mouse in A is cut open to reveal that it is rich in tumor blood vessels and is a live tumor. D. The tumor from compound-treated mouse in B is cut open to reveal a lack of tumor blood vessels and a necrotic tumor with yellow cheese-like appearance (coagulative necrosis). Coagulative necrosis is exactly what is expected for a treatment that can kill existing tumor blood vessels to block major blood supplies to the tumor. Precise and efficient killing of tumor blood vessels to cause massive tumor death by necrosis, which has been achieved by the compound 369 targeting PLXDC1/PLXDC2, cannot be achieved by any existing drugs or known antiangiogenic factors.

    [0049] FIG. 8A-C. A comparison between antiangiogenesis treatment and killing existing tumor blood vessels by targeting PLXDC1/PLXDC2. Angiogenesis is the growth of new blood vessels from existing blood vessels. A. Tumor depends on angiogenesis to grow and to metastasize. B. Antiangiogenic drugs or factors inhibit angiogenesis and the growth of the tumor, but cannot kill the tumor because they cannot effectively kill existing tumor blood vessels. C. Drugs that target PLXDC1/PLXDC2 can kill existing tumor blood vessels to cause tumor death. This therapeutic effect goes beyond antiangiogenesis, which means the inhibition of new blood vessel growth.

    [0050] FIG. 9A-C. Schematic diagrams of the experimental strategy to detect the binding of compound 369 to PLXDC1. A. Schematic diagram of the compound structure. The compound was designed to have an albumin binding structure and structures responsible for PLXDC1 interaction. B. Schematic diagram of the binding of the compound to human albumin, which has been biotinylated (Biotin-HSA-Compound). C. Schematic diagram of the strategy to detect the binding of Biotin-HSA-Compound to PLXDC1's extracellular domain. After binding, the biotin in the complex is detected by avidin-alkaline phosphatase.

    [0051] FIG. 10A-D. The compound that kills endothelial cells expressing PLXDC1 interacts with PLXDC1 independently of Domain B. Left Picture. Schematic diagrams of the domains in PLXDC1 (domains A to E on the extracellular side, the transmembrane domain and the intracellular domain) and the constructs used in this experiment. The domains for human PLXDC1 are defined as: Domain A (20 to 127), Domain B (128 to 242), Domain C (243 to 292), Domain D (293 to 359) and Domain E (360-427). Residues are numbered according to the full-length PLXDC1 without the secretion signal. All constructs in this experiment include an epitope tag (labeled as R) at the N-terminus. R-PLXDC1=full length human PLXDC1; R-AB-Del=domain A-B-deleted human PLXDC1. A-D. Binding of biotinylated-HSA (Biotin-HSA) or biotinylated-HAS-compound complex (Biotin-HSA-Compound) to HEK293 cells transfected with the constructs. Purple color represents the binding signal. A=full length human PLXDC1 transfected cells; B=control untransfected cells; C=full length human PLXDC1 transfected cells; D=Domain A-B deleted human PLXDC1 transfected cells. Biotin-HSA-Compound was added to B-D, while Biotin-HSA was added to A.

    [0052] FIG. 11A-B. The monoclonal antibodies that kill endothelial cells expressing PLXDC1 interact with PLXDC1 independently of Domain B. A. Schematic diagrams of the domains in PLXDC1 (domains A to E on the extracellular side, the transmembrane domain and the intracellular domain) and the constructs used in this experiment. The domains for human PLXDC1 are defined as: Domain A (20 to 127), Domain B (128 to 242), Domain C (243 to 292), Domain D (293 to 359) and Domain E (360-427). Residues are numbered according to the full-length PLXDC1 without the secretion signal. All constructs in this experiment include an epitope tag (labeled as R) at the N-terminus. R-PLXDC1=full length human PLXDC1; R-AB-Del=domain A-B-deleted human PLXDC1; R-PLXDC2-full length human PLXDC2. B. Live cell staining of HEK293 cells transfected with the constructs using different antibodies. Red signal is immunostaining signal. Blue signal is a DNA stain that indicates cell nucleus. R antibody recognizes the R epitope on all constructs. Monoclonal antibodies AA02 and AA03 are capable of killing endothelial cells expressing PLXDC1. They recognizes all constructs except human PLXDC2, suggesting that they bind to PLXDC1 independently of Domain B.

    [0053] FIG. 12 shows that monoclonal antibodies activated PLXDC1. An assay of receptor-induced NF-B activation. Addition of anti-human PLXDC1 monoclonal antibodies Ab-AA02, Ab-AA03 and Ab-AA94 stimulate PLXDC1-induced NF-B activation. Both Ab-AA02 and Ab-AA03 recognize domain E of PLXDC1. Basal NF-B activation in PLXDC1 expressing cells is defined as 1.

    [0054] FIG. 13 illustrates a few different strategy of killing tumors.

    [0055] FIG. 14A-B show tumor shrinkage and necrosis following treatment with compounds described herein. FIG. 14A shows that 3 days after injection, all the tumors were shrinking. FIG. 14B shows that the tumor shrinkage was maintained 6 days after injection.

    [0056] FIG. 15A-B show high affinity interaction between PLXDC1-activating compounds and the extracellular domain of PLXDC1 (PLXDC1-ECD). A. Raw data of the tryptophan fluorescence of PLXDC1-ECD as measured in a fluorometer after adding different concentrations of the compound. B. Dose-dependent curve of the suppression of tryptophan fluorescence. Tryptophan fluorescence without compound added is defined as 1. The estimated Kd value is 50 nM.

    [0057] FIG. 16A-E show specific binding of PLXDC1-activating antibodies to human PLXDC1 expressed on live cells. A. Binding of an antibody against the epitope tag demonstrated the expression of human PLXDC1 (left picture) and human PLXDC2 (middle picture) in their transfected cells, while it does not bind to untransfected cells (right picture). The green signal is the antibody binding signal. B & C. Binding of receptor activating antibody (3-G7/A-TEM7-Ab-1) to cells transfected with human PLXDC1 (left picture). This antibody does not bind to human PLXDC2 (middle picture) or untransfected control cells (right picture). The green signal in B and C is the antibody binding signal. The blue signal in C represent cell nuclear staining by the DNA dye DAPI. D & E. Binding of receptor activating antibody (8-C9/A-TEM7-Ab-2) to cells transfected with human PLXDC1 (left picture). This antibody does not bind to human PLXDC2 (middle picture) or untransfected control cells (right picture). The green signal in D and E is the antibody binding signal. The blue signal in E represent cell nuclear staining by the DNA dye DAPI.

    [0058] FIG. 17A-B show binding avidity of PLXDC1 receptor-activating antibodies to PLXDC1 extracellular domain (PLXDC1-ECD). A. PLXDC1 receptor-activating antibody 3-G7 (A-TEM7-Ab-1) bound to PLXDC1-ECD with high avidity (9.6 nM). In the presence of a small molecule (Compound) that can activate PLXDC1, the avidity is increased to 1.5 nM. B. PLXDC1 receptor-activating antibody 3-G7 (A-TEM7-Ab-1) binds to PLXDC1-ECD with high avidity (1.9 nM). In the presence of a small molecule (Compound) that can activate PLXDC1, the avidity is increased to 0.9 nM.

    [0059] FIG. 18A-B show activation of PLXDC1 and PLXDC2 by small molecules. Through RNAseq analysis of PLXDC1-expressing endothelial cells killing by PLXDC1-activating compounds, a transcriptional factor called Gfi1b was found to be induced during PLXDC1-mediated cell killing. By linking its promotor to a luciferase reporter gene, this example developed a PLXDC1 receptor activation assay that demonstrates the activation of the receptor by its ligands. A. PLXDC1-activating compounds (A-Com-1 and A-Com-2) highly activated the promotor activity in PLXDC1-expressing cells. B. A-Com-1 and A-Com-2 also activated the promotor activity in PLXDC2-expressing cells. However, both compounds preferentially activate PLXDC1 over PLXDC2. A-Com-2 more strongly differentiates between the two receptors. All compound treatments were done for 1 day. Basal promotor activity of the PLXDC1-expressing cells is defined as 1. Fluorouracil (FU), a chemotherapy drug that kills dividing cells by apoptosis, do not activate this promotor.

    [0060] FIG. 19 shows activation of PLXDC1 by antibodies. PLXDC1-activating antibodies (A-TEM7-Ab-1 and A-TEM7-Ab-2) activate the promotor activity in PLXDC1 cells, but not in cells without PLXDC1. Basal promotor activity of the PLXDC1-expressing cells is defined as 1. The basal activity of PLXDC1-expressing cells (Control) are higher than cells without PLXDC1, consistent promotor activation by the ectopic expression of the receptor without ligands.

    [0061] FIG. 20A-B show killing of PLXDC1-expressing endothelial cells by PLXDC1-activating small molecules and antibodies. A. Visualization of the killing human PLXDC1-expressing endothelial cells by PLXDC1-activating small molecule (compound). The top three pictures on represent control cells and the lower three pictures represent compound-treated cells, showing light microscopy picture (left), live cell (middle) and dead cell staining (right). Live cells are stained using Fluorescein diacetate (green signal) and dead cells are stained using propidium iodide (red signal). B. Quantitation of the killing of human PLXDC1-expressing endothelial cells by PLXDC1-activating small molecules (A-Compound-1 and A-Compound-2) and antibodies (A-TEM7-Ab-1 and A-TEM7-Ab-2). Incubation time of the compounds and antibodies is 24 hours. Cell survival of the control cells is defined as 100%.

    [0062] FIG. 21A-C show killing of human tumor endothelial cells expressing human PLXDC1 by receptor-activating antibodies against PLXDC1. The pictures represent one day after IgG addition and the right pictures represent 8 days after IgG addition. A. Incubation of human lung tumor endothelial cells with control IgG (500 nM) does not lead to the death of tumor endothelial cells expressing PLXDC1 (green signal). B. Incubation of human lung tumor endothelial cells with PLXDC1-activating IgG A-TEM7-Ab-1 (500 nM) leads to the death of tumor endothelial cells expressing PLXDC1 (green signal), as evident by comparing the tumor endothelial cell signal between day 1 and day 8. C. Incubation of human lung tumor endothelial cells with an independent PLXDC1-activating IgG A-TEM7-Ab-2 (500 nM) also leads to the death of tumor endothelial cells expressing PLXDC1 (green signal), as evident by comparing the tumor endothelial cell signal between day 1 and day 8.

    [0063] FIG. 22A-D show that PLXDC1-activating compound specifically suppresses pathogenic blood vessels in vivo without affecting healthy blood vessels in ischemia-induced retinopathy. A. Upper graph: Schematic diagram of the experimental design for ischemia-induced retinopathy. The high oxygen environment caused blood vessel loss (vaso-obliteration). In room air, loss of vessels triggered abnormal angiogenesis that generated pathogenic blood vessels on the top of the retina (marked in yellow in D). Treatment was applied during the return to room air by subcutaneous injection. Lower graph: quantitation of healthy blood vessels, vaso-obliteration and pathogenic blood vessels between the control (n=10) and treated retinas (n=10). Treatment by PLXDC1-activating compound (A-Compound-1) highly suppressed pathogenic blood vessels (two asterisks) while improving the amount of healthy blood vessels (one asterisk). B. Representative images of flat-mounted control retinas (upper two images) and retinas from compound treated mice (lower two images). Red signal is blood vessel marker. C. The same retinas in B with vaso-obliteration areas marked in white color. These images illustrate that compound-treated retinas went through vaso-obliteration like the control retinas. D. The same retinas in B with pathogenic blood vessels marked in yellow color. These images illustrate that compound-treated retinas have highly decreased pathogenic blood vessels as compared to the control retinas.

    [0064] FIG. 23A-C show that PLXDC1-activating compound causes tumor shrinkage in vivo. Treatment was done at day 0 by bolus IV injection. A. Raw data of tumor growth curves of the mice in the control group. B. Raw data of tumor growth curves of the mice in the treatment group. C. Comparison of the combined growth data of the control group and the treatment group.

    [0065] FIG. 24 shows tumor morphological changes on live animals due to the treatment by PLXDC1-activating compound. Pictures of the whole animals in the experiment described in FIG. 11 show tumor morphological and color changes on day 1 and day 3. Treatment was done at day 0. Tumors in the treatment groups becomes darker in color on day 1 due to the destruction of tumor blood vessels and accumulation of blood in the tumors. Tumors in the treatment groups start to become yellower in color on day 3, consistent with the onset of tumor necrosis due to the lack of tumor blood vessels.

    [0066] FIG. 25A-B show tumor morphological changes on live animals due to the treatment by PLXDC1-activating compound. Pictures of the whole animals in the experiment described in FIG. 11 show tumor morphological and color changes on day 7. Treatment was done at day 0. While the tumors in the control group have grown to large sizes, tumors in the treatment groups have highly shrunk in size and become yellow in color.

    [0067] FIG. 26A-B show morphological changes of dissected tumors due to the treatment by PLXDC1-activating compound. Pictures of the dissected tumors in the experiment described in FIG. 11 show tumor morphological and color changes on day 7. While the tumors in the control group are reddish in color, tumors in the treatment groups have highly shrunk in size and become yellow in color, consistent with the lack of tumor blood vessels and tumor necrosis.

    [0068] FIG. 27A-B show that PLXDC1-activating antibodies bound to PLXDC1 independently of domain B. This property is in contrast to PEDF, which depends on domain B to bind to PLXDC1. A. Binding of PLXDC1-activating antibody (A-TEM7-Ab-1) to cells transfected with full length PLXDC1 (left picture), domain B-deleted PLXDC1 (middle picture) or untransfected control cells (right picture). The green (gray as shown) signal is the antibody binding signal. B. Binding of PLXDC1-activating antibody (A-TEM7-Ab-2) to cells transfected with full length PLXDC1 (left picture), domain B-deleted PLXDC1 (middle picture) or untransfected control cells (right picture). The green signal is the antibody binding signal.

    DETAILED DESCRIPTION

    [0069] PLXDC1 and PLXDC2 are highly specifically expressed in the tumor blood vessels of diverse types of cancer (Beaty et al., 2007; Lu et al., 2007; Schwarze et al., 2005; St Croix et al., 2000; van Beijnum et al., 2009), and in the pathogenic blood vessels in diabetic retinopathy (Yamaji et al., 2008). This high enrichment is not present in healthy blood vessels (Beaty et al., 2007; Lu et al., 2007; Schwarze et al., 2005; St Croix et al., 2000; van Beijnum et al., 2009). High PLXDC1 expression has also been identified in choroidal neovascularization (pathogenic angiogenesis in age-related macular degeneration (AMD) and ischemia-induced retinopathy (pathogenic angiogenesis in retinopathy of prematurity).

    [0070] Not all agents that bind to the extracellular domains of PLXDC1 or PLXDC2 can activate these receptors to kill endothelial cells. PLXDC1-binding protein, nidogen, for instance, does not have the therapeutic effect of killing pathogenic blood vessels. Anti-PLXDC1 antibodies have been developed as a potential anti-angiogenic therapy. In Bagley et al., Microvasc Res. 2011 November; 82 (3): 253-62, an anti-PLXDC1 antibody was identified that mediated antibody-dependent cellular cytotoxicity (ADCC) and phagocytosis. However, the antibodies in this approach depended on ADCC, and were not designed to activate PLXDC1 to kill endothelial cells without the immune system. Pigment Epithelium Derived Factor (PEDF) is a natural ligand for PLXDC1 and PLXDC2. However, binding of PEDF to PLXDC1 or PLXDC2 also does not provide the therapeutic effect as demonstrated in the ex vivo/in vitro models (Example 1).

    [0071] The inventors have developed a novel array PLXDC1/PLXDC2 binding agents that induce the cell death in the endothelial cells that express PLXDC1/PLXDC2. This novel therapeutic modality is distinct from current anti-angiogenic strategies and current immunotherapy strategies that promote ADCC. As shown in the figures and examples of the application, these novel agents provided an effect that was different from other PLXDC1 or PLXDC2-targeting strategies, and also different from anti-angiogenic drugs such as anti-VEGF drugs or PEDF.

    [0072] Examples 1-3 provide exemplary methods that were used for the screening and identification of cancer therapeutic agents, such as small molecule drugs and antibodies (Examples 1-7), that can effectively cause necrosis of and kill existing tumor blood vessels. In particular, suitable antibodies are identified based on the ability to preferentially bind to PLXDC1 or PLXDC2 that is activated by a small molecule activator. Because the small molecule activator promotes the activated conformation of PLXDC1 or PLXDC2, antibodies that preferentially bind to these proteins in the presence of the activator are expected to promote the activated conformation and are able to activate the PLXDC1 or PLXDC2 protein.

    [0073] It is contemplated that PLXDC1 or PLXDC2 forms a dimer at the basal state. The small molecules and antibodies of the present disclosure, it is further contemplated, preferentially binds to amino acid residues of the protein that can interrupt or destabilize the receptor at the basal state. Such amino acid residues are not exposed on the surface of the protein when it is in the dimer/basal state. Preferably, such residues are on the dimer interface. They can also be residues that are only exposed when the dimer dissociates. In some embodiments, binding to the residue changes the conformation of the protein at the basal state.

    [0074] The preferential binding to unexposed amino acid residues by the activating antibodies is evidenced by the antibody-screening method. The antibodies were screened for their ability to bind to the PLXDC protein in the presence of a small molecular activator, which promotes the activated conformation.

    [0075] This also explains why not every ligand that binds to PLXDC1/PLXDC2 can activate it or kill endothelial cells expressing PLXDC1/PLXDC2 (e.g., tumor endothelial cells). As provided, nidogen, an extracellular matrix protein, binds to PLXDC1 but cannot activate PLXDC1 or kill endothelial cells expressing PLXDC1. Also, antibodies obtained via the conventional methods would not be able to activate PLXDC1/PLXDC2 as they can only bind to the exposed amino acid residues.

    [0076] Identification of such antibodies and compounds was a surprise. To the best knowledge of the instant inventors, all existing antibody drugs are neutralizing antibodies or targeting antibodies. Neutralizing antibodies inhibit the ligand/receptor interaction, such as Humira (inhibiting TNF-, a ligand), Avastin (inhibiting VEGF, a ligand), Herceptin (inhibiting HER2, a receptor), and Keytruda (inhibiting PD-1, a receptor). Targeting antibodies may exert their functions through mechanisms such as antibody-drug conjugates and antibody-dependent cell-mediated cytotoxicity (ADCC). No activating antibodies have been identified, in particular against single transmembrane cell-surface receptors like PLXDC1/PLXDC2.

    [0077] These new therapeutic agents can trigger tumor blood vessel death through relevant downstream biological pathways. This demonstrates the effectiveness of the tissue models and the screening technologies developed herein. Such an effect of killing tumors by killing existing tumor blood vessels has not been reported. It is contemplated that these agents activate tumor blood vessel necrosis through activating PLXDC1 or PLXDC2. Therefore, the present disclosure provides new technology for effective tumor treatments. As PLXDC1 and PLXDC2 are present in many tumor types and angiogenesis is universally important for tumor development, this new technology presents a new direction for tumor treatment across tumor types.

    I. Definitions

    [0078] As used herein, the terms treat or treatment refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the progression of cancer or of a pathogenic blood vessel disorder. Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.

    [0079] The term agent or therapeutic agent is used herein to denote a chemical compound, a small molecule, a mixture of chemical compounds and/or a biological macromolecule (such as a nucleic acid, an antibody, an antibody fragment, a protein or a peptide). The activity of such agents may render them suitable as a therapeutic agent which is a biologically, physiologically, or pharmacologically active substance (or substances) that acts locally or systemically in a subject.

    [0080] As used herein, the term activator refers to any agent that induces signal transduction changes in a cell through PLXDC1/PLXDC2.

    [0081] The term small molecule is a term of the art and includes molecules that are less than about 2000 molecular weight or even less than about 1000 molecular weight. In certain embodiments, small molecules do not comprise a plurality of peptide bonds. In certain preferred embodiments, small molecules are not oligomeric. Exemplary small molecule compounds which can be screened for activity include, but are not limited to, peptides, peptidomimetics, nucleic acids, carbohydrates, small organic molecules (e.g., polyketides) (Cane et al. (1998) Science 282:63), and natural product extract libraries. In certain embodiments, the compounds are small, organic non-peptidic compounds.

    [0082] By subject or individual or animal or patient or mammal, is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired. Mammalian subjects include humans, domestic animals, farm animals, and zoo, sport, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, and so on.

    [0083] Pathogenic blood vessels are blood vessels that are not involved in the vascularization of normal organs but in the pathogenic tissues, such as the new blood vessels that drive vision diseases or the blood vessels in tumors that tumor depend on to survive. Pathogenic blood vessel, in some embodiments, refers to an existing blood vessel that may have vascularized a diseased tissue, for instance, a tumor. In other embodiments, a pathogenic blood vessel may be a blood vessel that is a newly formed blood vessel involved in disease onset and/or progression of, for example, cancer, diabetic retinopathy, age-related macular degeneration (AMD), retinopathy of prematurity and/or any other diseases having etiologies associated with angiogenesis.

    [0084] Throughout this application, the term about is used according to its plain and ordinary meaning in the area of cell and molecular biology to indicate that a value includes the standard deviation of error for the device or method being employed to determine the value.

    [0085] The use of the word a or an when used in conjunction with the term comprising may mean one, but it is also consistent with the meaning of one or more, at least one, and one or more than one.

    [0086] As used herein, the terms or and and/or are utilized to describe multiple components in combination or exclusive of one another. For example, x, y, and/or z can refer to x alone, y alone, z alone, x, y, and z. (x and y) or z, x or (y and z), or x or y or z. It is specifically contemplated that x, y, or z may be specifically excluded from an embodiment.

    [0087] The words comprising (and any form of comprising, such as comprise and comprises), having (and any form of having, such as have and has), including (and any form of including, such as includes and include), characterized by (and any form of including, such as characterized as), or containing (and any form of containing, such as contains and contain) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps.

    [0088] The compositions and methods for their use can comprise, consist essentially of, or consist of any of the ingredients or steps disclosed throughout the specification. The phrase consisting of excludes any element, step, or ingredient not specified. The phrase consisting essentially of limits the scope of described subject matter to the specified materials or steps and those that do not materially affect its basic and novel characteristics. It is contemplated that embodiments described in the context of the term comprising may also be implemented in the context of the term consisting of or consisting essentially of.

    II. Binding to PLXDC1/PLXDC2

    [0089] The term plexin domain-containing protein or PLXDC refers to a small transmembrane receptor family that includes PLXDC1 and PLXDC2. PLXDC proteins have a large extracellular portion, a transmembrane domain, and share high sequence homology. Without limitation, the PLXDC protein can be PLXDC1 or PLXDC2.

    [0090] PLXDC1 has a protein sequence as shown in NCBI Reference Sequence: NP_065138.2: MRGELWLLVLVLREAARALSPQPGAGHDEGPGSGWAAKGTVRGWNRRARESPGHVSEPDRTQ LSQDLGGGTLAMDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHTILS NTHRQASRVVLSFDFPFYGHPLRQITIATGGFIFMGDVIHRMLTATQYVAPLMANFNPGYSDNST VVYFDNGTVFVVQWDHVYLQGWEDKGSFTFQAALHHDGRIVFAYKEIPMSVPEISSSQHPVKT GLSDAFMILNPSPDVPESRRRSIFEYHRIELDPSKVTSMSAVEFTPLPTCLQHRSCDACMSSDLTEN CSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTS SSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGTPVHLGTIVGIVLAVLLVAAIILAGIYINGHP TSNAALFFIERRPHHWPAMKFRSHPDHSTYAEVEPSGHEKEGFMEAEQC (SEQ ID NO:1).

    [0091] PLXDC2 has a sequence of NCBI Reference Sequence: NP_116201.7: MARFPKADLAAAGVMLLCHFFTDQFQFADGKPGDQILDWQYGVTQAFPHTEEEVEVDSHAYSH RWKRNLDFLKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPSDSAS RDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLREITVATGGFIYTGEVVHRM LTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRII FGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEM TPLPTCLQFNRCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVE TSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTSLPTEDDTKIALHLKDNGASTDDSAAEKKGGTL HAGLIIGILILVLIVATAILVTVYMYHHPTSAASIFFIERRPSRWPAMKFRRGSGHPAYAEVEPVGE KEGFIVSEQC (SEQ ID NO:2, isoform 1) or NP_001269665: MARFPKADLAAAGVMLLCHFFTDQFQFADGKPGDQILDWQYGVTQAFPHTEEEVEVDSHAYSH RWKRNLDELKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIERVNLSFDFPFYGHFLREITV ATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNL GSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRTIYEYHRV ELQMSKITNISAVEMTPLPTCLQFNRCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCP EESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTSLPTEDDTKIALHLKDNGA STDDSAAEKKGGTLHAGLIIGILILVLIVATAILVTVYMYHHPTSAASIFFIERRPSRWPAMKFRRG SGHPAYAEVEPVGEKEGFIVSEQC (SEQ ID NO:3, isoform 2). Their domain structures are shown in Tables 1 and 2 below.

    TABLE-US-00001 TABLE1 AlignmentandroughdomainstructuresofthePLXDCproteins PLXDC1 ---------MRGELWLLVLVLREAARALSPQPGAGHDEGPGSGWA--------------- 36 PLXDC2_1 MARFPKADLAAAGVMLLCHFFTDQFQFADGKPGD-----QILDWQYGVTQAFPHTEEEVE 55 PLXDC2_2 MARFPKADLAAAGVMLLCHFFTDQFQFADGKPGD-----QILDWQYGVTQAFPHTEEEVE 55 _________________________________ DomainA PLXDC1 --AKGTVRGWNRRARESPGHVSEPDRTQLSQDLG----GGTLAMDTLPDNRTR-VVEDNH 89 PLXDC2_1 VDSHAYSHRWKRNLDFLK--AVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIEEDTDH 113 PLXDC2_2 VDSHAYSHRWKRNLDFLK--AVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIE----- 108 ____________________________________________________________ DomainA PLXDC1 SYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHTILSNTHRQASRVVLSFDFPFYGHPLR 149 PLXDC2_1 NYYISRIYGPSDSASRDLWVNIDQMEKDKVKIRGILSNTHRQAARVNLSFDFPFYGHFLR 173 PLXDC2_2 --------------------------------------------RVNLSFDFPFYGHFLR 124 ______________________________________====================== DomainADomainB PLXDC1 QITIATGGFIFMGDVIHRMLTATQYVAPLMANFNPGYSDNSTVVYFDNGTVFVVQWDHVY 209 PLXDC2_1 EITVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVH 233 PLXDC2_2 EITVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVH 184 ============================================================ DomainB PLXDC1 LQGWEDKGSFTFQAALHHDGRIVFAYKEIPMSVPEISSSQHPVKTGLSDAFMILNPSPDV 269 PLXDC2_1 LQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQI 293 PLXDC2_2 LQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQI 244 ================================={circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()}{circumflex over ()} DomainBDomainC PLXDC1 PESRRRSIFEYHRIELDPSKVTSMSAVEFTPLPTCLQHRSCDACMSSDLTFNCSWCHVLQ 329 PLXDC2_1 PNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNRCGPCVSSQIGFNCSWCSKLQ 353 PLXDC2_2 PNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNRCGPCVSSQIGFNCSWCSKLQ 304 ^^^^^^^^^^^^^^^^^^^^^^^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ DomainCDomainD PLXDC1 RCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDT------SFSPYDGDLTTT 383 PLXDC2_1 RCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLT-TTRRA 412 PLXDC2_2 RCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLT-TTRRA 363 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~****************************** DomainDDomainE PLXDC1 SSSLFIDSLTTEDDTKLNPYAGGDGLQ-NNLSPKTKGTPVHLGTIVGIVLAVLLVAAIIL 442 PLXDC2_1 VTSQFPTSLPTEDDTKIALHLKDNGASTDDSAAEKKGGTLHAGLIIGILILVLIVATAIL 472 PLXDC2_2 VTSQFPTSLPTEDDTKIALHLKDNGASTDDSAAEKKGGTLHAGLIIGILILVLIVATAIL 423 ********************************************================ DomainETransmembrane PLXDC1 AGIYINGHPTSNAALFFIERRPHHWPAMKFRSHPDHSTYAEVEPSGHEKEGFMEAEQC 500 PLXDC2_1 VTVYMYHHPTSAASIFFIERRPSRWPAMKFRRGSGHPAYAEVEPVG-EKEGFIVSEQC 529 PLXDC2_2 VTVYMYHHPTSAASIFFIERRPSRWPAMKFRRGSGHPAYAEVEPVG-EKEGFIVSEQC 480 =====_____________________________________________________ Intracellular

    TABLE-US-00002 TABLE 2 Listing of domains and locations Protein (SEQ ID NO:) Domain Amino acid residues PLXDC1 Domain A 19-127 (SEQ ID NO: 1) Domain B 128-242 Domain C 243-292 Domain D 293-359 Domain E 360-427 PLXDC2 isoform 1 Domain A 31-151 (SEQ ID NO: 2) Domain B 152-266 Domain C 267-316 Domain D 317-383 Domain E 384-454 PLXDC2 isoform 2 Domain A 31-108 (SEQ ID NO: 3) Domain B 109-207 Domain C 208-267 Domain D 268-334 Domain E 335-405

    A. Modulators of PLXDC1 and PLXDC2

    [0092] In some aspects, provided herein are methods of treating cancer, as well as other diseases and disorder characterized with pathogenic blood vessels expressing PLXDC1 or PLXDC2, by activating PLXDC1 and/or PLXDC2 proteins in a subject (e.g., in a tumor blood vessel in a subject with cancer). In some embodiments, activating PLXDC1 and/or PLXDC2 receptors in a subject comprises administering an agent and/or activator described herein directly to the subject (e.g., by administering the activator and/or agent to the subject locally or systemically). In certain embodiments, the methods provided herein relate to activating PLXDC1 and/or PLXDC2 on the pathogenic blood vessel cells by contacting the cells with an agent disclosed herein.

    [0093] In some aspects, provided herein are methods of treating cancer or inducing necrosis (e.g., coagulative necrosis) in a subject, comprising administering to the subject an agent that increases the activity of PLXDC1 and/or PLXDC2 on tumor blood vessel cells. In some embodiments, the activator and/or agent is a small molecule disclosed herein (e.g., a molecule of Formula I). Activators of PLXDC1 and/or PLXDC2 may be a PLXDC1 and/or PLXDC2 ligand, such as a peptide described herein. Other activators include small molecules and/or an antibody (e.g., an antibody disclosed herein). In some embodiments, the agent is administered locally or systemically. In some embodiments, the agent and/or activator may be administered locally to the subject's tumor or tissue comprising cancerous cells.

    [0094] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain A of PLXDC1 (amino acids 19-127 of SEQ ID NO:1). In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain B of PLXDC1 (amino acids 128-242 of SEQ ID NO:1). In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain C of PLXDC1 (amino acids 243-292 of SEQ ID NO:1). In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain D of PLXDC1 (amino acids 293-359 of SEQ ID NO:1). In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain E of PLXDC1 (amino acids 360-427 of SEQ ID NO:1).

    [0095] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain E of PLXDC1 and also binds to Domain D of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain E of PLXDC1 and also binds to Domain C of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain E of PLXDC1 and also binds to Domain B of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain E of PLXDC1 and also binds to Domain A of PLXDC1.

    [0096] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain D of PLXDC1 and also binds to Domain E of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain D of PLXDC1 and also binds to Domain C of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain D of PLXDC1 and also binds to Domain B of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain D of PLXDC1 and also binds to Domain A of PLXDC1.

    [0097] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain C of PLXDC1 and also binds to Domain E of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain C of PLXDC1 and also binds to Domain D of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain C of PLXDC1 and also binds to Domain B of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain C of PLXDC1 and also binds to Domain A of PLXDC1.

    [0098] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain B of PLXDC1 and also binds to Domain E of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain B of PLXDC1 and also binds to Domain D of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain B of PLXDC1 and also binds to Domain C of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain B of PLXDC1 and also binds to Domain A of PLXDC1.

    [0099] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain A of PLXDC1 and also binds to Domain E of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain A of PLXDC1 and also binds to Domain D of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain A of PLXDC1 and also binds to Domain C of PLXDC1. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain A of PLXDC1 and also binds to Domain B of PLXDC1.

    [0100] In some embodiments, the therapeutic agent of the present disclosure does not bind to Domain B of PLXDC1.

    [0101] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain A of PLXDC2 (amino acids 31-151 of SEQ ID NO:2 or amino acids 31-108 of SEQ ID NO:3). In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain B of PLXDC2 (amino acids 152-266 of SEQ ID NO:2 or amino acids 109-207 of SEQ ID NO:3). In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain C of PLXDC2 (amino acids 267-316 of SEQ ID NO:2 or amino acids 208-267 of SEQ ID NO:3). In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain D of PLXDC2 (amino acids 317-383 of SEQ ID NO:2 or amino acids 268-334 of SEQ ID NO:3). In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain E of PLXDC2 (amino acids 384-454 of SEQ ID NO:2 or amino acids 335-405 of SEQ ID NO:3).

    [0102] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain E of PLXDC2 and also binds to Domain D of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain E of PLXDC2 and also binds to Domain C of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain E of PLXDC2 and also binds to Domain B of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain E of PLXDC2 and also binds to Domain A of PLXDC2.

    [0103] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain D of PLXDC2 and also binds to Domain E of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain D of PLXDC2 and also binds to Domain C of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain D of PLXDC2 and also binds to Domain B of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain D of PLXDC2 and also binds to Domain A of PLXDC2.

    [0104] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain C of PLXDC2 and also binds to Domain E of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain C of PLXDC2 and also binds to Domain D of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain C of PLXDC2 and also binds to Domain B of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain C of PLXDC2 and also binds to Domain A of PLXDC2.

    [0105] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain B of PLXDC2 and also binds to Domain E of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain B of PLXDC2 and also binds to Domain D of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain B of PLXDC2 and also binds to Domain C of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain B of PLXDC1 and also binds to Domain A of PLXDC2.

    [0106] In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain A of PLXDC2 and also binds to Domain E of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain A of PLXDC2 and also binds to Domain D of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain A of PLXDC2 and also binds to Domain C of PLXDC2. In some embodiments, a therapeutic agent of the present disclosure is able to bind to at least Domain A of PLXDC2 and also binds to Domain B of PLXDC2.

    [0107] In some embodiments, the therapeutic agent of the present disclosure does not bind to Domain B of PLXDC2.

    [0108] In some embodiments, the therapeutic agent of the present disclosure binds to PLXDC1 or PLXDC2 more strongly in the presence of a PLXDC1 or PLXDC2 activator, such as those disclosed herein, as compared to in the absence of such an activator. In some embodiments, the difference is at least 10%, 20%, 50%, 100%, 2.5 fold, 3 fold, 4 fold, 5 fold or 10 fold.

    [0109] In some embodiments, the binding of a therapeutic agent of the present disclosure to PLXDC1 or PLXDC2 is at least 5 times, or at least 10, 15, 20, 50, 100, 1000, 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, or 10.sup.8 times (or any derivable range therein) stronger than PEDF.

    [0110] In some embodiments, the binding of a therapeutic agent of the disclosure, such as the compound and antibody modulators of PLXDC1 and/or PLXDC2 receptors described herein activate intracellular signaling pathways upon binding to PLXDC1 and/or PLXDC2. In some embodiments, a therapeutic agent of the disclosure inhibits dimerization of a PLXDC1 and/or PLXDC2 protein, such as homo or heterodimerization. The therapeutic agents of the disclosure may directly inhibit dimerization by directly binding to one or more portion(s) of the protein involved in dimerization or by binding and changing the conformation of the protein so that dimerization is reduced or eliminated.

    [0111] In some embodiments, the agent binds to, binds at least, or binds at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 (or any derivable range therein) amino acid residues selected from the amino acid residue at position(s) 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, or 529 (or any derivable range therein) of a PLXDC1 or PLXDC2 polypeptide, such as those exemplified by any of SEQ ID NOS: 1-3. It is also specifically contemplated that such agent may be excluded in any embodiment disclosed herein. In some embodiments, the binding of the agent to PLXDC1 or PLXDC2 or to a certain domain, epitope, or amino acid residue(s) may be with a K.sub.D of at least, at most, or about 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13, 10.sup.14, or 10.sup.15 M (or any derivable range therein). In some embodiments, the agent binds to the monomeric form of PLXDC1 and/or PLXDC2 with greater affinity than the dimeric form of the receptor. For example, the K.sub.D for the monomeric form may be less than about 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13, 10.sup.14, or 10.sup.15 M (or any derivable range therein), and the K.sub.D for the dimeric form may be greater than about 10.sup.1, 10.sup.2, 10.sup.3, 10.sup.4, 10.sup.5, or 10.sup.6 M (or any derivable range therein).

    [0112] In some embodiments, the antibody is one that activates PLXDC1 and/or PLXDC2 in an assay as demonstrated in Example 5. In some embodiments, the antibody is one that demonstrates an efficacy of at least 60, 65, 70, 75, 80, 85, 90, 95, or 100% cell death (or any derivable range therein) in an assay as demonstrated in Example 6 or 7.

    [0113] In some embodiments, the binding of a therapeutic agent of the present disclosure to a plexin domain-containing protein is able to cause activation of one or more genes in the tumor endothelial cell leading to tumor blood vessel death and tumor necrosis Non-limiting examples of such genes include ADAM17 (ADAM metallopeptidase domain 17), BAG4 (BCL2 associated athanogene 4), BIRC2 (baculoviral IAP repeat containing 2), BIRC3 (baculoviral IAP repeat containing 3), CASP8 (caspase 8), CAV1 (caveolin 1), CHUK (component of inhibitor of nuclear factor kappa B kinase complex), CYLD (CYLD lysine 63 deubiquitinase), FADD (Fas associated via death domain), IKBKB (inhibitor of nuclear factor kappa B kinase subunit beta), IKBKG (inhibitor of nuclear factor kappa B kinase regulatory subunit gamma), ITCH (itchy E3 ubiquitin protein ligase), MADD (MAP kinase activating death domain), MAP2K3 (mitogen-activated protein kinase kinase 3), MAP2K7 (mitogen-activated protein kinase kinase 7), MAP3K1 (mitogen-activated protein kinase kinase kinase 1), MAP3K3 (mitogen-activated protein kinase kinase kinase 3), MAP3K5 (mitogen-activated protein kinase kinase kinase 5), MAP3K7 (mitogen-activated protein kinase kinase kinase 7), MAP4K2 (mitogen-activated protein kinase kinase kinase kinase 2), MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3), MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4), MAP4K5 (mitogen-activated protein kinase kinase kinase kinase 5), NFB1 (nuclear factor kappa B subunit 1), NRK (Nik related kinase), NSMAF (neutral sphingomyelinase activation associated factor), PRKCI (protein kinase C iota), PRKCZ (protein kinase C zeta), RACK1 (receptor for activated C kinase 1), RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1), RELA (RELA proto-oncogene, NF-B subunit), RFFL (ring finger and FYVE like domain containing E3 ubiquitin protein ligase), RIPK1 (receptor interacting serine/threonine kinase 1), RNF11 (ring finger protein 11), RNF31 (ring finger protein 31), SHARPIN (SHANK associated RH domain interactor), SMPD1 (sphingomyelin phosphodiesterase 1), SMPD2 (sphingomyelin phosphodiesterase 2), SQSTM1 (sequestosome 1), STAT1 (signal transducer and activator of transcription 1), TAB1 (TGF-beta activated kinase 1 (MAP3K7) binding protein 1), TAB2 (TGF-beta activated kinase 1 (MAP3K7) binding protein 2), TAB3 (TGF-beta activated kinase 1 (MAP3K7) binding protein 3), TAX1BP1 (Tax1 binding protein 1), TNF (tumor necrosis factor), TNFAIP3 (TNF alpha induced protein 3), TNFRSFIA (TNF receptor superfamily member 1A), TNFRSF1B (TNF receptor superfamily member 1B), TNIK (TRAF2 and NCK interacting kinase), TRADD (TNFRSF1A associated via death domain), TRAF1 (TNF receptor associated factor 1), TRAF2 (TNF receptor associated factor 2), TRAF5 (TNF receptor associated factor 5), and TXN (thioredoxin).

    III. Compounds of Formula I

    A. Chemical Definitions

    [0114] As used in the present specification, the following words, phrases and symbols are generally intended to have the meanings as set forth below, except to the extent that the context in which they are used indicates otherwise.

    [0115] A dash (-) that is not between two letters or symbols is used to indicate a point of attachment for a substituent. For example, C(O)NH.sub.2 is attached through the carbon atom. A dash at the front or end of a chemical group is a matter of convenience; chemical groups may be depicted with or without one or more dashes without losing their ordinary meaning. A wavy line or a dashed line drawn through a line in a structure indicates a specified point of attachment of a group. Unless chemically or structurally required, no directionality or stereochemistry is indicated or implied by the order in which a chemical group is written or named.

    [0116] The term C.sub.x-y when used in conjunction with a chemical moiety, such as, acyl, acyloxy, alkyl, alkenyl, alkynyl, or alkoxy is meant to include groups that contain from x to y carbons in the chain. For example, the term C.sub.x-yalkyl refers to substituted or unsubstituted saturated hydrocarbon groups, including straight-chain alkyl and branched-chain alkyl groups that contain from x to y carbons in the chain, including haloalkyl groups such as trifluoromethyl and 2,2,2-trifluoroethyl, etc. C.sub.0 alkyl indicates a hydrogen where the group is in a terminal position, a bond if internal. The terms C.sub.2-yalkenyl and C.sub.2-yalkynyl refer to substituted or unsubstituted unsaturated aliphatic groups analogous in length and possible substitution to the alkyls described above, but that contain at least one double or triple bond respectively. The singular forms a and the include plural references unless the context clearly dictates otherwise. Thus, e.g., reference to the compound includes a plurality of such compounds and reference to the assay includes reference to one or more assays and equivalents thereof known to those skilled in the art.

    [0117] Alkyl refers to an unbranched or branched saturated hydrocarbon chain. In some embodiments, alkyl has the indicated number of carbon atoms. In some embodiments, alkyl has 1 to 40 carbon atoms (i.e., C.sub.1-40 alkyl), 1 to 30 carbon atoms (i.e., C.sub.1-30 alkyl), 10 to 30 carbon atoms (i.e., C.sub.10-30 alkyl), 1 to 20 carbon atoms (i.e., C.sub.1-20 alkyl), 1 to 12 carbon atoms (i.e., C.sub.1-12 alkyl), 1 to 8 carbon atoms (i.e., C.sub.1-8 alkyl), 1 to 6 carbon atoms (i.e., C.sub.1-6 alkyl) or 1 to 4 carbon atoms (i.e., C.sub.1-4 alkyl). Examples of alkyl groups include, e.g., methyl, ethyl, propyl, isopropyl, n-butyl, sec-butyl, iso-butyl, tert-butyl, pentyl, 2-pentyl, isopentyl, neopentyl, hexyl, 2-hexyl, 3-hexyl, 3-methylpentyl, octyl, nonyl, decyl, dodecyl, icosyl, docosyl, and tetradecyl. When an alkyl residue having a specific number of carbons is named by chemical name or identified by molecular formula, all positional isomers having that number of carbons may be encompassed; thus, for example, butyl includes n-butyl (i.e., (CH.sub.2).sub.3CH.sub.3), sec-butyl (i.e., CH(CH.sub.3)CH.sub.2CH.sub.3), isobutyl (i.e., CH.sub.2CH(CH.sub.3).sub.2) and tert-butyl (i.e., C(CH.sub.3).sub.3); and propyl includes n-propyl (i.e., (CH.sub.2).sub.2CH.sub.3) and isopropyl (i.e., CH(CH.sub.3).sub.2).

    [0118] Certain commonly used alternative chemical names may be used. For example, a divalent group such as a divalent alkyl group, a divalent aryl group, etc., may also be referred to as an alkylene group, an arylene group, respectively. Also, unless indicated explicitly otherwise, where combinations of groups are referred to herein as one moiety, e.g., arylalkyl or aralkyl, the last mentioned group contains the atom by which the moiety is attached to the rest of the molecule.

    [0119] Alkenyl refers to an alkyl group containing at least one carbon-carbon double bond. In some embodiments, alkenyl has the indicated number of carbon atoms. In some embodiments, alkenyl has from 2 to 40 carbon atoms (i.e., C.sub.2-40 alkenyl), 2 to 30 carbon atoms (i.e., C.sub.2-30 alkenyl), 10 to 30 carbon atoms (i.e., C.sub.10-30 alkenyl), 2 to 20 carbon atoms (i.e., C.sub.2-20 alkenyl), 2 to 8 carbon atoms (i.e., C.sub.2-8 alkenyl), 2 to 6 carbon atoms (i.e., C.sub.2-6 alkenyl) or 2 to 4 carbon atoms (i.e., C.sub.2-4 alkenyl). Examples of alkenyl groups include, e.g., ethenyl, propenyl, butadienyl (including 1,2-butadienyl and 1,3-butadienyl).

    [0120] Alkynyl refers to an alkyl group containing at least one carbon-carbon triple bond. In some embodiments, alkynyl has the indicated number of carbon atoms. In some embodiments, alkynyl has from 2 to 40 carbon atoms (i.e., C2.40 alkynyl), 2 to 30 carbon atoms (i.e., C.sub.1-30 alkynyl), 10 to 30 carbon atoms (i.e., C.sub.10-30 alkynyl), 2 to 20 carbon atoms (i.e., C.sub.2-20 alkynyl), 2 to 8 carbon atoms (i.e., C.sub.2-8 alkynyl), 2 to 6 carbon atoms (i.e., C.sub.2-6 alkynyl) or 2 to 4 carbon atoms (i.e., C.sub.2-4 alkynyl). The term alkynyl also includes those groups having one triple bond and one double bond.

    [0121] Alkoxy refers to the group alkyl-O. In some embodiments, alkoxy has from 1 to 40 carbon atoms (i.e., OC.sub.1-40 alkyl), 1 to 30 carbon atoms (i.e., OC.sub.1-30 alkyl), 10 to 30 carbon atoms (i.e., OC.sub.10-30 alkyl, 1 to 20 carbon atoms (i.e., OC.sub.1-20 alkyl), 1 to 12 carbon atoms (i.e., OC.sub.1-12 alkyl), 1 to 8 carbon atoms (i.e., OC.sub.1-8 alkyl), 1 to 6 carbon atoms (i.e., OC.sub.1-6 alkyl) or 1 to 4 carbon atoms (i.e., OC.sub.1-4 alkyl). Examples of alkoxy groups include, e.g., methoxy, ethoxy, n-propoxy, iso-propoxy, n-butoxy, tert-butoxy, sec-butoxy, n-pentoxy, n-hexoxy and 1,2-dimethylbutoxy.

    [0122] Alkenoxy refers to the group alkene-O. In some embodiments, alkenoxy has from 2 to 40 carbon atoms (i.e., OC.sub.2-40 alkene), 2 to 30 carbon atoms (i.e., OC.sub.2-30 alkene), 10 to 30 carbon atoms (i.e., OC.sub.10-30 alkene), 2 to 20 carbon atoms (i.e., OC.sub.2-20 alkene), 2 to 12 carbon atoms (i.e., OC.sub.2-12 alkene), 2 to 8 carbon atoms (i.e., OC.sub.2-8 alkene), 2 to 6 carbon atoms (i.e., OC.sub.2-6 alkene) or 2 to 4 carbon atoms (i.e., OC.sub.2-4 alkene).

    [0123] Alkynoxy refers to the group alkyne-O. In some embodiments, alkynoxy has from 1 to 40 carbon atoms (i.e., OC.sub.2-40 alkyne), 2 to 30 carbon atoms (i.e., OC.sub.2-30 alkene), 10 to 30 carbon atoms (i.e., OC.sub.10-30 alkyne, 2 to 20 carbon atoms (i.e., OC.sub.2-20 alkyne), 2 to 12 carbon atoms (i.e., OC.sub.2-12 alkyne), 2 to 8 carbon atoms (i.e., OC.sub.2-8 alkyne), 2 to 6 carbon atoms (i.e., OC.sub.2-6 alkyne) or 2 to 4 carbon atoms (i.e., OC.sub.2-4 alkyne).

    [0124] Amino refers to the group NR.sup.yR.sup.z wherein R.sup.y and R.sup.z are independently hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclyl, aryl, heteroalkyl or heteroaryl; each of which may be optionally substituted, as defined herein.

    [0125] Aryl refers to an aromatic carbocyclic group having a single ring (e.g., monocyclic) or multiple rings (e.g., bicyclic or tricyclic) including fused systems. In some embodiments, aryl has 6 to 20 ring carbon atoms (i.e., C.sub.6-20 aryl), 6 to 12 ring carbon atoms (i.e., C.sub.6-12 aryl), or 6 to 10 ring carbon atoms (i.e., C.sub.6-10 aryl). Examples of aryl groups include, e.g., phenyl, naphthyl, fluorenyl and anthryl. Aryl, however, does not encompass or overlap in any way with heteroaryl defined below. If one or more aryl groups are fused with a heteroaryl, the resulting ring system is heteroaryl. If one or more aryl groups are fused with a heterocyclyl, the resulting ring system is heterocyclyl.

    [0126] Arylalkyl or Aralkyl refers to the group aryl-alkyl-.

    [0127] Carboxyl ester or ester refer to both OC(O)R.sup.x and C(O)OR.sup.x, wherein R.sup.x is alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclyl, aryl, heteroalkyl or heteroaryl; each of which may be optionally substituted, as defined herein.

    [0128] Carboxy as used herein refers to CO.sub.2H, or a salt thereof. Exemplary counter ions which can be used include, but are not limited to, Na.sup.+, K.sup.+, Li.sup.+, NH.sub.4.sup.+ and others described herein.

    [0129] Cycloalkyl refers to a saturated or partially unsaturated cyclic alkyl group having a single ring or multiple rings including fused, bridged and spiro ring systems. The term cycloalkyl includes cycloalkenyl groups (i.e., the cyclic group having at least one double bond) and carbocyclic fused ring systems having at least one sp.sup.3 carbon atom (i.e., at least one non-aromatic ring). In some embodiments, cycloalkyl has from 3 to 20 ring carbon atoms (i.e., C.sub.3-20 cycloalkyl), 3 to 12 ring carbon atoms (i.e., C.sub.3-12 cycloalkyl), 3 to 10 ring carbon atoms (i.e., C.sub.3-10 cycloalkyl), 3 to 8 ring carbon atoms (i.e., C.sub.3-8 cycloalkyl), or 3 to 6 ring carbon atoms (i.e., C.sub.3-6 cycloalkyl). Monocyclic groups include, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl and cyclooctyl. Polycyclic cycloalkyl refers to a cycloalkyl having at least two rings, which may be a fused, bridged or spiro ring system. Polycyclic groups include, for example, bicyclo[2.2.1]heptanyl, bicyclo[2.2.2]octanyl, adamantyl, norbornyl, decalinyl, 7,7-dimethyl-bicyclo[2.2.1]heptanyl and the like. Spirocycloalkyl refers to a polycyclic cycloalkyl group wherein at least two rings are linked together by one common atom, for example spiro[2.5]octanyl, spiro[4.5]decanyl, or spiro[5.5]undecanyl. Spirocycloalkyl may contain fused rings in the ring system, but not bridged rings. Fused cycloalkyl refers to a polycyclic cycloalkyl group wherein at least two rings are linked together by two common atoms wherein the two common atoms are connected through a covalent bond. Fused cycloalkyl does not contain any spiro or bridged rings in the ring system. Bridged cycloalkyl refers to a polycyclic cycloalkyl that contains a bridgean alkylene (such as C.sub.14 alkylene) group that connect two bridgehead atoms. Non-limiting examples of bridged cycloalkyl include bicyclo[2.2.1]heptanyl, bicyclo[2.2.2]octanyl, adamantyl, norbornyl, and 7,7-dimethyl-bicyclo[2.2.1]heptanyl. Bridged cycloalkyl may contain fused and/or spiro rings in the ring system. Further, the term cycloalkyl is intended to encompass any non-aromatic ring which may be fused to an aryl ring, regardless of the attachment to the remainder of the molecule.

    [0130] Halogen or halo refers to atoms occupying group VIIA of the periodic table, such as fluoro, chloro, bromo or iodo.

    [0131] Haloalkyl refers to an unbranched or branched alkyl group as defined above, wherein one or more (e.g., 1 to 6, 1 to 5 or 1 to 3) hydrogen atoms are replaced by a halogen. For example, where a residue is substituted with more than one halogen, it may be referred to by using a prefix corresponding to the number of halogen moieties attached. Dihaloalkyl and trihaloalkyl refer to alkyl substituted with two (di) or three (tri) halo groups, which may be, but are not necessarily, the same halogen. Examples of haloalkyl include, e.g., trifluoromethyl, difluoromethyl, fluoromethyl, trichloromethyl, 2,2,2-trifluoroethyl, 1,2-difluoroethyl, 3-bromo-2-fluoropropyl, 1,2-dibromoethyl and the like.

    [0132] Haloalkoxy refers to an alkoxy group as defined above, wherein one or more (e.g., 1 to 6, 1 to 5 or 1 to 3) hydrogen atoms are replaced by a halogen.

    [0133] Hydroxyalkyl refers to an alkyl group as defined above, wherein one or more (e.g., 1 to 6, 1 to 5 or 1 to 3) hydrogen atoms are replaced by a hydroxy group. A non-limiting example of hydroxyalkyl is (CH.sub.2).sub.1-4OH.

    [0134] Heteroalkyl refers to an alkyl group in which one or more, but not all of the carbon atoms (and any associated hydrogen atoms) are each independently replaced with the same or different heteroatomic group, provided the point of attachment to the remainder of the molecule is through a carbon atom. The term heteroalkyl includes unbranched or branched saturated chain having carbon and heteroatoms. By way of example, 1, 2 or 3 carbon atoms may be independently replaced with the same or different heteroatomic group. Heteroatomic groups include, but are not limited to, NR.sup.y, O, S, S(O), S(O).sub.2, and the like, wherein R.sup.y is hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclyl, aryl, heteroalkyl or heteroaryl; each of which may be optionally substituted, as defined herein. Examples of heteroalkyl groups include, e.g., ethers (e.g., CH.sub.2OCH.sub.3, CH(CH.sub.3)OCH.sub.3, CH.sub.2CH.sub.2OCH.sub.3, CH.sub.2CH.sub.2OCH.sub.2CH.sub.2OCH.sub.3, etc.), thioethers (e.g., CH.sub.2SCH.sub.3, CH(CH.sub.3)SCH.sub.3, CH.sub.2CH.sub.2SCH.sub.3, CH.sub.2CH.sub.2SCH.sub.2CH.sub.2SCH.sub.3, etc.), sulfones (e.g., CH.sub.2S(O).sub.2CH.sub.3, CH(CH.sub.3) S(O).sub.2CH.sub.3, CH.sub.2CH.sub.2S(O).sub.2CH.sub.3, CH.sub.2CH.sub.2S(O).sub.2CH.sub.2CH.sub.2OCH.sub.3, etc.) and amines (e.g., CH.sub.2NR.sup.yCH.sub.3, CH(CH.sub.3)NR.sup.yCH.sub.3, CH.sub.2CH.sub.2NR.sup.yCH.sub.3, CH.sub.2CH.sub.2NR.sup.yCH.sub.2CH.sub.2NR.sup.yCH.sub.3, etc., where R.sup.y is hydrogen, alkyl, alkenyl, alkynyl, cycloalkyl, heterocyclyl, aryl, heteroalkyl, or heteroaryl; each of which may be optionally substituted, as defined herein). In some embodiments, heteroalkyl includes 1 to 10 carbon atoms (C.sub.110 heteroalkyl), 1 to 8 carbon atoms (C.sub.18 heteroalkyl), or 1 to 4 carbon atoms (C.sub.14 heteroalkyl); and 1 to 3 heteroatoms, 1 to 2 heteroatoms, or 1 heteroatom.

    [0135] Heteroaryl refers to an aromatic group having a single ring, multiple rings or multiple fused rings, with one or more ring heteroatoms independently selected from nitrogen, oxygen, and sulfur. As used herein, heteroaryl includes 1 to 20 ring carbon atoms (i.e., C.sub.1-20 heteroaryl), 3 to 12 ring carbon atoms (i.e., C.sub.3-12 heteroaryl), or 3 to 8 carbon ring atoms (i.e., C.sub.3-8 heteroaryl), and 1 to 5 ring heteroatoms, 1 to 4 ring heteroatoms, 1 to 3 ring heteroatoms, 1 to 2 ring heteroatoms, or 1 ring heteroatom independently selected from nitrogen, oxygen and sulfur. In certain instances, heteroaryl includes 5-10 membered ring systems, 5-7 membered ring systems, or 5-6 membered ring systems, each independently having 1 to 4 ring heteroatoms, 1 to 3 ring heteroatoms, 1 to 2 ring heteroatoms, or 1 ring heteroatom independently selected from nitrogen, oxygen and sulfur. Examples of heteroaryl groups include, e.g., acridinyl, benzimidazolyl, benzothiazolyl, benzindolyl, benzofuranyl, benzothiazolyl, benzothiadiazolyl, benzonaphthofuranyl, benzoxazolyl, benzothienyl (benzothiophenyl), benzotriazolyl, benzo[4,6]imidazo[1,2-a]pyridyl, carbazolyl, cinnolinyl, dibenzofuranyl, dibenzothiophenyl, furanyl, isothiazolyl, imidazolyl, indazolyl, indolyl, indazolyl, isoindolyl, isoquinolyl, isoxazolyl, naphthyridinyl, oxadiazolyl, oxazolyl, 1-oxidopyridinyl, 1-oxidopyrimidinyl, 1-oxidopyrazinyl, 1-oxidopyridazinyl, phenazinyl, phthalazinyl, pteridinyl, purinyl, pyrrolyl, pyrazolyl, pyridinyl, pyrazinyl, pyrimidinyl, pyridazinyl, quinazolinyl, quinoxalinyl, quinolinyl, quinuclidinyl, isoquinolinyl, thiazolyl, thiadiazolyl, triazolyl, tetrazolyl and triazinyl. Examples of the fused-heteroaryl rings include, but are not limited to, benzo[d]thiazolyl, quinolinyl, isoquinolinyl, benzo[b]thiophenyl, indazolyl, benzo[d]imidazolyl, pyrazolo[1,5-a]pyridinyl and imidazo[1,5-a]pyridinyl, where the heteroaryl can be bound via either ring of the fused system. Any aromatic ring, having a single or multiple fused rings, containing at least one heteroatom, is considered a heteroaryl regardless of the attachment to the remainder of the molecule (i.e., through any one of the fused rings). Heteroaryl does not encompass or overlap with aryl as defined above.

    [0136] Heterocyclyl refers to a saturated or partially unsaturated cyclic alkyl group, with one or more ring heteroatoms independently selected from nitrogen, oxygen and sulfur. The term heterocyclyl includes heterocycloalkenyl groups (i.e., the heterocyclyl group having at least one double bond), bridged-heterocyclyl groups, fused-heterocyclyl groups and spiro-heterocyclyl groups. A heterocyclyl may be a single ring or multiple rings wherein the multiple rings may be fused, bridged or spiro, and may comprise one or more (e.g., 1 to 3) oxo (O) or N-oxide (O) moieties. Any non-aromatic ring containing at least one heteroatom is considered a heterocyclyl, regardless of the attachment (i.e., can be bound through a carbon atom or a heteroatom). Further, the term heterocyclyl is intended to encompass any non-aromatic ring containing at least one heteroatom, which ring may be fused to an aryl or heteroaryl ring, regardless of the attachment to the remainder of the molecule. As used herein, heterocyclyl has 2 to 20 ring carbon atoms (i.e., C.sub.2-20 heterocyclyl), 2 to 12 ring carbon atoms (i.e., C.sub.2-12 heterocyclyl), 2 to 10 ring carbon atoms (i.e., C.sub.2-10 heterocyclyl), 2 to 8 ring carbon atoms (i.e., C.sub.2-8 heterocyclyl), 3 to 12 ring carbon atoms (i.e., C.sub.3-12 heterocyclyl), 3 to 8 ring carbon atoms (i.e., C.sub.3-8 heterocyclyl), or 3 to 6 ring carbon atoms (i.e., C.sub.3-6 heterocyclyl); having 1 to 5 ring heteroatoms, 1 to 4 ring heteroatoms, 1 to 3 ring heteroatoms, 1 to 2 ring heteroatoms, or 1 ring heteroatom independently selected from nitrogen, sulfur or oxygen. In certain instances, heterocyclyl includes 3- to 10-membered heterocyclyl having 3-10 total ring atoms, 5- to 7-membered heterocyclyl having 5-7 total ring atoms, or 5- or 6-membered heterocyclyl having 5 or 6 total ring atoms. Examples of heterocyclyl groups include, e.g., azetidinyl, azepinyl, benzodioxolyl, benzo[b][1,4]dioxepinyl, 1,4-benzodioxanyl, benzopyranyl, benzodioxinyl, benzopyranonyl, benzofuranonyl, dioxolanyl, dihydropyranyl, hydropyranyl, thienyl[1,3]dithianyl, decahydroisoquinolyl, furanonyl, imidazolinyl, imidazolidinyl, indolinyl, indolizinyl, isoindolinyl, isothiazolidinyl, isoxazolidinyl, morpholinyl, octahydroindolyl, octahydroisoindolyl, 2-oxopiperazinyl, 2-oxopiperidinyl, 2-oxopyrrolidinyl, oxazolidinyl, oxiranyl, oxetanyl, phenothiazinyl, phenoxazinyl, piperidinyl, piperazinyl, 4-piperidonyl, pyrrolidinyl, pyrazolidinyl, quinuclidinyl, thiazolidinyl, tetrahydrofuryl, tetrahydropyranyl, trithianyl, tetrahydroquinolinyl, thiophenyl (i.e., thienyl), tetrahydropyranyl, thiomorpholinyl, thiamorpholinyl, 1-oxo-thiomorpholinyl and 1,1-dioxo-thiomorpholinyl. The term heterocyclyl also includes spiroheterocyclyl when there are at least two rings are linked together by one common atom. Examples of the spiro-heterocyclyl rings include, e.g., bicyclic and tricyclic ring systems, such as 2-oxa-7-azaspiro[3.5]nonanyl, 2-oxa-6-azaspiro[3.4]octanyl and 6-oxa-1-azaspiro[3.3]heptanyl. Examples of the fused-heterocyclyl rings include, but are not limited to, 1,2,3,4-tetrahydroisoquinolinyl, 4,5,6,7-tetrahydrothieno[2,3-c]pyridinyl, indolinyl and isoindolinyl, where the heterocyclyl can be bound via either ring of the fused system. Examples of heterocyclyl include sugar moieties such as glucose, mannose, allose, altrose, gulose, idose, galactose, and talose.

    [0137] The terms alkylthio or thioalkyl as used herein refer to S-alkyl, where the term alkyl is as defined herein.

    [0138] The term sulfonamido as used herein refer to both NR.sup.gS(O).sub.2R.sup.h and S(O).sub.2NR.sup.gR.sup.h, wherein each of R.sup.g and R.sup.h is independently hydrogen, alkyl, alkenyl, alkynyl, alkoxy, thioalkyl, aryl, aryl-alkyl, cycloalkyl, cycloalkyl-alkyl, haloalkyl, heterocyclyl, heterocyclyl-alkyl, heteroaryl, or heteroaryl-alkyl, and further wherein each R.sup.g and R.sup.h may be optionally substituted, as defined herein.

    [0139] The term sulfinamido as used herein refer to both NR.sup.gS(O) R.sup.h and S(O)NR.sup.gR.sup.h, wherein each of R.sup.g and R.sup.h is independently hydrogen, alkyl, alkenyl, alkynyl, alkoxy, thioalkyl, aryl, aryl-alkyl, cycloalkyl, cycloalkyl-alkyl, haloalkyl, heterocyclyl, heterocyclyl-alkyl, heteroaryl, or heteroaryl-alkyl, and further wherein each R.sup.g and R.sup.h may be optionally substituted, as defined herein.

    [0140] The term sulfoxide or sulfoxido refers to the group S(O)R.sup.g, wherein R.sup.g is hydrogen, alkyl, alkenyl, alkynyl, alkoxy, thioalkyl, aryl, aryl-alkyl, cycloalkyl, cycloalkyl-alkyl, haloalkyl, heterocyclyl, heterocyclyl-alkyl, heteroaryl, or heteroaryl-alkyl, and further wherein R.sup.g may be optionally substituted, as defined herein.

    [0141] The term sulfonyl refers to the group-S(O).sub.2R.sup.g, wherein Re is hydrogen, alkyl, alkenyl, alkynyl, alkoxy, thioalkyl, aryl, aryl-alkyl, cycloalkyl, cycloalkyl-alkyl, haloalkyl, heterocyclyl, heterocyclyl-alkyl, heteroaryl, or heteroaryl-alkyl, and further wherein R.sup.g may be optionally substituted, as defined herein. Sugar moiety refers to a monovalent radical of a sugar molecule, such as a monosaccharide molecule, including glucose (also known as dextrose), fructose, galactose, mannose, allose, altrose, gulose, idose, and talose. As used herein, a sugar moiety a heterocyclyl substituted with OH and/or hydoxyalkyl groups. However, it is understood that a sugar moiety can exist in a liner form as an alkyl substituted with oxo and OH groups.

    [0142] The terms optional or optionally means that the subsequently described event or circumstance may or may not occur and that the description includes instances where said event or circumstance occurs and instances in which it does not. Also, the term optionally substituted refers to any one or more (e.g., 1 to 5 or 1 to 3) hydrogen atoms on the designated atom or group may or may not be replaced by a moiety other than hydrogen.

    [0143] In certain embodiments, substituted includes any of the above alkyl, heteroalkyl, alkenyl, alkynyl, cycloalkyl, heterocyclyl, aryl or heteroaryl groups in which one or more (e.g., 1 to 5 or 1 to 3) hydrogen atoms are independently replaced with halo, cyano, nitro, azido, oxo, alkyl, alkenyl, alkynyl, haloalkyl, cycloalkyl, heterocyclyl, aryl, heteroaryl, NR.sup.gR.sup.h, C(NR.sup.g) R.sup.h, C(NR.sup.g) (NR.sup.h.sub.2), NR.sup.gC(O) R.sup.h, NR.sup.gC(O) NR.sup.gR.sup.h, NR.sup.gC(O) OR.sup.h, NR.sup.gS(O).sub.1-2R.sup.h, C(O) R.sup.g, C(O) OR.sup.g, OC(O) OR.sup.g, OC(O) R.sup.g, C(O) NR.sup.gR.sup.h, OC(O) NR.sup.gR.sup.h, OR.sup.g, SR.sup.g, S(O) R.sup.g, S(O).sub.2R.sup.g, OS(O).sub.1-2R.sup.g, S(O).sub.1-2OR.sup.g, NR.sup.gS(O).sub.1-2NR.sup.gR.sup.h, NSO.sub.2R.sup.g, NOR.sup.g, S(O).sub.1-2NR.sup.gR.sup.h, CR.sup.g(NOH), NR.sup.gC(NR.sup.h) (NR.sup.hR.sup.h), SF.sub.5, SCF.sub.3 or OCF.sub.3. In certain embodiments, substituted also means any of the above groups in which one or more (e.g., 1 to 5 or 1 to 3) hydrogen atoms are replaced with C(O) R.sup.g, C(O)OR.sup.8, C(O)NR.sup.gR.sup.h, CH.sub.2SO.sub.2R.sup.g, or CH.sub.2SO.sub.2NR.sup.gR.sup.h. In the foregoing, each of R.sup.g and R.sup.h is independently hydrogen, alkyl, alkenyl, alkynyl, alkoxy, thioalkyl, aryl, aralkyl, cycloalkyl, cycloalkyl-alkyl, haloalkyl, heterocyclyl, heterocyclyl-alkyl, heteroaryl, and/or heteroaryl-alkyl. In certain embodiments, substituted also means any of the above groups in which one or more (e.g., 1 to 5 or 1 to 3) hydrogen atoms are replaced with halo, hydroxy, alkyl, alkylhydroxy, or oxo groups.

    [0144] Polymers or similar indefinite structures arrived at by defining substituents with further substituents appended ad infinitum (e.g., a substituted aryl having a substituted alkyl which is itself substituted with a substituted aryl group, which is further substituted by a substituted heteroalkyl group, etc.) are not intended for inclusion herein. Unless otherwise noted, the maximum number of serial substitutions in compounds described herein is three. For example, serial substitutions of substituted aryl groups with two other substituted aryl groups are limited to ((substituted aryl) substituted aryl) substituted aryl. Similarly, the above definitions are not intended to include impermissible substitution patterns (e.g., methyl substituted with 5 fluorines or heteroaryl groups having two adjacent oxygen ring atoms). Such impermissible substitution patterns are well known to the skilled artisan.

    [0145] In certain embodiments, as used herein, the phrase one or more refers to one to five. In certain embodiments, as used herein, the phrase one or more refers to one to three.

    [0146] Any compound or structure given herein, is also intended to represent unlabeled forms as well as isotopically labeled forms of the compounds. These forms of compounds may also be referred to as isotopically enriched analogs. Isotopically labeled compounds have structures depicted herein, except that one or more atoms are replaced by an atom having a selected atomic mass or mass number. Examples of isotopes that can be incorporated into the disclosed compounds include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine, chlorine and iodine, such as .sup.2H, .sup.3H, .sup.11C, .sup.13C, .sup.14C, .sup.13N, .sup.15N, .sup.15O, .sup.17O, .sup.18O, .sup.31P, .sup.32P, .sup.35S, .sup.18F, .sup.36Cl, .sup.123I, and .sup.125I, respectively. Various isotopically labeled compounds of the present disclosure, for example those into which radioactive isotopes such as .sup.3H or .sup.14C are incorporated. Such isotopically labelled compounds may be useful in metabolic studies, reaction kinetic studies, detection or imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug or substrate tissue distribution assays or in radioactive treatment of subjects.

    [0147] The term isotopically enriched analogs includes deuterated analogs of compounds described herein in which one or more hydrogens is/are replaced by deuterium, such as a hydrogen on a carbon atom. Such compounds may exhibit increased resistance to metabolism and are thus useful for increasing the half-life of any compound when administered to a mammal, particularly a human. See, for example, Foster, Deuterium Isotope Effects in Studies of Drug Metabolism, Trends Pharmacol. Sci. 5 (12): 524-527 (1984). Such compounds are synthesized by means well known in the art, for example by employing starting materials in which one or more hydrogens have been replaced by deuterium.

    [0148] Deuterium labelled or substituted therapeutic compounds of the disclosure may have improved DMPK (drug metabolism and pharmacokinetics) properties, relating to distribution, metabolism and excretion (ADME). Substitution with heavier isotopes such as deuterium may afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life, reduced dosage requirements and/or an improvement in therapeutic index. An .sup.18F, .sup.3H, .sup.11C labeled compound may be useful for PET or SPECT or other imaging studies. Isotopically labeled compounds of this disclosure can generally be prepared by carrying out the procedures disclosed in the schemes or in the examples and preparations described below by substituting a readily available isotopically labeled reagent for a non-isotopically labeled reagent.

    [0149] The concentration of such a heavier isotope, specifically deuterium, may be defined by an isotopic enrichment factor. In the compounds of this disclosure any atom not specifically designated as a particular isotope is meant to represent any stable isotope of that atom. Unless otherwise stated, when an atom is represented by its name or letter symbol, such as, H, C, O, or N, it is understood that the atom has its natural abundance isotopic composition. For example, when a position is designated specifically as H or hydrogen, the position is understood to have hydrogen at its natural abundance isotopic composition. Accordingly, in the compounds of this disclosure any atom specifically designated as a deuterium (D) is meant to represent deuterium.

    [0150] In many cases, the compounds of this disclosure are capable of forming acid and/or base salts by virtue of the presence of amino and/or carboxyl groups or groups similar thereto.

    [0151] Provided also are a pharmaceutically acceptable salt, isotopically enriched analog, deuterated analog, stereoisomer, and mixture of stereoisomers of the compounds described herein. Pharmaceutically acceptable or physiologically acceptable refer to compounds, salts, compositions, dosage forms and other materials which are useful in preparing a pharmaceutical composition that is suitable for veterinary or human pharmaceutical use.

    [0152] The term pharmaceutically acceptable salt of a given compound refers to salts that retain the biological effectiveness and properties of the given compound and which are not biologically or otherwise undesirable. Pharmaceutically acceptable salts or physiologically acceptable salts include, for example, salts with inorganic acids and salts with an organic acid. In addition, if the compounds described herein are obtained as an acid addition salt, the free base can be obtained by basifying a solution of the acid salt. Conversely, if the product is a free base, an addition salt, particularly a pharmaceutically acceptable addition salt, may be produced by dissolving the free base in a suitable organic solvent and treating the solution with an acid, in accordance with conventional procedures for preparing acid addition salts from base compounds. Those skilled in the art will recognize various synthetic methodologies that may be used to prepare nontoxic pharmaceutically acceptable addition salts. Pharmaceutically acceptable acid addition salts may be prepared from inorganic and organic acids. Salts derived from inorganic acids include, e.g., hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like. Salts derived from organic acids include, e.g., acetic acid, propionic acid, gluconic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluene-sulfonic acid, salicylic acid and the like. Salts derived from organic acids may be derived from anhydrous organic acids or hydrates thereof. Likewise, pharmaceutically acceptable base addition salts can be prepared from inorganic and organic bases. Salts derived from inorganic bases include, by way of example only, sodium, potassium, lithium, aluminum, ammonium, calcium and magnesium salts. Salts derived from organic bases include, but are not limited to, salts of primary, secondary and tertiary amines, such as alkyl amines (i.e., NH.sub.2 (alkyl)), dialkyl amines (i.e., HN(alkyl).sub.2), trialkyl amines (i.e., N(alkyl).sub.3), substituted alkyl amines (i.e., NH.sub.2 (substituted alkyl)), di(substituted alkyl) amines (i.e., HN(substituted alkyl).sub.2), tri(substituted alkyl) amines (i.e., N(substituted alkyl).sub.3), alkenyl amines (i.e., NH.sub.2 (alkenyl)), dialkenyl amines (i.e., HN(alkenyl).sub.2), trialkenyl amines (i.e., N(alkenyl).sub.3), substituted alkenyl amines (i.e., NH.sub.2(substituted alkenyl)), di(substituted alkenyl) amines (i.e., HN(substituted alkenyl).sub.2), tri(substituted alkenyl) amines (i.e., N(substituted alkenyl).sub.3, mono-, di- or tri-cycloalkyl amines (i.e., NH.sub.2(cycloalkyl), HN(cycloalkyl).sub.2, N(cycloalkyl).sub.3), mono-, di- or tri-arylamines (i.e., NH.sub.2 (aryl), HN(aryl).sub.2, N(aryl).sub.3) or mixed amines, etc. Specific examples of suitable amines include, by way of example only, isopropylamine, trimethyl amine, diethyl amine, tri (iso-propyl) amine, tri (n-propyl) amine, ethanolamine, 2-dimethylaminoethanol, piperazine, piperidine, morpholine, N-ethylpiperidine, and the like.

    [0153] Some of the compounds exist as tautomers. Tautomers are in equilibrium with one another. For example, amide containing compounds may exist in equilibrium with imidic acid tautomers. Regardless of which tautomer is shown and regardless of the nature of the equilibrium among tautomers, the compounds are understood by one of ordinary skill in the art to comprise tautomers. Thus, the amide containing compounds are understood to include their imidic acid tautomers. Likewise, the imidic acid containing compounds are understood to include their amide tautomers.

    [0154] A stereoisomer refers to a compound made up of the same atoms bonded by the same bonds but having different three-dimensional structures, which are not interchangeable. The present disclosure contemplates various stereoisomers and mixtures thereof and includes

    [0155] Stereoisomers include enantiomers, diastereomers, and other stereoisomeric forms that may be defined, in terms of absolute stereochemistry, as (R)- or (S)- or, as (D)- or (L)- for amino acids. The present disclosure is meant to include all such possible isomers, as well as their racemic and optically pure forms. Optically active (+) and (), (R)- and (S)-, or (D)- and (L)-isomers may be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques, for example, chromatography and fractional crystallization. Conventional techniques for the preparation/isolation of individual enantiomers include chiral synthesis from a suitable optically pure precursor or resolution of the racemate (or the racemate of a salt or derivative) using, for example, chiral high pressure liquid chromatography (HPLC). Stereoisomers also include geometric isomers when the compounds described herein contain olefinic double bonds or other centers of geometric asymmetry. Unless specified otherwise, it is intended that such compounds include both E and Z geometric isomers.

    [0156] Enantiomers are two stereoisomers whose molecules are non-superimposable mirror images of one another. Diastereomers are stereoisomers that have at least two asymmetric atoms, but which are not mirror-images of each other.

    [0157] Relative centers of the compounds as depicted herein are indicated graphically using the thick bond style and absolute stereochemistry is depicted using wedge bonds.

    [0158] When the stereochemistry of a disclosed compound is named or depicted by structure, the named or depicted stereoisomer is at least 60%, 70%, 80%, 90%, 99% or 99.9% by weight pure relative to the other stereoisomers. When a single enantiomer is named or depicted by structure, the depicted or named enantiomer is at least 60%, 70%, 80%, 90%, 99% or 99.9% by weight optically pure. Percent optical purity by weight is the ratio of the weight of the enantiomer over the weight of the enantiomer plus the weight of its optical isomer.

    [0159] When the geometry of a disclosed compound is named or depicted by structure, the named or depicted geometrical isomer is at least 60%, 70%, 80%, 90%, 99% or 99.9% by weight pure relative to the other geometrical isomers.

    [0160] In certain embodiments, where one or more stereocenters are present, a compound disclosed herein may be provided as a racemic mixture. In certain embodiments, where one or more stereocenters are present, a compound disclosed herein may be provided as a single enantiomer. For example, a compound may be provided in a composition having greater than about 30% ee, about 40% ee, about 50% ee, about 60% ee, about 70% ee, about 80% ee, about 90% ee, about 95% ee, about 97% ee, about 98% ee, about 99% ee, or greater. In certain such embodiments, compounds may be provided in a diastereomerically enriched composition. For example, a diastereomerically enriched composition comprising a compound disclosed herein may have greater than about 30% de, about 40% de, about 50% de, about 60% de, about 70% de, about 80% de, about 90% de, about 95% de, about 97% de, about 98% de, about 99% de, or greater.

    [0161] In certain embodiments, the therapeutic preparation may be enriched to provide predominantly one enantiomer of a compound (e.g., of Formula (I)). An enantiomerically enriched mixture may comprise, for example, at least about 60 mol percent of one enantiomer, or more preferably at least about 75, about 90, about 95, or even about 99 mol percent. In certain embodiments, the compound enriched in one enantiomer is substantially free of the other enantiomer, wherein substantially free means that the substance in question makes up less than about 10%, or less than about 5%, or less than about 4%, or less than about 3%, or less than about 2%, or less than about 1% as compared to the amount of the other enantiomer, e.g., in the composition or compound mixture. For example, if a composition or compound mixture contains about 98 grams of a first enantiomer and about 2 grams of a second enantiomer, it would be said to contain about 98 mol percent of the first enantiomer and only about 2% of the second enantiomer.

    [0162] In certain embodiments, the therapeutic preparation may be enriched to provide predominantly one diastereomer of a compound (e.g., of Formula (I)). A diastereomerically enriched mixture may comprise, for example, at least about 60 mol percent of one diastereomer, or more preferably at least about 75, about 90, about 95, or even about 99 mol percent.

    [0163] The term prodrug is intended to encompass compounds which, under physiologic conditions, are converted into the therapeutically active agents of the present disclosure (e.g., a compound of Formula (I)). A common method for making a prodrug is to include one or more selected moieties which are hydrolyzed under physiologic conditions to reveal the desired molecule. In other embodiments, the prodrug is converted by an enzymatic activity of the subject. For example, esters or carbonates (e.g., esters or carbonates of alcohols or carboxylic acids) are preferred prodrugs of the present disclosure. In certain embodiments, some or all of the compounds of Formula (I) in a formulation represented above can be replaced with the corresponding suitable prodrug, e.g., wherein a hydroxyl in the parent compound is presented as an ester or a carbonate or carboxylic acid A therapeutically effective amount, as used herein refers to an amount that is sufficient to achieve a desired therapeutic effect. For example, a therapeutically effective amount can refer to an amount that is sufficient to improve at least one sign or symptom of diseases or conditions disclosed herein.

    Abbreviations:

    TABLE-US-00003 DCM dichloromethane DIPEA diisopropylethylamine DMA dimethylacetamide DMAP dimethylaminopyridine DMF dimethylformamide DMSO dimethyl sulfoxide EDCI 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Equiv or eq equivalent ESI electrospray ionization EtOAc ethyl acetate EtOH ethanol EtONa sodium ethoxide HOAc or AcOH acetic acid HOBt 1-hydroxybenzotriazole HPLC high performance liquid chromatography HRMS high-resolution mass spectrometry LC liquid chromatography LCMS liquid chromatography-mass spectrometry mCPBA meta-chloroperoxybenzoic acid MeOH methanol NMM N-methylmorpholine NMP N-methyl-2-pyrrolidone OXONE Potassium peroxymonosulfate PPSE Trimethylsilyl polyphosphate rt room temperature TEA triethylamine THF tetrahydrofuran TLC thin-layer chromatography TsOH p-toluenesulfonic acid

    B. Compounds

    [0164] Small molecules have been identified that bind to and activate PLXDC1 and PLXDC2 proteins, leading to effective killing of the endothelial cells in pathogenic blood vessels that express these proteins. In certain embodiments, provided is a compound of Formula (I):

    ##STR00002##

    or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof;
    wherein [0165] n is 0, 1, 2, 3 or 4; [0166] R.sup.1 is selected from optionally substituted amino, optionally substituted aryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, and optionally substituted heteroaryl; [0167] R.sup.2 is selected from H, halo, alkyl, alkenyl, alkynyl, OH, alkoxy, CN, NO.sub.2, alkylthio, sulfoxido, sulfonyl, and amino; [0168] R.sup.5, R.sup.7 and R.sup.8 are each independently selected from H, halo, alkyl, alkenyl, alkynyl, hydroxy, alkoxy, alkenoxy, alkynoxy, alkylthio, sulfoxido, sulfonyl, carboxy, ester, CN, NO.sub.2, amino, and amido; [0169] R.sup.6 is selected from H, halo, alkyl, hydroxy, alkoxy, alkylthio, sulfoxido, sulfonyl, carboxy, ester, CN, NO.sub.2, amino, amido, sulfinamido, sulfonamido, optionally substituted heterocyclyl, optionally substituted heteroaryl, poly (ethylene glycol), and methoxypoly(ethylene glycol), or [0170] R.sup.6 and R.sup.7 together with atoms to which they are attached form an optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl; and [0171] each R.sup.9 is independently selected from halo, alkyl, OH, alkoxy, CN, and amino.

    [0172] In certain embodiments, when R.sup.2 is C.sub.1-6 alkyl, R.sup.6 is not C.sub.1-6 alkyl or C.sub.1-6 alkoxy. In other embodiments, when R.sup.2 is C.sub.1-3 alkyl, R.sup.6 is not C.sub.1-3 alkyl or C.sub.1-3 alkoxy. In certain embodiments, when R.sup.2 is ethyl, then R.sup.6 is not methyl or methoxy.

    [0173] In certain embodiments, provided is a compound of Formula (I):

    ##STR00003##

    or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof;
    wherein [0174] n is 0, 1, 2, 3 or 4; [0175] R.sup.1 is selected from optionally substituted amino, optionally substituted aryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, and optionally substituted heteroaryl; [0176] R.sup.2 is selected from halo, alkyl, alkenyl, alkynyl, alkoxy, alkenoxy, alkynoxy, CN, and NO.sub.2; [0177] R.sup.5, R.sup.7 and R.sup.8 are each independently selected from H, halo, alkyl, alkenyl, hydroxy, and alkoxy; [0178] R.sup.6 is selected from halo, alkyl, alkenyl, alkynyl hydroxy, alkoxy, alkylthio, sulfoxide, sulfonyl, carboxy, ester, NO.sub.2CN, amino, and amido; and [0179] each R.sup.9 is independently selected from halo, hydroxy, and alkoxy.

    [0180] In certain embodiments, provided is a compound of Formula (I):

    ##STR00004##

    or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof;
    wherein [0181] n is 0 or 1; [0182] R.sup.1 is selected from amino, optionally substituted heterocyclyl, and optionally substituted heteroaryl; [0183] R.sup.2 is selected from alkyl, alkoxy, CN, and NO.sub.2; [0184] R.sup.5, R.sup.7 and R.sup.8 are each independently selected from H and alkoxy; [0185] R.sup.6 is selected from halo, alkyl, alkoxy, sulfoxido, sulfonyl, carboxy, ester, NO.sub.2 and amido; and [0186] each R.sup.9 is independently halo or alkoxy.

    [0187] In certain embodiments, the compound of Formula (I) described above has at least one of the following: [0188] 1) R.sup.2 is selected from C.sub.2-30alkyl, OH, C.sub.1-40alkoxy, C.sub.1-40alkenoxy, C.sub.1-40alkynoxy, NO.sub.2, alkylthio, sulfoxido, sulfonyl, and amino, where [0189] a) when R.sup.2 is ethyl, then R.sup.6 is not methyl or methoxy, and/or [0190] b) when R.sup.2 is methoxy, then R.sup.6 is not halo, C.sub.1-2 alkyl or C.sub.1-2 alkoxy; [0191] 2) R.sup.1 is optionally substituted heteroaryl, optionally substituted bridged heterocyclyl, optionally substituted fused heterocyclyl, or optionally substituted cycloheptyl; [0192] 3) R.sup.1 is heterocyclyl optionally substituted with one halo, amino, hydroxy, alkoxy, CN, NO.sub.2, alkyl, carboxy, alkylthio, sulfoxido, sulfonyl, sulfinamido, sulfonamido, cycloalkyl, heterocyclyl, heteroaryl, poly (ethylene glycol), or methoxypoly(ethylene glycol), where if the substituent is alkyl, the alkyl is further substituted with one substituent selected from halo, amino, alkoxy, CN, NO.sub.2, carboxy, ester, alkylthio, sulfoxido, sulfonyl, sulfinamido, sulfonamido, cycloalkyl, heterocyclyl, poly (ethylene glycol), methoxypoly(ethylene glycol), pyrrolidinyl and piperidinyl; or the alkyl is substituted with at least one OR.sup.31, wherein R.sup.31 is poly (ethylene glycol) or methoxypoly(ethylene glycol); [0193] 4) R.sup.1 is amino substituted with at least one substituent selected from alkyl, cycloalkyl, heterocyclyl, heteroaryl, poly (ethylene glycol) or methoxypoly(ethylene glycol) and amino, [0194] where the alkyl is substituted with at least one substituent selected from halo, amino, hydroxy, alkoxy, CN, NO.sub.2, amido, carboxy, ester, alkylthio, sulfoxido, sulfonyl, sulfinamido, sulfonamido, cycloalkyl, heterocyclyl, and heteroaryl; or [0195] 5) R.sup.6 is alkyl substituted with at least one substituent selected from halo, amino, hydroxy, alkoxy, cycloalkoxy, heterocycloalkoxy, aryloxy, heteroaryloxy, poly (ethylene glycol)-oxy, methoxypoly(ethylene glycol)-oxy, CN, NO.sub.2, oxo, amido, carboxy, ester, alkylthio, sulfoxido, sulfonyl, sulfinamido, sulfonamido, heterocyclyl, cycloalkyl, aryl, heteroaryl, poly (ethylene glycol) and methoxypoly(ethylene glycol).

    [0196] In certain embodiments, R.sup.1 is heterocyclyl substituted with at least one substituent selected from oxo, OH, OR.sup.28, N(R.sup.28).sub.2, C(O) OR.sup.28, alkyl, aryl, and heterocyclyl, wherein the alkyl is substituted with at least one substituent selected from OH, N(R.sup.31).sub.2, S(O).sub.0-2NR.sup.31R.sup.31, C(O) N(R.sup.31).sub.2, heterocyclyl, cycloalkyl, pyrrolidinyl and piperidinyl; or the alkyl is substituted with at least one OR.sup.31a, wherein R.sup.31a is poly (ethylene glycol) or methoxypoly(ethylene glycol); and each R.sup.28 and R.sup.31 are independently H or alkyl.

    [0197] In certain embodiments, R.sup.1 is NR.sup.3R.sup.4, and R.sup.3 is H or alkyl unsubstituted or substituted with at least one substituent selected from OH, N(R.sup.28).sub.2, aryl, and heteroaryl, and R.sup.4 and R.sup.28 are each independently H or alkyl.

    [0198] In certain embodiments, a compound of Formula (I) is a compound of Formula (II) and/or (Formula III) and/or Formula (IV) and/or (Formula V) and/or Formula (VI) and/or Formula (VII) and/or Formula (VIII) and/or Formula (IX) and/or Formula (X) and/or Formula (XI) and/or Formula (XII), as described herein, or any combination thereof.

    [0199] In certain embodiments, provided is a compound of Formula (II):

    ##STR00005##

    or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, wherein each of R.sup.1, R.sup.2, R.sup.5, R.sup.6, R.sup.7, and R.sup.8 is as defined herein.

    [0200] In certain embodiments, provided is a compound of Formula (III):

    ##STR00006##

    or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, wherein each of R.sup.1, R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8 and R.sup.9 is as defined herein.

    [0201] In certain embodiments, provided is a compound of Formula (IV):

    ##STR00007## [0202] or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, wherein each of R.sup.1, R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8 and R.sup.9 is as defined herein.

    [0203] In certain embodiments, R.sup.1 is heteroaryl or heterocyclyl, each optionally substituted with a second heterocyclyl, wherein the second heterocyclyl is unsubstituted or substituted with one or more substituents, e.g., selected from OH, C(O) Oalkyl, C(O)NHalkyl, alkyl, aryl, and heterocyclyl; [0204] wherein the alkyl and heterocyclyl are each unsubstituted or substituted with one or more substituents selected from OH, alkyl and aryl.

    [0205] In certain embodiments, provided is a compound of Formula (V):

    ##STR00008## [0206] or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, [0207] wherein [0208] each of s, t, u, and v is independently 0, 1, 2, or 3, provided that the sum of s and t is 1, 2, 3 or 4, and the sum of u and v is 1, 2, 3 or 4; [0209] w is 0, 1, 2, or 3; [0210] Z.sup.1 is C or N, [0211] when Z.sup.1 is C, R.sup.20a is H, halo, oxo, NH.sub.2, OH, CN, NO.sub.2, OR.sup.28, NHR.sup.28, N(R.sup.28).sub.2, C(O) R.sup.28, C(O) OR.sup.28, C(O) OH, OC(O) R.sup.28, S(O).sub.0-2R.sup.28, NHS(O).sub.0-2R.sup.28, S(O).sub.0-2NHR.sup.28, NHS(O).sub.0-2NHR.sup.28, C(O) NH.sub.2, C(O) NHR.sup.28, C(O) N(R.sup.28).sub.2, NHC(O) R.sup.28, OC(O) NHR.sup.28, NHC(O) OR.sup.28, OC(O) N(R.sup.28).sub.2, NR.sup.32C(O) NH.sub.2, NR.sup.32C(O) NHR.sup.28, NR.sup.32C(O) N(R.sup.28).sub.2, poly (ethylene glycol), methoxypoly(ethylene glycol), C.sub.1-30 alkyl optionally substituted with OH or C(O) OH, or C.sub.1-30 heteroalkyl optionally substituted with OH or C(O) OH, wherein R.sup.32 is H or C.sub.1-4 alkyl, and R.sup.28 is C.sub.1-4 alkyl; [0212] when Z.sup.1 is N, R.sup.20a is absent; [0213] Z.sup.2 is C or N; [0214] Z.sup.3 is CH.sub.2, CHR.sup.25, CR.sup.25R.sup.25, or NR.sup.25, O, or S(O).sub.0-2 and R.sup.25 is selected from H and alkyl; and [0215] each of n, R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8, and R.sup.9 is as defined herein.

    [0216] In certain embodiments, provided is a compound of Formula (V):

    ##STR00009## [0217] or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, [0218] wherein [0219] each of s, t, u, and v is independently 0, 1, 2, or 3, provided that the sum of s and t is 1, 2, 3 or 4, and the sum of u and v is 1, 2, 3 or 4; [0220] w is 0, 1, 2, or 3; [0221] Z.sup.1 is C or N, [0222] when Z.sup.1 is C, R.sup.20a is H, halo, oxo, NH.sub.2, OH, CN, NO.sub.2, OR.sup.28, NHR.sup.28, N(R.sup.28).sub.2, C(O) R.sup.28, C(O) OR.sup.28, C(O) OH, OC(O) R.sup.28, S(O).sub.0-2R.sup.28, NHS(O).sub.0.2R.sup.28, S(O).sub.0-2NHR.sup.28, NHS(O).sub.0-2NHR.sup.28, C(O) NH.sub.2, C(O) NHR.sup.28, C(O) N(R.sup.28).sub.2, NHC(O) R.sup.28, OC(O) NHR.sup.28, NHC(O) OR.sup.28, OC(O) N(R.sup.28).sub.2, NR.sup.32C(O) NH.sub.2, NR.sup.32C(O) NHR.sup.28, NR.sup.32C(O) N(R.sup.28).sub.2, poly (ethylene glycol), methoxypoly(ethylene glycol), C.sub.1-30 alkyl optionally substituted with OH or C(O) OH, or C.sub.1-30 heteroalkyl optionally substituted with OH or C(O) OH, wherein R.sup.32 is H or C.sub.1-4 alkyl, and R.sup.28 is C.sub.1-4 alkyl; [0223] when Z.sup.1 is N, R.sup.20a is absent; [0224] Z.sup.2 is C or N; [0225] Z.sup.3 is CH.sub.2, CHR.sup.25, CR.sup.25R.sup.25, or NR.sup.25, O, or S(O).sub.0-2 and R.sup.25 is selected from H and alkyl; [0226] n is 0, 1, 2, 3 or 4; [0227] R.sup.2 is selected from H, halo, alkyl, alkenyl, alkynyl, OH, alkoxy, CN, NO.sub.2, alkylthio, sulfoxido, sulfonyl, and amino; [0228] R.sup.5, R.sup.7 and R.sup.8 are each independently selected from H, halo, alkyl, alkenyl, alkynyl, hydroxy, alkoxy, alkylthio, sulfoxido, sulfonyl, carboxy, ester, CN, NO.sub.2, amino, and amido; [0229] R.sup.6 is selected from H, halo, alkyl, hydroxy, alkoxy, alkylthio, sulfoxido, sulfonyl, carboxy, ester, CN, NO.sub.2, amino, amido, sulfinamido, sulfonamido, heterocyclyl, heteroaryl, poly (ethylene glycol), and methoxypoly(ethylene glycol), or [0230] R.sup.6 and R.sup.7 together with atoms to which they are attached form a cycloalkyl, heterocyclyl, aryl, or heteroaryl; and [0231] each R.sup.9 is independently selected from halo, alkyl, OH, alkoxy, CN, and amino.

    [0232] In certain embodiments, provided is a compound of a formula (VI):

    ##STR00010## [0233] or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, wherein each of n, s, u, v, R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8, R.sup.9, R.sup.20a, Z.sup.2, and Z.sup.3 is as defined herein.

    [0234] In certain embodiments, provided is a compound of a formula:

    ##STR00011## [0235] or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, wherein each of n, s, u, v, R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8, R.sup.9, and Z.sup.3 is as defined herein.

    [0236] In certain embodiments, provided is a compound of a formula (VIII):

    ##STR00012## [0237] or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, wherein each of n, s, u, v, R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8, R.sup.9, R.sup.20a, Z.sup.2, and Z.sup.3 is as defined herein.

    [0238] In certain embodiments, provided is a compound of a formula (IX):

    ##STR00013## [0239] or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, wherein each of n, s, u, v, R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8, R.sup.9, Z.sup.2, and Z.sup.3 is as defined herein.

    [0240] In certain embodiments, provided is a compound of a formula (X):

    ##STR00014## [0241] or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, wherein each of n, s, u, v, R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8, R.sup.9, R.sup.20a, Z.sup.2, and Z.sup.3 is as defined herein.

    [0242] In certain embodiments, provided is a compound of a formula (XI):

    ##STR00015## [0243] or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof, wherein each of n, s, u, v, R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8, R.sup.9, Z.sup.2, and Z.sup.3 is as defined herein.

    [0244] In certain embodiments, provided is a compound of Formula (I):

    ##STR00016##

    or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof;
    wherein [0245] R.sup.2 is OC.sub.4-30 alkyl; and [0246] each of n, R.sup.1, R.sup.5, R.sup.6, R.sup.7, R.sup.8, and R.sup.9 is as defined herein.

    [0247] In certain embodiments, provided is a compound of Formula (I):

    ##STR00017##

    or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof;
    wherein [0248] R.sup.6 is NO.sub.2, ester, amido, alkylthio, sulfoxido, or sulfonyl; and [0249] each of n, R.sup.1, R.sup.5, R.sup.5, R.sup.7, R.sup.8, R.sup.9 is as defined herein.

    [0250] In certain embodiments, R.sup.9 is OH or OC.sub.1-10 alkyl. In certain embodiments, each R.sup.9 is independently halo. In certain embodiments, n is 1 or 2 and each R.sup.9 is independently halo. In certain embodiments, n is 1 or 2 and each R.sup.9 is fluoro.

    [0251] In certain embodiments, provided is a compound of Formula (I):

    ##STR00018## [0252] or a pharmaceutically acceptable salt, isotopically enriched analog, stereoisomer, mixture of stereoisomers, or tautomer thereof; [0253] wherein [0254] R.sup.1 is selected from NR.sup.3R.sup.4, heterocyclyl optionally substituted with one to five R.sup.20, and heteroaryl optionally substituted with one to five R.sup.21; [0255] R.sup.2 is selected from H, halo, C.sub.1-30 alkyl optionally substituted with one to five R.sup.19, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.19, OH, OR.sup.18, CN, NO.sub.2, NH.sub.2, S(O).sub.0-2R.sup.18, and NR.sup.11R.sup.18; [0256] R.sup.3 is selected from H, C.sub.1-6 alkyl optionally substituted with one to five R.sup.20, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.20, heterocyclyl optionally substituted with one to five R.sup.20, aryl optionally substituted with one to five R.sup.21, and heteroaryl optionally substituted with one to five R.sup.21, [0257] R.sup.4 is selected from H, C.sub.1-30 alkyl optionally substituted with one to five R.sup.20, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.20, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.20, heterocyclyl optionally substituted with one to five R.sup.20, aryl optionally substituted with one to five R.sup.21, heteroaryl optionally substituted with one to five R.sup.21, poly (ethylene glycol), methoxypoly(ethylene glycol), and NR.sup.13R.sup.14; [0258] R.sup.5, R.sup.7 and R.sup.8 are each independently selected from H, halo, C.sub.1-30 alkyl optionally substituted with one to five R.sup.29, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.29, OR.sup.15, S(O).sub.0-2R.sup.16, C(O) OR.sup.15, OC(O) R.sup.16, CN, NO.sub.2, NR.sup.15R.sup.15, and C(O) NR.sup.15R.sup.15; [0259] R.sup.6 is selected from H, halo, C.sub.1-30 alkyl optionally substituted with one to five R.sup.29, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.29, OR.sup.17, S(O).sub.0-2R.sup.16, C(O) OR.sup.15, OC(O) R.sup.16, CN, NO.sub.2, NR.sup.15R.sup.15, C(O) NR.sup.15R.sup.15, NR.sup.15C(O) R.sup.16, S(O).sub.0-2NR.sup.15R.sup.15, NR.sup.15S(O).sub.0-2R.sup.16, heterocyclyl optionally substituted with one to five R.sup.29, heteroaryl optionally substituted with one to five R.sup.30, poly (ethylene glycol), and methoxypoly(ethylene glycol), or [0260] R.sup.6 and R.sup.7 together with atoms to which they are attached form C.sub.5-10cycloalkyl optionally substituted with one to five R.sup.29, heterocyclyl optionally substituted with one to five R.sup.29, aryl optionally substituted with one to five R.sup.30, or heteroaryl optionally substituted with one to five R.sup.30; [0261] R.sup.9 is independently selected from halo, C.sub.1-8 alkyl optionally substituted with one to five R.sup.22, OH, OR.sup.10, CN, and NR.sup.11R.sup.12; [0262] n is 0, 1, 2, 3 or 4; [0263] R.sup.10 is independently selected from C.sub.1-10 alkyl optionally substituted with one to five R.sup.22, and C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.22; [0264] R.sup.11 and R.sup.12 are each independently H or C.sub.1-6 alkyl optionally substituted with one to five R.sup.22; [0265] R.sup.13 is selected from H, C.sub.1-6 alkyl optionally substituted with one to five R.sup.20, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.20, heterocyclyl optionally substituted with one to five R.sup.20, aryl optionally substituted with one to five R.sup.21, and heteroaryl optionally substituted with one to five R.sup.21; [0266] R.sup.14 is selected from H, C.sub.1-30 alkyl optionally substituted with one to five R.sup.20, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.20, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.20, heterocyclyl optionally substituted with one to five R.sup.20, aryl optionally substituted with one to five R.sup.21 heteroaryl optionally substituted with one to five R.sup.21, poly (ethylene glycol), and methoxypoly(ethylene glycol); [0267] each R.sup.15 is independently selected from H, C.sub.1-30 alkyl optionally substituted with one to five R.sup.23, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.23, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.23, heterocyclyl optionally substituted with one to five R.sup.23, aryl optionally substituted with one to five R.sup.24, heteroaryl optionally substituted with one to five R.sup.24, poly (ethylene glycol), and methoxypoly(ethylene glycol); [0268] R.sup.16 is selected from C.sub.1-30 alkyl optionally substituted with one to five R.sup.23, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.23, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.23, heterocyclyl optionally substituted with one to five R.sup.23, aryl optionally substituted with one to five R.sup.24, heteroaryl optionally substituted with one to five R.sup.24, poly (ethylene glycol), and methoxypoly(ethylene glycol); [0269] R.sup.17 is selected from H, C.sub.1-30 alkyl optionally substituted with one to five R.sup.27, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.27, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.27, heterocyclyl optionally substituted with one to five R.sup.27, aryl optionally substituted with one to five R.sup.24, heteroaryl optionally substituted with one to five R.sup.24, poly (ethylene glycol), and methoxypoly(ethylene glycol); [0270] R.sup.18 is selected from C.sub.1-30 alkyl optionally substituted with one to five R.sup.19 and C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.19; [0271] each R.sup.20 is independently selected from halo, oxo, NH.sub.2, OH, CN, NO.sub.2, OR.sup.28, NHR.sup.28, N(R.sup.28).sub.2, C(O) R.sup.28, C(O) OR.sup.28, C(O) OH, OC(O) R.sup.28, S(O).sub.0-2R.sup.28, NHS(O).sub.0-2R.sup.28, S(O).sub.0-2NHR.sup.28, NHS(O).sub.0-2NHR.sup.28, C(O) NHR.sup.28, C(O) N(R.sup.28).sub.2, NHC(O) R.sup.28, OC(O) NHR.sup.28, NHC(O) OR.sup.28, OC(O) N(R.sup.28).sub.2, NR.sup.32C(O) NH.sub.2, NR.sup.32C(O) NHR.sup.28, NR.sup.32C(O) N(R.sup.28).sub.2, C.sub.1-30 alkyl optionally substituted with one to five R.sup.25, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.25, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.25, heterocyclyl optionally substituted with one to five R.sup.25, aryl optionally substituted with one to five R.sup.26, heteroaryl optionally substituted with one to five R.sup.26, poly (ethylene glycol), and methoxypoly(ethylene glycol); [0272] each R.sup.21 is independently selected from halo, NH.sub.2, OH, CN, NO.sub.2, OR.sup.28, NHR.sup.28, N(R.sup.28).sub.2, C(O) R.sup.28, C(O) OR.sup.28, C(O) OH, OC(O) R.sup.28, S(O).sub.0-2R.sup.28, NHS(O).sub.0-2R.sup.28, S(O).sub.0-2NHR.sup.28, NHS(O).sub.0-2NHR.sup.28, C(O) NHR.sup.28, NHC(O) R.sup.28, C(O) N(R.sup.28).sub.2, OC(O) NHR.sup.28, NHC(O) OR.sup.28, OC(O) N(R.sup.28).sub.2, NR.sup.32C(O) NH.sub.2, NR.sup.32C(O) NHR.sup.28, NR.sup.32C(O) N(R.sup.28).sub.2, C.sub.1-6 alkyl optionally substituted with one to five R.sup.25, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.25, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.25, heterocyclyl optionally substituted with one to five R.sup.25, aryl optionally substituted with one to five R.sup.26, and heteroaryl optionally substituted with one to five R.sup.26, poly (ethylene glycol), and methoxypoly(ethylene glycol); [0273] each R.sup.19 or R.sup.22 is independently selected from halo, NH.sub.2, OH, CN, NO.sub.2, oxo, C.sub.1-4 alkyl, C.sub.1-4 haloalkyl, C.sub.1-4 hydroxyalkyl, C.sub.1-4 alkoxy, NHC.sub.1-4alkyl, N(C.sub.1-4 alkyl).sub.2, C(O)C.sub.1-4 alkyl, C(O)OC.sub.1-4 alkyl, C(O) OH, S(O).sub.0-2C.sub.1-4 alkyl, NHS(O).sub.0-2C.sub.1-4 alkyl, S(O).sub.0-2NHC.sub.1-4 alkyl, NHS(O).sub.0-2NHC.sub.1-4 alkyl, C(O) NHC.sub.1-4 alkyl, NHC(O)C.sub.1-4 alkyl, C(O) N(C.sub.1-4 alkyl).sub.2, OC(O) NHC.sub.1-4 alkyl, NHC(O)OC.sub.1-4 alkyl, OC(O) N(C.sub.1-4 alkyl).sub.2, NHC.sub.1-4 haloalkyl, N(C.sub.1-4 haloalkyl).sub.2, C(O)C.sub.1-4 haloalkyl, S(O).sub.0-2C.sub.1-4 haloalkyl, NHS(O).sub.0-2C.sub.1-4 haloalkyl, S(O).sub.0-2NHC.sub.1-4 haloalkyl, NHS(O).sub.0-2NHC.sub.1-4 haloalkyl, C(O) NHC.sub.1-4 haloalkyl, NHC(O)C.sub.1-4 haloalkyl, C(O) N(C.sub.1-4 haloalkyl).sub.2, OC(O) NHC.sub.1-4 haloalkyl, NHC(O)OC.sub.1-4 haloalkyl, OC(O) N(C.sub.1-4 haloalkyl).sub.2, and C.sub.3-10 cycloalkyl; [0274] each R.sup.25 is independently selected from halo, NH.sub.2, OH, CN, NO.sub.2, oxo, OR.sup.31, NHR.sup.31, N(R.sup.31).sub.2, C(O) R.sup.31, C(O) OR.sup.31, C(O) OH, S(O).sub.0-2R.sup.31, NR.sup.32S(O).sub.0-2R.sup.31, S(O).sub.0-2NR.sup.32R.sup.31, NR.sup.32S(O).sub.0.2NR.sup.32R.sup.31, C(O) NH.sub.2, C(O) NHR.sup.31, NR.sup.32C(O) R.sup.31, C(O) N(R.sup.31).sub.2, OC(O) NHR.sup.31, NR.sup.32C(O) OR.sup.31, OC(O) N(R.sup.31).sub.2, NR.sup.32C(O) NH.sub.2, NR.sup.32C(O) NHR.sup.31, NR.sup.32C(O) N(R.sup.31).sub.2, C.sub.1-30 alkyl optionally substituted with one to five R.sup.33, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.33, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.33, heterocyclyl optionally substituted with one to five R.sup.33, aryl optionally substituted with one to five R.sup.34, heteroaryl optionally substituted with one to five R.sup.34, poly (ethylene glycol), and methoxypoly(ethylene glycol); [0275] each R.sup.26 is independently selected from halo, NH.sub.2, OH, CN, NO.sub.2, OR.sup.31, NHR.sup.31, N(R.sup.31).sub.2, C(O) R.sup.31, C(O) OR.sup.31, C(O) OH, S(O).sub.0-2R.sup.31, NR.sup.32S(O).sub.0-2R.sup.31, S(O).sub.0-2NR.sup.32R.sup.31, NR.sup.32S(O).sub.0-2NR.sup.32R.sup.31, C(O) NH.sub.2, C(O) NHR.sup.31, NR.sup.32C(O) R.sup.31, C(O) N(R.sup.31).sub.2, OC(O) NHR.sup.31, NR.sup.32C(O) OR.sup.31, OC(O) N(R.sup.31).sub.2, NR.sup.32C(O) NH.sub.2, NR.sup.32C(O) NHR.sup.31, NR.sup.32C(O) N(R.sup.31).sub.2, C.sub.1-30 alkyl optionally substituted with one to five R.sup.33, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.33, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.33, heterocyclyl optionally substituted with one to five R.sup.33, aryl optionally substituted with one to five R.sup.34, and heteroaryl optionally substituted with one to five R.sup.34, poly (ethylene glycol), and methoxypoly(ethylene glycol); [0276] each R.sup.31 is independently selected C.sub.1-30 alkyl optionally substituted with one to five R.sup.33, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.33, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.33, heterocyclyl optionally substituted with one to five R.sup.33, aryl optionally substituted with one to five R.sup.34, heteroaryl optionally substituted with one to five R.sup.34, poly (ethylene glycol) and methoxypoly(ethylene glycol); [0277] each R.sup.32 is independently selected H and C.sub.1-4 alkyl; [0278] each R.sup.23, R.sup.27, R.sup.29 or R.sup.33 is independently selected from halo, NH.sub.2, OH, CN, NO.sub.2, oxo, C.sub.1-4 alkyl optionally substituted with phenyl, C.sub.1-4 haloalkyl, C.sub.1-4 hydroxyalkyl, C.sub.1-4 alkoxy, NHC.sub.1-4 alkyl, N(C.sub.1-4 alkyl).sub.2, C(O)C.sub.1-4 alkyl, C(O)OC.sub.1-4 alkyl, C(O) OH, S(O).sub.0-2C.sub.1-4 alkyl, NHS(O).sub.0-2C.sub.1-4 alkyl, S(O).sub.0-2NHC.sub.1-4 alkyl, NHS(O).sub.0-2NHC.sub.1-4 alkyl, C(O) NHC.sub.1-4 alkyl, NHC(O)C.sub.1-4 alkyl, C(O) N(C.sub.1-4 alkyl).sub.2, OC(O) NHC.sub.1-4 alkyl, NHC(O)OC.sub.1-4 alkyl, OC(O) N(C.sub.1-4 alkyl).sub.2, NHC.sub.1-4 haloalkyl, N(C.sub.1-4 haloalkyl).sub.2, C(O)C.sub.1-4 haloalkyl, NHS(O).sub.0-2C.sub.1-4 haloalkyl, S(O).sub.0-2NHC.sub.1-4 haloalkyl, S(O).sub.0-2C.sub.1-4 haloalkyl, C(O) NHC.sub.1-4 haloalkyl, NHC(O)C.sub.1-4 haloalkyl, NHS(O).sub.0-2NHC.sub.1-4 haloalkyl, C(O) N(C.sub.1-4 haloalkyl).sub.2, OC(O) NHC.sub.1-4 haloalkyl, NHC(O)OC.sub.1-4 haloalkyl, OC(O) N(C.sub.1-4 haloalkyl).sub.2, C.sub.3-10 cycloalkyl, heterocyclyl, aryl heteroaryl, (CH.sub.2).sub.1-30C(O) OH, (CH.sub.2).sub.0-4O-poly (ethylene glycol), methoxypoly(ethylene glycol)-O(CH.sub.2).sub.0-4, and sugar moiety; [0279] each R.sup.24, R.sup.30 or R.sup.34 is independently selected from halo, NH.sub.2, OH, CN, NO.sub.2, C.sub.1-4 alkyl, C.sub.1-4 haloalkyl, C.sub.1-4 hydroxyalkyl, C.sub.1-4 alkoxy, NHC.sub.1-4alkyl, N(C.sub.1-4 alkyl).sub.2, C(O)C.sub.1-4 alkyl, C(O) OH, C(O)OC.sub.1-4 alkyl, S(O).sub.0-2C.sub.1-4 alkyl, NHS(O).sub.0-2C.sub.1-4 alkyl, S(O).sub.0-2NHC.sub.1-4 alkyl, NHS(O).sub.0-2NHC.sub.1-4 alkyl, C(O) NHC.sub.1-4 alkyl, NHC(O)C.sub.1-4 alkyl, C(O) N(C.sub.1-4 alkyl).sub.2, OC(O) NHC.sub.1-4 alkyl, NHC(O)OC.sub.1-4 alkyl, OC(O) N(C.sub.1-4 alkyl).sub.2, NHC.sub.1-4 haloalkyl, N(C.sub.1-4 haloalkyl).sub.2, C(O)C.sub.1-4 haloalkyl, S(O).sub.0-2C.sub.1-4 haloalkyl, NHS(O).sub.0-2C.sub.1-4 haloalkyl, S(O).sub.0-2NHC.sub.1-4 haloalkyl, NHS(O).sub.0-2NHC.sub.1-4 haloalkyl, C(O) NHC.sub.1-4 haloalkyl, NHC(O)C.sub.1-4 haloalkyl, C(O) N(C.sub.1-4 haloalkyl).sub.2, OC(O) NHC.sub.1-4 haloalkyl, NHC(O)OC.sub.1-4 haloalkyl, OC(O) N(C.sub.1-4 haloalkyl).sub.2, C.sub.3-10 cycloalkyl, heterocyclyl, aryl, heteroaryl, (CH.sub.2).sub.1-30C(O) OH, (CH.sub.2).sub.0-4O-poly (ethylene glycol), (CH.sub.2).sub.0-4O-methoxypoly(ethylene glycol) and sugar moiety; and [0280] each R.sup.28 is independently selected from C.sub.1-30 alkyl optionally substituted with one to five R.sup.25, C.sub.1-30 heteroalkyl optionally substituted with one to five R.sup.25, C.sub.3-10 cycloalkyl optionally substituted with one to five R.sup.25, heterocyclyl optionally substituted with one to five R.sup.25, aryl optionally substituted with one to five R.sup.26, heteroaryl optionally substituted with one to five R.sup.26, poly (ethylene glycol), and methoxypoly(ethylene glycol).

    [0281] In certain embodiments, poly (ethylene glycol) has an average molecular weight of less than 20,000. In certain embodiments, poly (ethylene glycol) has an average molecular weight of less than 15,000. In certain embodiments, poly (ethylene glycol) has an average molecular weight of less than 10,000. In certain embodiments, poly (ethylene glycol) has an average molecular weight of less than 5,000. In certain embodiments, poly (ethylene glycol) has an average molecular weight of less than 2,000. In certain embodiments, poly (ethylene glycol) has an average molecular weight of about 20,000 to about 2,000. In certain embodiments, poly (ethylene glycol) has an average molecular weight of about 10,000 to about 2,000.

    [0282] In certain embodiments, methoxypoly(ethylene glycol) has an average molecular weight of less than 20,000. In certain embodiments, methoxypoly(ethylene glycol) has an average molecular weight of less than 15,000. In certain embodiments, methoxypoly(ethylene glycol) has an average molecular weight of less than 15,000. In certain embodiments, methoxypoly(ethylene glycol) has an average molecular weight of less than 10,000. In certain embodiments, methoxypoly(ethylene glycol) has an average molecular weight of less than 5,000. In certain embodiments, methoxypoly(ethylene glycol) has an average molecular weight of less than 2,000. In certain embodiments, methoxypoly(ethylene glycol) has an average molecular weight of about 20,000 to about 2,000. In certain embodiments, methoxypoly(ethylene glycol) has an average molecular weight of about 10,000 to about 2,000.

    [0283] In certain embodiments, provided is a compound selected from Table 3, or a pharmaceutically acceptable salt or prodrug thereof.

    [0284] In certain embodiments, provided is a salt of a compound of this disclosure. In certain embodiments, the salt is salt of a compound of this disclosure formed with hydrochloric acid, hydrochloric acid, phosphoric acid, methanesulfonic acid (mesylate salt), malic acid, malonic acid, maleic acid, fumaric acid, tartaric acid, citric acid, or acetic acid. In certain embodiments, the salt is a salt of a compound of this disclosure formed with methanesulfonic acid (mesylate salt).

    C. Compound Agents of the Disclosure

    TABLE-US-00004 TABLE 3 Ex. Structure 1 [00019]embedded image 2 [00020]embedded image 3 [00021]embedded image 4 [00022]embedded image 5 [00023]embedded image 6 [00024]embedded image 7 [00025]embedded image 8 [00026]embedded image 9 [00027]embedded image 10 [00028]embedded image 11 [00029]embedded image 12 [00030]embedded image 13 [00031]embedded image 14 [00032]embedded image 15 [00033]embedded image 16 [00034]embedded image 17 [00035]embedded image 18 [00036]embedded image 19 [00037]embedded image 20 [00038]embedded image 21 [00039]embedded image 22 [00040]embedded image 23 [00041]embedded image 24 [00042]embedded image 25 [00043]embedded image 26 [00044]embedded image 27 [00045]embedded image 28 [00046]embedded image 29 [00047]embedded image 30 [00048]embedded image 31 [00049]embedded image 32 [00050]embedded image 33 [00051]embedded image 34 [00052]embedded image 35 [00053]embedded image 36 [00054]embedded image 37 [00055]embedded image 38 [00056]embedded image 39 [00057]embedded image 40 [00058]embedded image 41 [00059]embedded image 42 [00060]embedded image 43 [00061]embedded image 44 [00062]embedded image 45 [00063]embedded image 46 [00064]embedded image 47 [00065]embedded image 48 [00066]embedded image 49 [00067]embedded image 50 [00068]embedded image 51 [00069]embedded image 52 [00070]embedded image 53 [00071]embedded image 54 [00072]embedded image 55 [00073]embedded image 56 [00074]embedded image 57 [00075]embedded image 58 [00076]embedded image 59 [00077]embedded image 60 [00078]embedded image 61 [00079]embedded image 62 [00080]embedded image 63 [00081]embedded image 64 [00082]embedded image 65 [00083]embedded image 66 [00084]embedded image 67 [00085]embedded image 68 [00086]embedded image 69 [00087]embedded image 70 [00088]embedded image 71 [00089]embedded image 72 [00090]embedded image 73 [00091]embedded image 74 [00092]embedded image 75 [00093]embedded image 76 [00094]embedded image 77 [00095]embedded image 78 [00096]embedded image 79 [00097]embedded image 80 [00098]embedded image 81 [00099]embedded image 82 [00100]embedded image 83 [00101]embedded image 84 [00102]embedded image 85 [00103]embedded image 86 [00104]embedded image 87 [00105]embedded image 88 [00106]embedded image 89 [00107]embedded image 90 [00108]embedded image 91 [00109]embedded image 92 [00110]embedded image 93 [00111]embedded image 94 [00112]embedded image 95 [00113]embedded image 96 [00114]embedded image 97 [00115]embedded image 98 [00116]embedded image 99 [00117]embedded image 100 [00118]embedded image 101 [00119]embedded image 102 [00120]embedded image 103 [00121]embedded image 104 [00122]embedded image 105 [00123]embedded image 106 [00124]embedded image 107 [00125]embedded image 108 [00126]embedded image 109 [00127]embedded image 110 [00128]embedded image 111 [00129]embedded image 112 [00130]embedded image 113 [00131]embedded image 114 [00132]embedded image 115 [00133]embedded image 116 [00134]embedded image 117 [00135]embedded image 118 [00136]embedded image 119 [00137]embedded image 120 [00138]embedded image 121 [00139]embedded image 122 [00140]embedded image 123 [00141]embedded image 124 [00142]embedded image 125 [00143]embedded image 126 [00144]embedded image 127 [00145]embedded image 128 [00146]embedded image 129 [00147]embedded image 130 [00148]embedded image 131 [00149]embedded image 132 [00150]embedded image 133 [00151]embedded image 134 [00152]embedded image 135 [00153]embedded image 136 [00154]embedded image 137 [00155]embedded image 138 [00156]embedded image 139 [00157]embedded image 140 [00158]embedded image 141 [00159]embedded image 142 [00160]embedded image 143 [00161]embedded image 144 [00162]embedded image 145 [00163]embedded image 146 [00164]embedded image 147 [00165]embedded image 148 [00166]embedded image 149 [00167]embedded image 150 [00168]embedded image 151 [00169]embedded image 152 [00170]embedded image 153 [00171]embedded image 154 [00172]embedded image 155 [00173]embedded image 156 [00174]embedded image 157 [00175]embedded image 158 [00176]embedded image 159 [00177]embedded image 160 [00178]embedded image 161 [00179]embedded image 162 [00180]embedded image 163 [00181]embedded image 164 [00182]embedded image 165 [00183]embedded image 166 [00184]embedded image 167 [00185]embedded image 168 [00186]embedded image 169 [00187]embedded image 170 [00188]embedded image 171 [00189]embedded image 172 [00190]embedded image 173 [00191]embedded image 174 [00192]embedded image 175 [00193]embedded image 176 [00194]embedded image 177 [00195]embedded image 178 [00196]embedded image 179 [00197]embedded image 180 [00198]embedded image 181 [00199]embedded image 182 [00200]embedded image 183 [00201]embedded image 184 [00202]embedded image 185 [00203]embedded image 186 [00204]embedded image 187 [00205]embedded image 188 [00206]embedded image 189 [00207]embedded image 190 [00208]embedded image 191 [00209]embedded image 192 [00210]embedded image 193 [00211]embedded image 194 [00212]embedded image 195 [00213]embedded image 196 [00214]embedded image 197 [00215]embedded image 198 [00216]embedded image 199 [00217]embedded image 200 [00218]embedded image 201 [00219]embedded image 202 [00220]embedded image 203 [00221]embedded image 204 [00222]embedded image 205 [00223]embedded image 206 [00224]embedded image 207 [00225]embedded image 208 [00226]embedded image 209 [00227]embedded image 210 [00228]embedded image 211 [00229]embedded image 212 [00230]embedded image 213 [00231]embedded image 214 [00232]embedded image 215 [00233]embedded image 216 [00234]embedded image 217 [00235]embedded image 218 [00236]embedded image 219 [00237]embedded image 220 [00238]embedded image 221 [00239]embedded image 222 [00240]embedded image 223 [00241]embedded image 224 [00242]embedded image 225 [00243]embedded image 226 [00244]embedded image 227 [00245]embedded image 228 [00246]embedded image 229 [00247]embedded image 230 [00248]embedded image 231 [00249]embedded image 232 [00250]embedded image 233 [00251]embedded image 234 [00252]embedded image 235 [00253]embedded image 236 [00254]embedded image 237 [00255]embedded image 238 [00256]embedded image 239 [00257]embedded image 240 [00258]embedded image 241 [00259]embedded image 242 [00260]embedded image 243 [00261]embedded image 244 [00262]embedded image 245 [00263]embedded image 246 [00264]embedded image 247 [00265]embedded image 248 [00266]embedded image 249 [00267]embedded image 250 [00268]embedded image 251 [00269]embedded image 252 [00270]embedded image 253 [00271]embedded image 254 [00272]embedded image 255 [00273]embedded image 256 [00274]embedded image 257 [00275]embedded image 258 [00276]embedded image 259 [00277]embedded image 260 [00278]embedded image 262 [00279]embedded image 263 [00280]embedded image 264 [00281]embedded image 265 [00282]embedded image 266 [00283]embedded image 267 [00284]embedded image 268 [00285]embedded image 269 [00286]embedded image 270 [00287]embedded image 271 [00288]embedded image 272 [00289]embedded image 273 [00290]embedded image 274 [00291]embedded image 275 [00292]embedded image 276 [00293]embedded image 277 [00294]embedded image 278 [00295]embedded image 279 [00296]embedded image 280 [00297]embedded image 281 [00298]embedded image 282 [00299]embedded image 283 [00300]embedded image 284 [00301]embedded image 285 [00302]embedded image 286 [00303]embedded image 287 [00304]embedded image 288 [00305]embedded image 289 [00306]embedded image 290 [00307]embedded image 291 [00308]embedded image 292 [00309]embedded image 293 [00310]embedded image 294 [00311]embedded image 295 [00312]embedded image 296 [00313]embedded image 297 [00314]embedded image 298 [00315]embedded image 299 [00316]embedded image 300 [00317]embedded image 301 [00318]embedded image 302 [00319]embedded image 303 [00320]embedded image 304 [00321]embedded image 305 [00322]embedded image 306 [00323]embedded image 307 [00324]embedded image 308 [00325]embedded image 309 [00326]embedded image 310 [00327]embedded image 311 [00328]embedded image 312 [00329]embedded image 313 [00330]embedded image 314 [00331]embedded image 315 [00332]embedded image 316 [00333]embedded image 317 [00334]embedded image 318 [00335]embedded image 319 [00336]embedded image 320 [00337]embedded image 321 [00338]embedded image 322 [00339]embedded image 323 [00340]embedded image 324 [00341]embedded image 325 [00342]embedded image 326 [00343]embedded image 327 [00344]embedded image 328 [00345]embedded image 329 [00346]embedded image 330 [00347]embedded image 331 [00348]embedded image 332 [00349]embedded image 333 [00350]embedded image 334 [00351]embedded image 335 [00352]embedded image 336 [00353]embedded image 337 [00354]embedded image 338 [00355]embedded image 339 [00356]embedded image 340 [00357]embedded image 341 [00358]embedded image 342 [00359]embedded image 343 [00360]embedded image 344 [00361]embedded image 345 [00362]embedded image 346 [00363]embedded image 347 [00364]embedded image 348 [00365]embedded image 349 [00366]embedded image 350 [00367]embedded image 351 [00368]embedded image 352 [00369]embedded image 353 [00370]embedded image 354 [00371]embedded image 355 [00372]embedded image 356 [00373]embedded image 357 [00374]embedded image 358 [00375]embedded image 359 [00376]embedded image 360 [00377]embedded image 361 [00378]embedded image 362 [00379]embedded image 363 [00380]embedded image 364 [00381]embedded image 365 [00382]embedded image 366 [00383]embedded image 367 [00384]embedded image 368 [00385]embedded image 369 [00386]embedded image 370 [00387]embedded image 371 [00388]embedded image 372 [00389]embedded image 373 [00390]embedded image 374 [00391]embedded image 375 [00392]embedded image 376 [00393]embedded image 377 [00394]embedded image 378 [00395]embedded image 379 [00396]embedded image 380 [00397]embedded image 381 [00398]embedded image 382 [00399]embedded image 383 [00400]embedded image 384 [00401]embedded image 385 [00402]embedded image 386 [00403]embedded image 387 [00404]embedded image 388 [00405]embedded image 389 [00406]embedded image 390 [00407]embedded image 391 [00408]embedded image 392 [00409]embedded image 393 [00410]embedded image 394 [00411]embedded image 395 [00412]embedded image 396 [00413]embedded image 397 [00414]embedded image 398 [00415]embedded image 399 [00416]embedded image 400 [00417]embedded image 401 [00418]embedded image 402 [00419]embedded image 403 [00420]embedded image 404 [00421]embedded image 405 [00422]embedded image 406 [00423]embedded image 407 [00424]embedded image 408 [00425]embedded image 409 [00426]embedded image 410 [00427]embedded image 411 [00428]embedded image 412 [00429]embedded image 413 [00430]embedded image 414 [00431]embedded image 415 [00432]embedded image 416 [00433]embedded image 417 [00434]embedded image 418 [00435]embedded image 419 [00436]embedded image 420 [00437]embedded image 421 [00438]embedded image 422 [00439]embedded image 423 [00440]embedded image 424 [00441]embedded image 425 [00442]embedded image 426 [00443]embedded image 427 [00444]embedded image 428 [00445]embedded image 429 [00446]embedded image 430 [00447]embedded image 431 [00448]embedded image 432 [00449]embedded image 433 [00450]embedded image 434 [00451]embedded image 435 [00452]embedded image 436 [00453]embedded image 437 [00454]embedded image 438 [00455]embedded image 439 [00456]embedded image 440 [00457]embedded image 441 [00458]embedded image 442 [00459]embedded image 443 [00460]embedded image 444 [00461]embedded image 445 [00462]embedded image 446 [00463]embedded image 447 [00464]embedded image 448 [00465]embedded image 449 [00466]embedded image 450 [00467]embedded image 451 [00468]embedded image 452 [00469]embedded image 453 [00470]embedded image 454 [00471]embedded image 455 [00472]embedded image 456 [00473]embedded image 457 [00474]embedded image 458 [00475]embedded image 459 [00476]embedded image 460 [00477]embedded image 461 [00478]embedded image 462 [00479]embedded image 463 [00480]embedded image 464 [00481]embedded image 465 [00482]embedded image 466 [00483]embedded image 467 [00484]embedded image 468 [00485]embedded image 469 [00486]embedded image 470 [00487]embedded image 471 [00488]embedded image 472 [00489]embedded image 473 [00490]embedded image 474 [00491]embedded image 475 [00492]embedded image 476 [00493]embedded image 477 [00494]embedded image 478 [00495]embedded image 479 [00496]embedded image 480 [00497]embedded image 481 [00498]embedded image 482 [00499]embedded image 483 [00500]embedded image 484 [00501]embedded image 485 [00502]embedded image 486 [00503]embedded image 487 [00504]embedded image 488 [00505]embedded image 489 [00506]embedded image 490 [00507]embedded image 491 [00508]embedded image 492 [00509]embedded image 493 [00510]embedded image 494 [00511]embedded image 495 [00512]embedded image 496 [00513]embedded image 497 [00514]embedded image 498 [00515]embedded image 499 [00516]embedded image 500 [00517]embedded image 501 [00518]embedded image 502 [00519]embedded image 503 [00520]embedded image 504 [00521]embedded image 505 [00522]embedded image 506 [00523]embedded image 507 [00524]embedded image 508 [00525]embedded image 509 [00526]embedded image 510 [00527]embedded image 511 [00528]embedded image 512 [00529]embedded image 513 [00530]embedded image 514 [00531]embedded image 515 [00532]embedded image 516 [00533]embedded image 517 [00534]embedded image 518 [00535]embedded image 519 [00536]embedded image 520 [00537]embedded image 521 [00538]embedded image 522 [00539]embedded image 523 [00540]embedded image 524 [00541]embedded image 525 [00542]embedded image 526 [00543]embedded image 527 [00544]embedded image 528 [00545]embedded image 529 [00546]embedded image 530 [00547]embedded image 531 [00548]embedded image 532 [00549]embedded image 533 [00550]embedded image 534 [00551]embedded image 535 [00552]embedded image 536 [00553]embedded image 537 [00554]embedded image 538 [00555]embedded image 539 [00556]embedded image 540 [00557]embedded image 541 [00558]embedded image 542 [00559]embedded image

    [0285] Compounds shown in Table 3 may be synthesized according to the procedures described in U.S. Pat. 62/916,983 or PCT/US20/55979, each of which are incorporated by reference for all purposes.

    IV. Antibodies

    [0286] Disclosed herein are methods of modulating the activity of a PLXDC1 and/or PLXDC2 receptor using an antibody (e.g., an antibody that activates the PLXDC1 and/or PLXDC2 receptor, such as an antibody disclosed herein, such as an antibody that binds to the extracellular domain of a receptor described herein, such as AA02, AA03, or AA94, or those in Table 6). In some embodiments, the antibody is an anti-PLXDC1 and/or anti-PLXDC2 antibody. In some embodiments, the antibody is specific for a PLXDC1 and/or PLXDC2 protein (e.g., an extracellular domain of PLXDC1 and/or PLXDC2).

    A. Antibodies

    [0287] The term antibody refers to an intact immunoglobulin of any isotype, or a fragment thereof that can compete with the intact antibody for specific binding to the target antigen, and includes chimeric, humanized, fully human, and bispecific antibodies. As used herein, the terms antibody or immunoglobulin are used interchangeably and refer to any of several classes of structurally related proteins that function as part of the immune response of an animal, including IgG, IgD, IgE, IgA, IgM, and related proteins, as well as polypeptides comprising antibody CDR domains that retain antigen-binding activity.

    [0288] The term antigen refers to a molecule or a portion of a molecule capable of being bound by a selective binding agent, such as an antibody. An antigen may possess one or more epitopes that are capable of interacting with different antibodies.

    [0289] The term epitope includes any region or portion of molecule capable eliciting an immune response by binding to an immunoglobulin or to a T-cell receptor. Epitope determinants may include chemically active surface groups such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and may have specific three-dimensional structural characteristics and/or specific charge characteristics. Generally, antibodies specific for a particular target antigen will preferentially recognize an epitope on the target antigen within a complex mixture.

    [0290] The epitope regions of a given polypeptide can be identified using many different epitope mapping techniques are well known in the art, including: x-ray crystallography, nuclear magnetic resonance spectroscopy, site-directed mutagenesis mapping, protein display arrays, see, e.g., Epitope Mapping Protocols, (Johan Rockberg and Johan Nilvebrant, Ed., 2018) Humana Press, New York, N.Y. Such techniques are known in the art and described in, e.g., U.S. Pat. No. 4,708,871; Geysen et al. Proc. Natl. Acad. Sci. USA 81:3998-4002 (1984); Geysen et al. Proc. Natl. Acad. Sci. USA 82:178-182 (1985); Geysen et al. Molec. Immunol. 23:709-715 (1986). Additionally, antigenic regions of proteins can also be predicted and identified using standard antigenicity and hydropathy plots.

    [0291] The term immunogenic sequence means a molecule that includes an amino acid sequence of at least one epitope such that the molecule is capable of stimulating the production of antibodies in an appropriate host. The term immunogenic composition means a composition that comprises at least one immunogenic molecule (e.g., an antigen or carbohydrate).

    [0292] An intact antibody is generally composed of two full-length heavy chains and two full-length light chains, but in some instances may include fewer chains, such as antibodies naturally occurring in camelids that may comprise only heavy chains. Antibodies as disclosed herein may be derived solely from a single source or may be chimeric, that is, different portions of the antibody may be derived from two different antibodies. For example, the variable or CDR regions may be derived from a rat or murine source, while the constant region is derived from a different animal source, such as a human. The antibodies or binding fragments may be produced in hybridomas, by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact antibodies. Unless otherwise indicated, the term antibody includes derivatives, variants, fragments, and muteins thereof, examples of which are described below (Sela-Culang et al., Front Immunol. 2013; 4:302; 2013).

    [0293] The term light chain includes a full-length light chain and fragments thereof having sufficient variable region sequence to confer binding specificity. A full-length light chain has a molecular weight of around 25,000 Daltons and includes a variable region domain (abbreviated herein as VL), and a constant region domain (abbreviated herein as CL). There are two classifications of light chains, identified as kappa (2) and lambda (2). The term VL fragment means a fragment of the light chain of a monoclonal antibody that includes all or part of the light chain variable region, including CDRs. A VL fragment can further include light chain constant region sequences. The variable region domain of the light chain is at the amino-terminus of the polypeptide.

    [0294] The term heavy chain includes a full-length heavy chain and fragments thereof having sufficient variable region sequence to confer binding specificity. A full-length heavy chain has a molecular weight of around 50,000 Daltons and includes a variable region domain (abbreviated herein as VH), and three constant region domains (abbreviated herein as CH1, CH2, and CH3). The term VH fragment means a fragment of the heavy chain of a monoclonal antibody that includes all or part of the heavy chain variable region, including CDRs. A VH fragment can further include heavy chain constant region sequences. The number of heavy chain constant region domains will depend on the isotype. The VH domain is at the amino-terminus of the polypeptide, and the CH domains are at the carboxy-terminus, with the CH3 being closest to the COOH end. The isotype of an antibody can be IgM, IgD, IgG, IgA, or IgE and is defined by the heavy chains present of which there are five classifications: mu (), delta (d), gamma (), alpha (), or epsilon () chains, respectively. IgG has several subtypes, including, but not limited to, IgG1, IgG2, IgG3, and IgG4. IgM subtypes include IgM1 and IgM2. IgA subtypes include IgA1 and IgA2.

    [0295] Antibodies can be whole immunoglobulins of any isotype or classification, chimeric antibodies, or hybrid antibodies with specificity to two or more antigens. They may also be fragments (e.g., F(ab)2, Fab, Fab, Fv, and the like), including hybrid fragments. An immunoglobulin also includes natural, synthetic, or genetically engineered proteins that act like an antibody by binding to specific antigens to form a complex. The term antibody includes genetically engineered or otherwise modified forms of immunoglobulins, such as the following:

    [0296] The term monomer means an antibody containing only one Ig unit. Monomers are the basic functional units of antibodies. The term dimer means an antibody containing two Ig units attached to one another via constant domains of the antibody heavy chains (the Fc, or fragment crystallizable, region). The complex may be stabilized by a joining (J) chain protein. The term multimer means an antibody containing more than two Ig units attached to one another via constant domains of the antibody heavy chains (the Fc region). The complex may be stabilized by a joining (J) chain protein.

    [0297] The term bivalent antibody means an antibody that comprises two antigen-binding sites. The two binding sites may have the same antigen specificities or they may be bi-specific, meaning the two antigen-binding sites have different antigen specificities.

    [0298] Bispecific antibodies are a class of antibodies that have two paratopes with different binding sites for two or more distinct epitopes. In some embodiments, bispecific antibodies can be biparatopic, wherein a bispecific antibody may specifically recognize a different epitope from the same antigen. In some embodiments, bispecific antibodies can be constructed from a pair of different single domain antibodies termed nanobodies. Single domain antibodies are sourced and modified from cartilaginous fish and camelids. Nanobodies can be joined together by a linker using techniques typical to a person skilled in the art; such methods for selection and joining of nanobodies are described in PCT Publication No. WO2015044386A1, No. WO2010037838A2, and Bever et al., Anal Chem. 86:7875-7882 (2014), each of which are specifically incorporated herein by reference in their entirety.

    [0299] Bispecific antibodies can be constructed as: a whole IgG, Fab2, FabPEG, a diabody, or alternatively as scFv. Diabodies and scFvs can be constructed without an Fe region, using only variable domains, potentially reducing the effects of anti-idiotypic reaction. Bispecific antibodies may be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab fragments. See, e.g., Songsivilai and Lachmann, Clin. Exp. Immunol. 79:315-321 (1990); Kostelny et al., J. Immunol. 148:1547-1553 (1992), each of which are specifically incorporated by reference in their entirety.

    [0300] In certain aspects, the antigen-binding domain may be multispecific or heterospecific by multimerizing with VH and VL region pairs that bind a different antigen. For example, the antibody may bind to, or interact with, (a) a cell surface antigen, (b) an Fc receptor on the surface of an effector cell, or (c) at least one other component. Accordingly, aspects may include, but are not limited to, bispecific, trispecific, tetraspecific, and other multispecific antibodies or antigen-binding fragments thereof that are directed to epitopes and to other targets, such as Fc receptors on effector cells.

    [0301] In some embodiments, multispecific antibodies can be used and directly linked via a short flexible polypeptide chain, using routine methods known in the art. One such example is diabodies that are bivalent, bispecific antibodies in which the VH and VL domains are expressed on a single polypeptide chain, and utilize a linker that is too short to allow for pairing between domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain creating two antigen binding sites. The linker functionality is applicable for embodiments of triabodies, tetrabodies, and higher order antibody multimers. (see, e.g., Hollinger et al., Proc Natl. Acad. Sci. USA 90:6444-6448 (1993); Polijak et al., Structure 2:1121-1123 (1994); Todorovska et al., J. Immunol. Methods 248:47-66 (2001)).

    [0302] Bispecific diabodies, as opposed to bispecific whole antibodies, may also be advantageous because they can be readily constructed and expressed in E. coli. Diabodies (and other polypeptides such as antibody fragments) of appropriate binding specificities can be readily selected using phage display (WO94/13804) from libraries. If one arm of the diabody is kept constant, for instance, with a specificity directed against a protein, then a library can be made where the other arm is varied and an antibody of appropriate specificity selected. Bispecific whole antibodies may be made by alternative engineering methods as described in Ridgeway et al., (Protein Eng., 9:616-621, 1996) and Krah et al., (N Biotechnol. 39:167-173, 2017), each of which is hereby incorporated by reference in their entirety.

    [0303] Heteroconjugate antibodies are composed of two covalently linked monoclonal antibodies with different specificities. See, e.g., U.S. Pat. No. 6,010,902, incorporated herein by reference in its entirety.

    [0304] The part of the Fv fragment of an antibody molecule that binds with high specificity to the epitope of the antigen is referred to herein as the paratope. The paratope consists of the amino acid residues that make contact with the epitope of an antigen to facilitate antigen recognition. Each of the two Fv fragments of an antibody is composed of the two variable domains, V.sub.H and V.sub.L, in dimerized configuration. The primary structure of each of the variable domains includes three hypervariable loops separated by, and flanked by, Framework Regions (FR). The hypervariable loops are the regions of highest primary sequences variability among the antibody molecules from any mammal. The term hypervariable loop is sometimes used interchangeably with the term Complementarity Determining Region (CDR). The length of the hypervariable loops (or CDRs) varies between antibody molecules. The framework regions of all antibody molecules from a given mammal have high primary sequence similarity/consensus. The consensus of framework regions can be used by one skilled in the art to identify both the framework regions and the hypervariable loops (or CDRs) which are interspersed among the framework regions. The hypervariable loops are given identifying names which distinguish their position within the polypeptide, and on which domain they occur. CDRs in the V.sub.L domain are identified as L1, L2, and L3, with L1 occurring at the most distal end and L3 occurring closest to the C.sub.L domain. The CDRs may also be given the names CDR-1. CDR-2, and CDR-3. The L3 (CDR-3) is generally the region of highest variability among all antibody molecules produced by a given organism. The CDRs are regions of the polypeptide chain arranged linearly in the primary structure, and separated from each other by Framework Regions. The amino terminal (N-terminal) end of the V.sub.L chain is named FR1. The region identified as FR2 occurs between L1 and L2 hypervariable loops. FR3 occurs between L2 and L3 hypervariable loops, and the FR4 region is closest to the C.sub.L domain. This structure and nomenclature is repeated for the V.sub.H chain, which includes three CDRs identified as H1, H2 and H3. The majority of amino acid residues in the variable domains, or Fv fragments (V.sub.H and V.sub.L), are part of the framework regions (approximately 85%). The three dimensional, or tertiary, structure of an antibody molecule is such that the framework regions are more internal to the molecule and provide the majority of the structure, with the CDRs on the external surface of the molecule.

    [0305] Several methods have been developed and can be used by one skilled in the art to identify the exact amino acids that constitute each of these regions. This can be done using any of a number of multiple sequence alignment methods and algorithms, which identify the conserved amino acid residues that make up the framework regions, therefore identifying the CDRs that may vary in length but are located between framework regions. Three commonly used methods have been developed for identification of the CDRs of antibodies: Kabat (as described in T. T. Wu and E. A. Kabat. AN ANALYSIS OF THE SEQUENCES OF THE VARIABLE REGIONS OF BENCE JONES PROTEINS AND MYELOMA LIGHT CHAINS AND THEIR IMPLICATIONS FOR ANTIBODY COMPLEMENTARITY. J Exp Med, vol. 132, no. 2, pp. 211-250, August 1970); Chothia (as described in C. Chothia et al . . . Conformations of immunoglobulin hypervariable regions. Nature, vol. 342, no. 6252, pp. 877-883, December 1989); and IMGT (as described in M.-P. Lefranc et al., IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains. Developmental & Comparative Immunology, vol. 27, no. 1, pp. 55-77, January 2003). These methods each include unique numbering systems for the identification of the amino acid residues that constitute the variable regions. In most antibody molecules, the amino acid residues that actually contact the epitope of the antigen occur in the CDRs, although in some cases, residues within the framework regions contribute to antigen binding.

    [0306] One skilled in the art can use any of several methods to determine the paratope of an antibody. These methods include: 1) Computational predictions of the tertiary structure of the antibody/epitope binding interactions based on the chemical nature of the amino acid sequence of the antibody variable region and composition of the epitope; 2) Hydrogen-deuterium exchange and mass spectroscopy; 3) Polypeptide fragmentation and peptide mapping approaches in which one generates multiple overlapping peptide fragments from the full length of the polypeptide and evaluates the binding affinity of these peptides for the epitope; 4) Antibody Phage Display Library analysis in which the antibody Fab fragment encoding genes of the mammal are expressed by bacteriophage in such a way as to be incorporated into the coat of the phage. This population of Fab expressing phage are then allowed to interact with the antigen which has been immobilized or may be expressed in by a different exogenous expression system. Non-binding Fab fragments are washed away, thereby leaving only the specific binding Fab fragments attached to the antigen. The binding Fab fragments can be readily isolated and the genes which encode them determined. This approach can also be used for smaller regions of the Fab fragment including Fv fragments or specific V.sub.H and V.sub.L domains as appropriate.

    [0307] In certain aspects, affinity matured antibodies are enhanced with one or more modifications in one or more CDRs thereof that result in an improvement in the affinity of the antibody for a target antigen as compared to a parent antibody that does not possess those alteration(s). Certain affinity matured antibodies will have nanomolar or picomolar affinities for the target antigen. Affinity matured antibodies are produced by procedures known in the art, e.g., Marks et al., Bio/Technology 10:779 (1992) describes affinity maturation by VH and VL domain shuffling, random mutagenesis of CDR and/or framework residues employed in phage display is described by Rajpal et al., PNAS. 24:8466-8471 (2005) and Thie et al., Methods Mol Biol. 525:309-22 (2009) in conjugation with computation methods as demonstrated in Tiller et al., Front. Immunol. 8:986 (2017).

    [0308] Chimeric immunoglobulins are the products of fused genes derived from different species; humanized chimeras generally have the framework region (FR) from human immunoglobulins and one or more CDRs are from a non-human source.

    [0309] In certain aspects, portions of the heavy and/or light chain are identical or homologous to corresponding sequences from another particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity. U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA 81:6851 (1984). For methods relating to chimeric antibodies, see, e.g., U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA 81:6851-6855 (1985), each of which are specifically incorporated herein by reference in their entirety. CDR grafting is described, for example, in U.S. Pat. Nos. 6,180,370, 5,693,762, 5,693,761, 5,585,089, and 5,530,101, which are all hereby incorporated by reference for all purposes.

    [0310] In some embodiments, minimizing the antibody polypeptide sequence from the non-human species optimizes chimeric antibody function and reduces immunogenicity. Specific amino acid residues from non-antigen recognizing regions of the non-human antibody are modified to be homologous to corresponding residues in a human antibody or isotype. One example is the CDR-grafted antibody, in which an antibody comprises one or more CDRs from a particular species or belonging to a specific antibody class or subclass, while the remainder of the antibody chain(s) is identical or homologous to a corresponding sequence in antibodies derived from another species or belonging to another antibody class or subclass. For use in humans, the V region composed of CDR1, CDR2, and partial CDR3 for both the light and heavy chain variance region from a non-human immunoglobulin, are grafted with a human antibody framework region, replacing the naturally occurring antigen receptors of the human antibody with the non-human CDRs. In some instances, corresponding non-human residues replace framework region residues of the human immunoglobulin. Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody to further refine performance. The humanized antibody may also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. See, e.g., Jones et al., Nature 321:522 (1986); Riechmann et al., Nature 332:323 (1988); Presta, Curr. Op. Struct. Biol. 2:593 (1992); Vaswani and Hamilton, Ann. Allergy, Asthma and Immunol. 1:105 (1998); Harris, Biochem. Soc. Transactions 23; 1035 (1995); Hurle and Gross, Curr. Op. Biotech. 5:428 (1994); Verhoeyen et al., Science 239:1534-36 (1988).

    [0311] Intrabodies are intracellularly localized immunoglobulins that bind to intracellular antigens as opposed to secreted antibodies, which bind antigens in the extracellular space.

    [0312] Polyclonal antibody preparations typically include different antibodies against different determinants (epitopes). In order to produce polyclonal antibodies, a host, such as a rabbit or goat, is immunized with the antigen or antigen fragment, generally with an adjuvant and, if necessary, coupled to a carrier. Antibodies to the antigen are subsequently collected from the sera of the host. The polyclonal antibody can be affinity purified against the antigen rendering it monospecific.

    [0313] Monoclonal antibodies or mAb refer to an antibody obtained from a population of homogeneous antibodies from an exclusive parental cell, e.g., the population is identical except for naturally occurring mutations that may be present in minor amounts. Each monoclonal antibody is directed against a single antigenic determinant.

    [0314] Certain aspects relate to antibody fragments, such as antibody fragments that bind to PLXDC1 or PLXDC2. The term functional antibody fragment includes antigen-binding fragments of an antibody that retain the ability to specifically bind to an antigen. These fragments are constituted of various arrangements of the variable region heavy chain (VH) and/or light chain (VL); and in some embodiments, include constant region heavy chain 1 (CH1) and light chain (CL). In some embodiments, they lack the Fc region constituted of heavy chain 2 (CH2) and 3 (CH3) domains. Embodiments of antigen binding fragments and the modifications thereof may include: (i) the Fab fragment type constituted with the VL, VH, CL, and CHI domains; (ii) the Fd fragment type constituted with the VH and CH1 domains; (iii) the Fv fragment type constituted with the VH and VL domains; (iv) the single domain fragment type, dAb, (Ward, 1989; McCafferty et al., 1990; Holt et al., 2003) constituted with a single VH or VL domain; (v) isolated complementarity determining region (CDR) regions. Such terms are described, for example, in Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, NY (1989); Molec. Biology and Biotechnology: A Comprehensive Desk Reference (Myers, R. A. (ed.), New York: VCH Publisher, Inc.); Huston et al., Cell Biophysics, 22:189-224 (1993); Pluckthun and Skerra, Meth. Enzymol., 178:497-515 (1989) and in Day, E. D., Advanced Immunochemistry, 2d ed., Wiley-Liss, Inc. New York, N.Y. (1990); Antibodies, 4:259-277 (2015). The citations in this paragraph are all incorporated by reference.

    [0315] Antigen-binding fragments also include fragments of an antibody that retain exactly, at least, or at most 1, 2, or 3 complementarity determining regions (CDRs) from a light chain variable region. Fusions of CDR-containing sequences to an Fe region (or a CH2 or CH3 region thereof) are included within the scope of this definition including, for example, scFv fused, directly or indirectly, to an Fe region are included herein.

    [0316] The term Fab fragment means a monovalent antigen-binding fragment of an antibody containing the VL, VH, CL and CH1 domains. The term Fab fragment means a monovalent antigen-binding fragment of a monoclonal antibody that is larger than a Fab fragment. For example, a Fab fragment includes the VL, VH, CL and CH1 domains and all or part of the hinge region. The term F(ab) 2 fragment means a bivalent antigen-binding fragment of a monoclonal antibody comprising two Fab fragments linked by a disulfide bridge at the hinge region. An F(ab) 2 fragment includes, for example, all or part of the two VH and VL domains, and can further include all or part of the two CL and CHI domains.

    [0317] The term Fd fragment means a fragment of the heavy chain of a monoclonal antibody, which includes all or part of the VH, including the CDRs. An Fd fragment can further include CHI region sequences.

    [0318] The term Fv fragment means a monovalent antigen-binding fragment of a monoclonal antibody, including all or part of the VL and VH, and absent of the CL and CH1 domains. The VL and VH include, for example, the CDRs. Single-chain antibodies (sFv or scFv) are Fv molecules in which the VL and VH regions have been connected by a flexible linker to form a single polypeptide chain, which forms an antigen-binding fragment. Single chain antibodies are discussed in detail in International Patent Application Publication No. WO 88/01649 and U.S. Pat. Nos. 4,946,778 and 5,260,203, the disclosures of which are herein incorporated by reference. The term (scFv) 2 means bivalent or bispecific sFv polypeptide chains that include oligomerization domains at their C-termini, separated from the sFv by a hinge region (Pack et al. 1992). The oligomerization domain comprises self-associating a-helices, e.g., leucine zippers, which can be further stabilized by additional disulfide bonds. (scFv) 2 fragments are also known as miniantibodies or minibodies.

    [0319] A single domain antibody is an antigen-binding fragment containing only a VH or the VL domain. In some instances, two or more VH regions are covalently joined with a peptide linker to create a bivalent domain antibody. The two VH regions of a bivalent domain antibody may target the same or different antigens.

    [0320] An Fc region contains two heavy chain fragments comprising the CH2 and CH3 domains of an antibody. The two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the CH3 domains. The term Fc polypeptide as used herein includes native and mutein forms of polypeptides derived from the Fe region of an antibody. Truncated forms of such polypeptides containing the hinge region that promotes dimerization are included.

    [0321] Antigen-binding peptide scaffolds, such as complementarity-determining regions (CDRs), are used to generate protein-binding molecules in accordance with the embodiments. Generally, a person skilled in the art can determine the type of protein scaffold on which to graft at least one of the CDRs. It is known that scaffolds, optimally, must meet a number of criteria such as: good phylogenetic conservation; known three-dimensional structure; small size; few or no post-transcriptional modifications; and/or be easy to produce, express, and purify. Skerra, J Mol Recognit, 13:167-87 (2000).

    [0322] The protein scaffolds can be sourced from, but not limited to: fibronectin type III FN3 domain (known as monobodies), fibronectin type III domain 10, lipocalin, anticalin, Z-domain of protein A of Staphylococcus aureus, thioredoxin A or proteins with a repeated motif such as the ankyrin repeat, the armadillo repeat, the leucine-rich repeat and the tetratricopeptide repeat. Such proteins are described in US Patent Publication Nos. 2010/0285564, 2006/0058510, 2006/0088908, 2005/0106660, and PCT Publication No. WO2006/056464, each of which are specifically incorporated herein by reference in their entirety. Scaffolds derived from toxins from scorpions, insects, plants, mollusks, etc., and the protein inhibiters of neuronal NO synthase (PIN) may also be used.

    [0323] The term selective binding agent refers to a molecule that binds to an antigen. Non-limiting examples include antibodies, antigen-binding fragments, scFv, Fab, Fab, F(ab)2, single chain antibodies, peptides, peptide fragments and proteins.

    [0324] The term binding refers to a direct association between two molecules, due to, for example, covalent, electrostatic, hydrophobic, and ionic and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges. Immunologically reactive means that the selective binding agent or antibody of interest will bind with antigens present in a biological sample. The term immune complex refers the combination formed when an antibody or selective binding agent binds to an epitope on an antigen.

    [0325] The term affinity refers the strength with which an antibody or selective binding agent binds an epitope. In antibody binding reactions, this is expressed as the affinity constant (Ka or ka sometimes referred to as the association constant) for any given antibody or selective binding agent. Affinity is measured as a comparison of the binding strength of the antibody to its antigen relative to the binding strength of the antibody to an unrelated amino acid sequence. Affinity can be expressed as, for example, 20-fold greater binding ability of the antibody to its antigen then to an unrelated amino acid sequence. As used herein, the term avidity refers to the resistance of a complex of two or more agents to dissociation after dilution. The terms immunoreactive and preferentially binds are used interchangeably herein with respect to antibodies and/or selective binding agent.

    [0326] There are several experimental methods that can be used by one skilled in the art to evaluate the binding affinity of any given antibody or selective binding agent for its antigen. This is generally done by measuring the equilibrium dissociation constant (KD or Kd), using the equation KD=koff/kon=[A][B]/[AB]. The term koff is the rate of dissociation between the antibody and antigen per unit time, and is related to the concentration of antibody and antigen present in solution in the unbound form at equilibrium. The term kon is the rate of antibody and antigen association per unit time, and is related to the concentration of the bound antigen-antibody complex at equilibrium. The units used for measuring the KD are mol/L (molarity, or M), or concentration. The Ka of an antibody is the opposite of the KD, and is determined by the equation Ka=1/KD. Examples of some experimental methods that can be used to determine the KD value are: enzyme-linked immunosorbent assays (ELISA), isothermal titration calorimetry (ITC), fluorescence anisotropy, surface plasmon resonance (SPR), and affinity capillary electrophoresis (ACE). The affinity constant (Ka) of an antibody is the opposite of the KD, and is determined by the equation Ka=1/KD.

    [0327] Antibodies deemed useful in certain embodiments may have an affinity constant (Ka) of about, at least about, or at most about 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, or 10.sup.10 M or any range derivable therein. Similarly, in some embodiments, antibodies may have a dissociation constant of about, at least about or at most about 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10 M, or any range derivable therein. These values are reported for antibodies discussed herein and the same assay may be used to evaluate the binding properties of such antibodies. An antibody of the disclosure is said to specifically bind its target antigen when the dissociation constant (KD) is 10.sup.8 M. The antibody specifically binds antigen with high affinity when the KD is 510.sup.9 M, and with very high affinity when the KD is 510.sup.10 M.

    [0328] The epitope of an antigen is the specific region of the antigen for which an antibody has binding affinity. In the case of protein or polypeptide antigens, the epitope is the specific residues (or specified amino acids or protein segment) that the antibody binds with high affinity. An antibody does not necessarily contact every residue within the protein. Nor does every single amino acid substitution or deletion within a protein necessarily affect binding affinity. For purposes of this specification and the accompanying claims, the terms epitope and antigenic determinant are used interchangeably to refer to the site on an antigen to which B and/or T cells respond or recognize. Polypeptide epitopes can be formed from both contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a polypeptide. An epitope typically includes at least 3, and typically 5-10 amino acids in a unique spatial conformation.

    [0329] Epitope specificity of an antibody can be determined in a variety of ways. One approach, for example, involves testing a collection of overlapping peptides of about 15 amino acids spanning the full sequence of the protein and differing in increments of a small number of amino acids (e.g., 3 to 30 amino acids). The peptides are immobilized in separate wells of a microtiter dish. Immobilization can be accomplished, for example, by biotinylating one terminus of the peptides. This process may affect the antibody affinity for the epitope, therefore different samples of the same peptide can be biotinylated at the N and C terminus and immobilized in separate wells for the purposes of comparison. This is useful for identifying end-specific antibodies. Optionally, additional peptides can be included terminating at a particular amino acid of interest. This approach is useful for identifying end-specific antibodies to internal fragments. An antibody or antigen-binding fragment is screened for binding to each of the various peptides. The epitope is defined as a segment of amino acids that is common to all peptides to which the antibody shows high affinity binding.

    [0330] It is understood that the antibodies of the present disclosure may be modified, such that they are substantially identical to the antibody polypeptide sequences, or fragments thereof, and still bind the epitopes of the present disclosure. Polypeptide sequences are substantially identical when optimally aligned using such programs as Clustal Omega, IGBLAST, GAP or BESTFIT using default gap weights, they share at least 80% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity, or at least 99% sequence identity or any range therein.

    [0331] As discussed herein, minor variations in the amino acid sequences of antibodies or antigen-binding regions thereof are contemplated as being encompassed by the present disclosure, providing that the variations in the amino acid sequence maintain at least 75%, more preferably at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% and most preferably at least 99% sequence identity. In particular, conservative amino acid replacements are contemplated.

    [0332] Conservative replacements are those that take place within a family of amino acids that are related in their side chains. Genetically encoded amino acids are generally divided into families based on the chemical nature of the side chain; e.g., acidic (aspartate, glutamate), basic (lysine, arginine, histidine), nonpolar (alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), and uncharged polar (glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine). For example, it is reasonable to expect that an isolated replacement of a leucine moiety with an isoleucine or valine moiety, or a similar replacement of an amino acid with a structurally related amino acid in the same family, will not have a major effect on the binding or properties of the resulting molecule, especially if the replacement does not involve an amino acid within a framework site. Whether an amino acid change results in a functional peptide can readily be determined by assaying the specific activity of the polypeptide derivative. Standard ELISA, Surface Plasmon Resonance (SPR), or other antibody binding assays can be performed by one skilled in the art to make a quantitative comparison of antigen binging affinity between the unmodified antibody and any polypeptide derivatives with conservative substitutions generated through any of several methods available to one skilled in the art.

    [0333] Fragments or analogs of antibodies or immunoglobulin molecules can be readily prepared by those skilled in the art. Preferred amino- and carboxy-termini of fragments or analogs occur near boundaries of functional domains. Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases. Preferably, computerized comparison methods are used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Standard methods to identify protein sequences that fold into a known three-dimensional structure are available to those skilled in the art; Dill and McCallum, Science 338:1042-1046 (2012). Several algorithms for predicting protein structures and the gene sequences that encode these have been developed, and many of these algorithms can be found at the National Center for Biotechnology Information (on the World Wide Web at ncbi.nlm.nih.gov/guide/proteins/) and at the Bioinformatics Resource Portal (on the World Wide Web at expasy.org/proteomics). Thus, the foregoing examples demonstrate that those of skill in the art can recognize sequence motifs and structural conformations that may be used to define structural and functional domains in accordance with the disclosure.

    [0334] Framework modifications can be made to antibodies to decrease immunogenicity, for example, by backmutating one or more framework residues to a corresponding germline sequence.

    [0335] It is also contemplated that the antigen-binding domain may be multi-specific or multivalent by multimerizing the antigen-binding domain with VH and VL region pairs that bind either the same antigen (multi-valent) or a different antigen (multi-specific).

    [0336] In some aspects, also contemplated are glycosylation variants of antibodies, wherein the number and/or type of glycosylation site(s) has been altered compared to the amino acid sequences of the parent polypeptide. Glycosylation of the polypeptides can be altered, for example, by modifying one or more sites of glycosylation within the polypeptide sequence to increase the affinity of the polypeptide for antigen (U.S. Pat. Nos. 5,714,350 and 6,350,861). In certain embodiments, antibody protein variants comprise a greater or a lesser number of N-linked glycosylation sites than the native antibody. An N-linked glycosylation site is characterized by the sequence: Asn-X-Ser or Asn-X-Thr, wherein the amino acid residue designated as X may be any amino acid residue except proline. The substitution of amino acid residues to create this sequence provides a potential new site for the addition of an N-linked carbohydrate chain. Alternatively, substitutions that eliminate or alter this sequence will prevent addition of an N-linked carbohydrate chain present in the native polypeptide. For example, the glycosylation can be reduced by the deletion of an Asn or by substituting the Asn with a different amino acid. In other embodiments, one or more new N-linked glycosylation sites are created. Antibodies typically have an N-linked glycosylation site in the Fc region.

    [0337] Additional antibody variants include cysteine variants, wherein one or more cysteine residues in the parent or native amino acid sequence are deleted from or substituted with another amino acid (e.g., serine). Cysteine variants are useful, inter alia, when antibodies must be refolded into a biologically active conformation. Cysteine variants may have fewer cysteine residues than the native antibody and typically have an even number to minimize interactions resulting from unpaired cysteines.

    [0338] In some aspects, the polypeptides can be pegylated to increase biological half-life by reacting the polypeptide with polyethylene glycol (PEG) or a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the polypeptide. Polypeptide pegylation may be carried out by an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer). Methods for pegylating proteins are known in the art and can be applied to the polypeptides of the disclosure to obtain PEGylated derivatives of antibodies. See, e.g., EP 0 154 316 and EP 0 401 384. In some aspects, the antibody is conjugated or otherwise linked to transthyretin (TTR) or a TTR variant. The TTR or TTR variant can be chemically modified with, for example, a chemical selected from the group consisting of dextran, poly (n-vinyl pyrrolidone), polyethylene glycols, propropylene glycol homopolymers, polypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols, and polyvinyl alcohols. As used herein, the term polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins.

    [0339] Derivatives of the antibodies and antigen binding fragments that are described herein are also provided. The derivatized antibody or fragment thereof may comprise any molecule or substance that imparts a desired property to the antibody or fragment. The derivatized antibody can comprise, for example, a detectable (or labeling) moiety (e.g., a radioactive, colorimetric, antigenic, or enzymatic molecule, or a detectable bead), a molecule that binds to another molecule (e.g., biotin or streptavidin), a therapeutic or diagnostic moiety (e.g., a radioactive, cytotoxic, or pharmaceutically active moiety), or a molecule that increases the suitability of the antibody for a particular use (e.g., administration to a subject, such as a human subject, or other in vivo or in vitro uses). Optionally, an antibody or an immunological portion of an antibody can be chemically conjugated to, or expressed as, a fusion protein with other proteins. In some aspects, polypeptides may be chemically modified by conjugating or fusing the polypeptide to serum protein, such as human serum albumin, to increase half-life of the resulting molecule. See, e.g., EP 0322094 and EP 0 486 525. In some aspects, the polypeptides may also be conjugated to a therapeutic agent to provide a therapy in combination with the therapeutic effect of the polypeptide.

    [0340] In some aspects, contemplated are immunoconjugates comprising an antibody or antigen-binding fragment thereof conjugated to a cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).

    B. Example Antibodies

    [0341] Example antibodies that are capable of binding to and activating PLXDC1 are disclosed in the experimental examples (e.g., Table 6). In one embodiment, an antibody or antigen binding fragment thereof is provided, which has specificity to the human plexin domain-containing 1 (PLXDC1) protein. In some embodiments, the antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) and a light chain variable region (VL), the VH comprises a VH complementarity-determining region (CDR) CDR1, a VH CDR2, a VH CDR3, the VL comprises a VL CDR1, a VL CDR2, and a VL CDR3. In some embodiments, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of an antibody selected from Table 6.

    [0342] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 1-A1. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 1-A5. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 1-H10. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 2-B4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 2-B5. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 2-F7. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 2-F8.

    [0343] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 2-G4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 2-H2. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 2-H9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-A7. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-A9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-B3. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 3-C.sub.4.

    [0344] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-C.sub.6. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-C.sub.8. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-C.sub.9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-C.sub.11. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-C.sub.12. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-D3. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 3-D6.

    [0345] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-D7. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-D12. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-E2. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-E5. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-E7. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-E8. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-E9.

    [0346] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-F5. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-F6. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-F12. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-G4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-G5. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-G6. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-G7.

    [0347] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-G8. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-H1. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 3-H4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 4-A7. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 4-A8. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 4-B1. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 4-B2.

    [0348] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 4-B11. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 4-D12. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 4-F4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 4-G12. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 5-C.sub.9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 5-E2. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 5-E12.

    [0349] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 6-G4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 6-H5. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-A2. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-A4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-A6. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-A7. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 8-A8.

    [0350] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-A9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-C.sub.4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-C.sub.6. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-C.sub.9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-C.sub.10. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-C.sub.11. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-D11.

    [0351] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-D4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-D7. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-E2. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-E3. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-E9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-F1. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 8-F2.

    [0352] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-F4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-F6. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-F11. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-G12. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-H7. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 9-A6. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 9-B3.

    [0353] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 9-B10. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 9-C.sub.2. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 9-D8. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 9-E4. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 9-E5. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 9-G1. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 9-G3.

    [0354] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 9-H9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 2-C.sub.8. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 8-D9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 10-A9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 10-B2. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 10-B5. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 10-C.sub.1.

    [0355] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 10-C.sub.3. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 10-C.sub.9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 10-C.sub.11. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 10-D7. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 10-E1. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 10-E6. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 10-E7.

    [0356] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 10-F11. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1. VL CDR2, and VL CDR3 are those of antibody 10-F12. In one embodiment, the VH CDR1, VH CDR2. VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 10-G5. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 11-B6. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 11-D8. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 11-D10. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 11-D11.

    [0357] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 11-G2. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 11-G5. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 11-G9. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 11-H8. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 are those of antibody 11-H11.

    [0358] Example CDR sequences (Kabat) from these antibodies are shown in Table 7. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 248, 341, 435, 497, and 517, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:225, 249, 342, 436, 498, and 518, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 226, 250, 343, 437, 499, and 519, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:227, 251, 344, 438, 500, and 520, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:228, 252, 345, 439, 501, and 521, respectively.

    [0359] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 253, 346, 440, 501, and 522, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 254, 347, 441, 500, and 523, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:230, 255, 348, 442, 502, and 524, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:231, 256, 349, 443, 500, and 525, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 232, 257, 350, 444, 500, and 526, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:227, 258, 351, 445, 500, and 527, respectively.

    [0360] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 259, 352, 446, 502, and 528, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 260, 353, 445, 500, and 523, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 261, 354, 447, 500, and 529, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:232, 262, 355, 448, 503, and 530, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 229, 263, 356, 449, 500, and 531, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 264, 357, 450, 500, and 532, respectively.

    [0361] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 265, 358, 451, 504, and 523, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 266, 359, 448, 500, and 533, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 267, 360, 452, 502, and 534, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:233, 268, 361, 439, 501, and 535, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 226, 269, 362, 453, 502, and 536, respectively.

    [0362] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:234, 270, 363, 454, 502, and 537, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 271, 364, 444, 500, and 538, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 272, 365, 455, 502, and 539, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 273, 366, 456, 501, and 540, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 229, 274, 367, 457, 501, and 541, respectively.

    [0363] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 275, 368, 444, 503, and 542, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:234, 270, 363, 446, 502, and 543, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 276, 369, 458, 502, and 544, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 277, 370, 454, 502, and 545, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 232, 278, 371, 459, 500, and 531, respectively.

    [0364] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 279, 372, 460, 504, and 531, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:231, 280, 373, 444, 505, and 546, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:235, 281, 374, 461, 501, and 547, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 282, 375, 462, 500, and 523, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 226, 283, 376, 463, 506, and 548, respectively.

    [0365] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 284, 377, 464, 501, and 549, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:236, 285, 378, 435, 507, and 550, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 286, 379, 465, 508, and 551, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 287, 380, 435, 509, and 552, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 237, 288, 381, 466, 509, and 553, respectively.

    [0366] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:238, 289, 382, 467, 510, and 554, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 290, 376, 435, 511, and 555, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:239, 291, 383, 435, 508, and 556, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 292, 384, 468, 512, and 557, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 240, 293, 385, 469, 502, and 558, respectively.

    [0367] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:231, 294, 386, 445, 500, and 559, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 295, 387, 470, 501, and 560, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 296, 388, 435, 498, and 561, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 297, 389, 435, 498, and 562, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 241, 298, 390, 454, 513, and 563, respectively.

    [0368] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 299, 376, 459, 505, and 564, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 300, 391, 445, 500, and 565, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 301, 392, 471, 501, and 566, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 302, 393, 472, 500, and 567, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 226, 303, 394, 473, 500, and 523, respectively.

    [0369] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 304, 395, 462, 500, and 523, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 305, 396, 444, 500, and 568, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 306, 397, 474, 505, and 569, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 307, 398, 463, 500, and 570, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 224, 308, 399, 472, 503, and 531, respectively.

    [0370] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:242, 309, 400, 442, 514, and 571, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 310, 376, 475, 500, and 530, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 311, 401, 476, 513, and 572, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:243, 312, 402, 477, 515, and 573, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 226, 313, 403, 478, 516, and 535, respectively.

    [0371] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 314, 404, 479, 513, and 574, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 315, 405, 439, 516, and 575, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 303, 394, 473, 500, and 523, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:234, 316, 406, 438, 500, and 523, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 224, 317, 407, 439, 516, and 576, respectively.

    [0372] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:244, 318, 408, 458, 514, and 577, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:234, 270, 363, 446, 502, and 543, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 304, 395, 462, 500, and 523, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 300, 391, 445, 500, and 565, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 231, 280, 373, 438, 500, and 578, respectively.

    [0373] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 319, 409, 439, 516, and 579, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 317, 407, 439, 516, and 576, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:245, 320, 410, 480, 516, and 580, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 317, 407, 439, 516, and 576, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 242, 321, 411, 481, 500, and 581, respectively.

    [0374] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 322, 412, 482, 503, and 582, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 323, 413, 474, 500, and 583, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 324, 414, 445, 505, and 584, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 325, 415, 450, 500, and 585, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 243, 312, 416, 477, 515, and 573, respectively.

    [0375] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 325, 415, 450, 503, and 585, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 300, 417, 445, 500, and 565, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 326, 418, 483, 500, and 531, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 327, 419, 484, 500, and 529, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 226, 279, 420, 485, 500, and 531, respectively.

    [0376] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 304, 421, 486, 500, and 523, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 328, 422, 470, 501, and 586, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 329, 376, 484, 500, and 548, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 300, 417, 445, 500, and 565, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 224, 330, 423, 487, 505, and 587, respectively.

    [0377] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 279, 424, 438, 500, and 588, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:246, 331, 425, 488, 501, and 589, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 332, 426, 489, 516, and 566, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 333, 427, 490, 501, and 590, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 247, 334, 428, 491, 516, and 535, respectively.

    [0378] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 335, 429, 492, 500, and 567, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:224, 336, 430, 493, 502, and 591, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:232, 337, 431, 494, 500, and 592, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:241, 298, 390, 454, 513, and 563, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO: 226, 338, 432, 495, 502, and 593, respectively.

    [0379] In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:229, 339, 433, 496, 503, and 529, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 340, 434, 438, 500, and 548, respectively. In one embodiment, the VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3 comprise the amino acid sequences of SEQ ID NO:226, 269, 362, 454, 502, and 594, respectively.

    [0380] In some embodiments, the antibody or antigen binding fragment thereof includes a VH and VL of any of the antibody of Table 6. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:4 and 5, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:6 and 7, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:8 and 9, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:10 and 11, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 12 and 13, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 14 and 15, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 16 and 17, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 18 and 19, respectively.

    [0381] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:20 and 21, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:22 and 23, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:24 and 25, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 26 and 27, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 28 and 29, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:30 and 31, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:32 and 33, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:34 and 35, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:36 and 37, respectively.

    [0382] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:38 and 39, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:40 and 41, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:42 and 43, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 44 and 45, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 46 and 47, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:48 and 49, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:50 and 51, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:52 and 53, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:54 and 55, respectively.

    [0383] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:56 and 57, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:58 and 59, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:60 and 61, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 62 and 63, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 64 and 65, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:66 and 67, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:68 and 69, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:70 and 71, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:72 and 73, respectively.

    [0384] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:74 and 75, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:76 and 77, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:78 and 79, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 80 and 81, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 82 and 83, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:84 and 85, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:86 and 87, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:88 and 89, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:90 and 91, respectively.

    [0385] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:92 and 93, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:94 and 95, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:96 and 97, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 98 and 99, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 100 and 101, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 102 and 103, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 104 and 105, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 106 and 107, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 108 and 109, respectively.

    [0386] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:110 and 111, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 112 and 113, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:114 and 115, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:116 and 117, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:118 and 119, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 120 and 121, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 122 and 123, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:124 and 125, respectively.

    [0387] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 126 and 127, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 128 and 129, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:130 and 131, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 132 and 133, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 134 and 135, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 136 and 137, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 138 and 139, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 140 and 141, respectively.

    [0388] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:142 and 143, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 144 and 145, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:146 and 147, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:148 and 149, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 150 and 151, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 152 and 153, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 154 and 155, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 156 and 157, respectively.

    [0389] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:158 and 159, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 160 and 161, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:162 and 163, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 164 and 165, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 166 and 167, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 168 and 169, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 170 and 171, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:172 and 173, respectively.

    [0390] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:174 and 175, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 176 and 177, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:178 and 179, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 180 and 181, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 182 and 183, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 184 and 185, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 186 and 187, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 188 and 189, respectively.

    [0391] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:190 and 191, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 192 and 193, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:194 and 195, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 196 and 197, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 198 and 199, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:200 and 201, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:202 and 203, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:204 and 205, respectively.

    [0392] In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:206 and 207, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO: 208 and 209, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:210 and 211, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:212 and 213, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:214 and 215, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:216 and 217, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:218 and 219, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:220 and 221, respectively. In one embodiment, the VH and the VL have the amino acid sequences of SEQ ID NO:222 and 223, respectively.

    [0393] In some embodiments, the VH CDR1 comprises an amino acid sequence of one of SEQ ID NOS: 224-247, the VH CDR2 comprises an amino acid sequence of one of SEQ ID NOS: 248-340, the VH CDR3 comprises an amino acid sequence of one of SEQ ID NOS: 341-362, the VL CDR1 comprises an amino acid sequence of one of SEQ ID NOS: 435-496, the VL CDR2 comprises an amino acid sequence of one of SEQ ID NOS: 497-516, and the VL CDR3 comprises an amino acid sequence of one of SEQ ID NOS: 517-594.

    [0394] In some embodiments, the antibody may comprise a CDR that is at least 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identical (or any range derivable therein) in sequence to SEQ ID NOS: 224-594.

    [0395] In certain aspects, a polypeptide can comprise 1, 2, and/or 3 CDRs from the variable heavy chain or variable light chain of SEQ ID NOS: 4-223. The CDR may be one that has been determined by Kabat, IMGT, or Chothia. In further embodiments, a polypeptide may have CDRs that have 1, 2, and/or 3 amino acid changes (addition of 1 or 2 amino acids, deletions or 1 or 2 amino acids or substitution) with respect to these 1, 2, or 3 CDRs. In further embodiments, an antibody may be alternatively or additionally humanized in regions outside the CDR(s) and/or variable region(s). In some aspects, a polypeptide comprises additionally or alternatively, an amino acid sequence that is at least 60, 65, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100% identical or homologous to the amino acid sequence of the variable region that is not a CDR sequence, i.e., the variable region framework.

    [0396] From amino to carboxy terminus the CDRs are CDR1, CDR2, and CDR3. In some embodiments, a polypeptide may have CDRs that have 1, 2, and/or 3 amino acid changes (addition of 1 or 2 amino acids, deletions or 1 or 2 amino acids or substitution) with respect to CDR1, CDR2, or CDR3. In some embodiments, the CDRs of SEQ ID NOS: 4-223 may further comprise 1, 2, 3, 4, 5, or 6 additional amino acids at the amino or carboxy terminus of the CDR; in some embodiments, the CDRs of SEQ ID NOS: 4-223 may exclude 1, 2, 3, 4, 5, or 6 amino acids at the amino or carboxy terminus of the CDR. The additional amino acids may be from the heavy and/or light chain framework regions of SEQ ID NOS: 4-223, that are shown as immediately adjacent to the CDRs. Accordingly, embodiments relate to antibodies comprising an HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and/or LCDR3 with at least or at most or exactly 1, 2, 3, 4, 5, 6 or 7 amino acids at the amino end of the CDR or at the carboxy end of the CDR, wherein the additional amino acids are the 1, 2, 3, 4, 5, 6, or 7 amino acids of SEQ ID NOS: 4-223 that are shown as immediately adjacent to the CDRs. Other embodiments relate to antibodies comprising one or more CDRs, wherein the CDR is a fragment of SEQ ID NO:224-594 and wherein the fragment lacks 1, 2, 3, 4, or 5 amino acids from the amino or carboxy end of the CDR. In some embodiments, the CDR may lack one, 2, 3, 4, 5, 6, or 7 amino acids from the carboxy end and may further comprise 1, 2, 3, 4, 5, 6, 7, or 8 amino acids from the framework region of the amino end of the CDR. In some embodiments, the CDR may lack one, 2, 3, 4, 5, 6, or 7 amino acids from the amino end and may further comprise 1, 2, 3, 4, 5, 6, 7, or 8 amino acids from the framework region of the carboxy end of the CDR. In further embodiments, an antibody may be alternatively or additionally humanized in regions outside the CDR(s) and/or variable region(s). In some aspects, a polypeptide comprises additionally or alternatively, an amino acid sequence that is at least 60, 65, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100% identical or homologous to the amino acid sequence of the variable region that is not a CDR sequence, i.e., the variable region framework.

    [0397] In other embodiments, a polypeptide or protein comprises 1, 2, 3, 4, 5, and/or 6 CDRs from the either or both of the light and heavy variable regions of SEQ ID NOS: 4-223, and 1, 2, 3, 4, 5, and/or 6 CDRs may have 1, 2, and/or 3 amino acid changes with respect to these CDRs. In some embodiments, parts or all of the antibody sequence outside the variable region have been humanized. A protein may comprise one or more polypeptides. In some aspects, a protein may contain one or two polypeptides similar to a heavy chain polypeptide and/or 1 or 2 polypeptides similar to a light chain polypeptide.

    [0398] In some embodiments, the antibody or antigen binding fragment comprises, comprises at least, or comprises at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 substitutions (or any derivable range therein) at amino acid position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, or 130 (or any range derivable therein) of the VH, VL, or CDR region identified in Tables 6, Table 7, the VH and VL region of SEQ ID NOS: 4-223, or the CDR of SEQ ID NOS: 224-594. In some embodiments, the amino acid at position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, or 130 of the VH, VL, or CDR region identified in Tables 6, Table 7, the VH and VL region of SEQ ID NOS: 4-223, or the CDR of SEQ ID NOS: 224-594 is substituted with an alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, or valine.

    [0399] In some embodiments, the amino acid at position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, or 130 of the VH, VL, or CDR region identified in Tables 6, Table 7, the VH and VL region of SEQ ID NOS: 4-223, or the CDR of SEQ ID NOS: 224-594 is substituted with a conservative amino acid.

    [0400] In some embodiments, the amino acid at position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, or 130 of the VH, VL, or CDR region identified in Tables 6, Table 7, the VH and VL region of SEQ ID NOS: 4-223, or the CDR of SEQ ID NOS: 224-594 is substituted with a non-conservative amino acid.

    [0401] In some embodiments, the antibody or antigen binding fragment may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, or 150 (or any derivable range therein) of any of SEQ ID NOS: 4-594.

    [0402] In some embodiments, the antibody or antigen binding fragment may comprise at least, at most, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, or 150, (or any derivable range therein) contiguous amino acids of any of SEQ ID NOS: 4-594 that are at least, at most, or about 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% (or any derivable range therein) similar, identical, or homologous with any of SEQ ID NOS: 4-594.

    [0403] In some aspects there is a polypeptide, such as an antibody or antigen binding fragment starting at position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, or 130 of any of SEQ ID NOS: 4-594 and comprising at least, at most, or about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, or 130 (or any derivable range therein) contiguous amino acids or nucleotides of any of SEQ ID NOS: 4-594.

    [0404] Amino acid sequence variants of the disclosure can be substitutional, insertional, or deletion variants. In some embodiments, a variation in a polypeptide of the disclosure affects or affects at least or affects at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more non-contiguous or contiguous amino acids of the protein or polypeptide, as compared to a particular sequence, such as any of sequences disclosed herein. A variant can comprise an amino acid sequence that is at least 50%, 60%, 70%, 80%, or 90%, including all values and ranges there between, identical to any sequence provided or referenced herein. A variant can include 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more substitute amino acids.

    [0405] It also will be understood that amino acid and nucleic acid sequences may include additional residues, such as additional N- or C-terminal amino acids, or 5 or 3 sequences, respectively, and yet still be essentially identical as set forth in one of the sequences disclosed herein, so long as the sequence meets the criteria set forth above, including the maintenance of biological protein activity where protein expression is concerned. The addition of terminal sequences particularly applies to nucleic acid sequences that may, for example, include various non-coding sequences flanking either of the 5 or 3 portions of the coding region.

    [0406] Deletion variants typically lack one or more residues of the reference protein. Individual residues can be deleted or a number of contiguous amino acids can be deleted. A stop codon may be introduced (by substitution or insertion) into an encoding nucleic acid sequence to generate a truncated protein.

    [0407] Insertional mutants typically involve the addition of amino acid residues at a non-terminal point in the polypeptide. This may include the insertion of one or more amino acid residues. Terminal additions may also be generated and can include fusion proteins which are multimers or concatemers of one or more peptides or polypeptides described or referenced herein.

    [0408] Substitutional variants typically contain the exchange of one amino acid for another at one or more sites within the protein or polypeptide, and may be designed to modulate one or more properties of the polypeptide, with or without the loss of other functions or properties. Substitutions may be conservative, that is, one amino acid is replaced with one of similar chemical properties. Conservative amino acid substitutions may involve exchange of a member of one amino acid class with another member of the same class. Conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine. Conservative amino acid substitutions may encompass non-naturally occurring amino acid residues, which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include peptidomimetics or other reversed or inverted forms of amino acid moieties.

    [0409] Alternatively, substitutions may be non-conservative, such that a function or activity of the polypeptide is affected. Non-conservative changes typically involve substituting an amino acid residue with one that is chemically dissimilar, such as a polar or charged amino acid for a nonpolar or uncharged amino acid, and vice versa. Non-conservative substitutions may involve the exchange of a member of one of the amino acid classes for a member from another class.

    [0410] One skilled in the art can determine suitable variants of polypeptides as set forth herein using well-known techniques. One skilled in the art may identify suitable areas of the molecule that may be changed without destroying activity by targeting regions not believed to be important for activity. The skilled artisan will also be able to identify amino acid residues and portions of the molecules that are conserved among similar proteins or polypeptides. In further embodiments, areas that may be important for biological activity or for structure may be subject to conservative amino acid substitutions without significantly altering the biological activity or without adversely affecting the protein or polypeptide structure.

    [0411] In making such changes, the hydropathy index of amino acids may be considered. The hydropathy profile of a protein is calculated by assigning each amino acid a numerical value (hydropathy index) and then repetitively averaging these values along the peptide chain. Each amino acid has been assigned a value based on its hydrophobicity and charge characteristics. They are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cysteine (+2.5); methionine (+1.9); alanine (+1.8); glycine (0.4); threonine (0.7); serine (0.8); tryptophan (0.9); tyrosine (1.3); proline (1.6); histidine (3.2); glutamate (3.5); glutamine (3.5); aspartate (3.5); asparagine (3.5); lysine (3.9); and arginine (4.5). The importance of the hydropathy amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte et al., J. Mol. Biol. 157:105-131 (1982)). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein or polypeptide, which in turn defines the interaction of the protein or polypeptide with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and others. It is also known that certain amino acids may be substituted for other amino acids having a similar hydropathy index or score, and still retain a similar biological activity. In making changes based upon the hydropathy index, in certain embodiments, the substitution of amino acids whose hydropathy indices are within +2 is included. In some aspects of the invention, those that are within +1 are included, and in other aspects of the invention, those within +0.5 are included.

    [0412] It also is understood in the art that the substitution of like amino acids can be effectively made based on hydrophilicity. U.S. Pat. No. 4,554,101, incorporated herein by reference, states that the greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with a biological property of the protein. In certain embodiments, the greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with its immunogenicity and antigen binding, that is, as a biological property of the protein. The following hydrophilicity values have been assigned to these amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.01); glutamate (+3.01); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (0.4); proline (0.51); alanine (0.5); histidine (0.5); cysteine (1.0); methionine (1.3); valine (1.5); leucine (1.8); isoleucine (1.8); tyrosine (2.3); phenylalanine (2.5); and tryptophan (3.4). In making changes based upon similar hydrophilicity values, in certain embodiments, the substitution of amino acids whose hydrophilicity values are within 2 are included, in other embodiments, those which are within 1 are included, and in still other embodiments, those within 0.5 are included. In some instances, one may also identify epitopes from primary amino acid sequences based on hydrophilicity. These regions are also referred to as epitopic core regions. It is understood that an amino acid can be substituted for another having a similar hydrophilicity value and still produce a biologically equivalent and immunologically equivalent protein.

    [0413] Additionally, one skilled in the art can review structure-function studies identifying residues in similar polypeptides or proteins that are important for activity or structure. In view of such a comparison, one can predict the importance of amino acid residues in a protein that correspond to amino acid residues important for activity or structure in similar proteins. One skilled in the art may opt for chemically similar amino acid substitutions for such predicted important amino acid residues.

    [0414] One skilled in the art can also analyze the three-dimensional structure and amino acid sequence in relation to that structure in similar proteins or polypeptides. In view of such information, one skilled in the art may predict the alignment of amino acid residues of an antibody with respect to its three-dimensional structure. One skilled in the art may choose not to make changes to amino acid residues predicted to be on the surface of the protein, since such residues may be involved in important interactions with other molecules. Moreover, one skilled in the art may generate test variants containing a single amino acid substitution at each desired amino acid residue. These variants can then be screened using standard assays for binding and/or activity, thus yielding information gathered from such routine experiments, which may allow one skilled in the art to determine the amino acid positions where further substitutions should be avoided either alone or in combination with other mutations. Various tools available to determine secondary structure can be found on the world wide web at expasy.org/proteomics/protein_structure.

    [0415] In some embodiments of the invention, amino acid substitutions are made that: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter ligand or antigen binding affinities, and/or (5) confer or modify other physicochemical or functional properties on such polypeptides. For example, single or multiple amino acid substitutions (in certain embodiments, conservative amino acid substitutions) may be made in the naturally occurring sequence. Substitutions can be made in that portion of the antibody that lies outside the domain(s) forming intermolecular contacts. In such embodiments, conservative amino acid substitutions can be used that do not substantially change the structural characteristics of the protein or polypeptide (e.g., one or more replacement amino acids that do not disrupt the secondary structure that characterizes the native antibody).

    C. Methods of Identifying Activating Antibodies

    [0416] The present disclosure further provides methods and agents useful for identify activating antibodies and fragments. As demonstrated in the experimental examples, an activating antibody or fragment is able to preferentially bind to a PLXDC1 or PLXDC2 protein in the presence of an activator, such as a small molecule compound of the present disclosure. The activator is contemplated to dissociate the homooligomer and make the PLXDC1 or PLXDC2 protein more accessible to the antibody. Once bound to the PLXDC1 or PLXDC2 protein, the antibody is able to keep the protein in the active (monomer) state.

    [0417] In one embodiment, therefore, provided is a method for identifying an activator of a PLXDC protein, comprising contacting a candidate molecule with the PLXDC protein in the presence of a reference PLXDC activator, and detecting the binding affinity between the candidate molecule and the PLXDC protein, thereby identifying the candidate molecule as a PLXDC activator when the detected binding affinity is greater than a reference binding affinity between the candidate molecule and the PLXDC protein in the absence of the reference PLXDC activator. In some embodiments, the reference activator is a small molecule compound, such as those in Table 3. In some embodiments, the candidate molecule is an antibody, such as one from an antibody library.

    V. Nucleic Acids

    [0418] Also provided herein are nucleic acid or polynucleotide molecules that encode the PLXDC1 and/or PLXDC2 receptors, antibodies, antigen binding fragments thereof and/or polypeptides that bind to PLXDC1 and/or PLXDC2 described herein. For example, the polynucleotide may encode an PLXDC1 and/or PLXDC2 protein or fragment thereof. The nucleic acids may be present, for example, in whole cells, in a cell lysate, or in a partially purified or substantially pure form.

    [0419] In certain embodiments, nucleic acid sequences can exist in a variety of instances such as: isolated segments and recombinant vectors of incorporated sequences or recombinant polynucleotides encoding one or both chains of an antibody, or a fragment, derivative, mutein, or variant thereof, polynucleotides sufficient for use as hybridization probes, PCR primers or sequencing primers for identifying, analyzing, mutating or amplifying a polynucleotide encoding a polypeptide, anti-sense nucleic acids for inhibiting expression of a polynucleotide, and complementary sequences of the foregoing described herein. Nucleic acids that encode the epitope to which certain of the antibodies provided herein are also provided. Nucleic acids encoding fusion proteins that include these peptides are also provided. The nucleic acids can be single-stranded or double-stranded and can comprise RNA and/or DNA nucleotides and artificial variants thereof (e.g., peptide nucleic acids).

    [0420] The term polynucleotide refers to a nucleic acid molecule that either is recombinant or has been isolated from total genomic nucleic acid. Included within the term polynucleotide are oligonucleotides (nucleic acids 100 residues or less in length), recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like. Polynucleotides include, in certain aspects, regulatory sequences, isolated substantially away from their naturally occurring genes or protein encoding sequences. Polynucleotides may be single-stranded (coding or antisense) or double-stranded, and may be RNA, DNA (genomic, cDNA or synthetic), analogs thereof, or a combination thereof. Additional coding or non-coding sequences may, but need not, be present within a polynucleotide.

    [0421] In this respect, the term gene. polynucleotide, or nucleic acid is used to refer to a nucleic acid that encodes a protein, polypeptide, or peptide (including any sequences required for proper transcription, post-translational modification, or localization). As will be understood by those in the art, this term encompasses genomic sequences, expression cassettes, cDNA sequences, and smaller engineered nucleic acid segments that express, or may be adapted to express, proteins, polypeptides, domains, peptides, fusion proteins, and mutants. A nucleic acid encoding all or part of a polypeptide may contain a contiguous nucleic acid sequence encoding all or a portion of such a polypeptide. It also is contemplated that a particular polypeptide may be encoded by nucleic acids containing variations having slightly different nucleic acid sequences but, nonetheless, encode the same or substantially similar protein.

    [0422] In certain embodiments, there are polynucleotide variants having substantial identity to the sequences disclosed herein; those comprising at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or higher sequence identity, including all values and ranges there between, compared to a polynucleotide sequence provided herein using the methods described herein (e.g., BLAST analysis using standard parameters). In certain aspects, the isolated polynucleotide will comprise a nucleotide sequence encoding a polypeptide that has at least 90%, preferably 95% and above, identity to an amino acid sequence described herein, over the entire length of the sequence; or a nucleotide sequence complementary to said isolated polynucleotide.

    [0423] The nucleic acid segments, regardless of the length of the coding sequence itself, may be combined with other nucleic acid sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably. The nucleic acids can be any length. They can be, for example, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 175, 200, 250, 300, 350, 400, 450, 500, 750, 1000, 1500, 3000, 5000 or more nucleotides in length, and/or can comprise one or more additional sequences, for example, regulatory sequences, and/or be a part of a larger nucleic acid, for example, a vector. It is therefore contemplated that a nucleic acid fragment of almost any length may be employed, with the total length preferably being limited by the case of preparation and use in the intended recombinant nucleic acid protocol. In some cases, a nucleic acid sequence may encode a polypeptide sequence with additional heterologous coding sequences, for example to allow for purification of the polypeptide, transport, secretion, post-translational modification, or for therapeutic benefits such as targeting or efficacy. As discussed above, a tag or other heterologous polypeptide may be added to the modified polypeptide-encoding sequence, wherein heterologous refers to a polypeptide that is not the same as the modified polypeptide.

    A. Hybridization

    [0424] The nucleic acids that hybridize to other nucleic acids under particular hybridization conditions. Methods for hybridizing nucleic acids are well known in the art. See, e.g., Current Protocols in Molecular Biology, John Wiley and Sons, N.Y. (1989), 6.3.1-6.3.6. As defined herein, a moderately stringent hybridization condition uses a prewashing solution containing 5 sodium chloride/sodium citrate (SSC), 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization buffer of about 50% formamide, 6SSC, and a hybridization temperature of 55 C. (or other similar hybridization solutions, such as one containing about 50% formamide, with a hybridization temperature of 42 C.), and washing conditions of 60 C. in 0.5SSC, 0.1% SDS. A stringent hybridization condition hybridizes in 6SSC at 45 C., followed by one or more washes in 0.1SSC, 0.2% SDS at 68 C. Furthermore, one of skill in the art can manipulate the hybridization and/or washing conditions to increase or decrease the stringency of hybridization such that nucleic acids comprising nucleotide sequence that are at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to each other typically remain hybridized to each other.

    [0425] The parameters affecting the choice of hybridization conditions and guidance for devising suitable conditions are set forth by, for example, Sambrook, Fritsch, and Maniatis (Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., chapters 9 and 11 (1989); Current Protocols in Molecular Biology, Ausubel et al., eds., John Wiley and Sons, Inc., sections 2.10 and 6.3-6.4 (1995), both of which are herein incorporated by reference in their entirety for all purposes) and can be readily determined by those having ordinary skill in the art based on, for example, the length and/or base composition of the DNA.

    B. Mutation

    [0426] Changes can be introduced by mutation into a nucleic acid, thereby leading to changes in the amino acid sequence of a polypeptide (e.g., an antibody or antibody derivative) that it encodes. Mutations can be introduced using any technique known in the art. In one embodiment, one or more particular amino acid residues are changed using, for example, a site-directed mutagenesis protocol. In another embodiment, one or more randomly selected residues are changed using, for example, a random mutagenesis protocol. However it is made, a mutant polypeptide can be expressed and screened for a desired property.

    [0427] Mutations can be introduced into a nucleic acid without significantly altering the biological activity of a polypeptide that it encodes. For example, one can make nucleotide substitutions leading to amino acid substitutions at non-essential amino acid residues. Alternatively, one or more mutations can be introduced into a nucleic acid that selectively changes the biological activity of a polypeptide that it encodes. See, eg., Romain Studer et al., Biochem. J. 449:581-594 (2013). For example, the mutation can quantitatively or qualitatively change the biological activity. Examples of quantitative changes include increasing, reducing or eliminating the activity. Examples of qualitative changes include altering the antigen specificity of an antibody.

    C. Probes

    [0428] In another aspect, nucleic acid molecules are suitable for use as primers or hybridization probes for the detection of nucleic acid sequences. A nucleic acid molecule can comprise only a portion of a nucleic acid sequence encoding a full-length polypeptide, for example, a fragment that can be used as a probe or primer or a fragment encoding an active portion of a given polypeptide.

    [0429] In another embodiment, the nucleic acid molecules may be used as probes or PCR primers for specific antibody sequences. For instance, a nucleic acid molecule probe may be used in diagnostic methods or a nucleic acid molecule PCR primer may be used to amplify regions of DNA that could be used, inter alia, to isolate nucleic acid sequences for use in producing variable domains of antibodies. See, eg., Gaily Kivi et al., BMC Biotechnol. 16:2 (2016). In a preferred embodiment, the nucleic acid molecules are oligonucleotides. In a more preferred embodiment, the oligonucleotides are from highly variable regions of the heavy and light chains of the antibody of interest. In an even more preferred embodiment, the oligonucleotides encode all or part of one or more of the CDRs.

    [0430] Probes based on the desired sequence of a nucleic acid can be used to detect the nucleic acid or similar nucleic acids, for example, transcripts encoding a polypeptide of interest. The probe can comprise a label group, e.g., a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used to identify a cell that expresses the polypeptide.

    VI. Antibody Production

    A. Antibody Production

    [0431] Methods for preparing and characterizing antibodies for use in diagnostic and detection assays, for purification, and for use as therapeutics are well known in the art as disclosed in, for example, U.S. Pat. Nos. 4,011,308; 4,722,890; 4,016,043; 3,876,504; 3,770,380; and 4,372,745 (see, e.g., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, 1988; incorporated herein by reference). These antibodies may be polyclonal or monoclonal antibody preparations, monospecific antisera, human antibodies, hybrid or chimeric antibodies, such as humanized antibodies, altered antibodies, F(ab) 2 fragments, Fab fragments, Fv fragments, single-domain antibodies, dimeric or trimeric antibody fragment constructs, minibodies, or functional fragments thereof which bind to the antigen in question. In certain aspects, polypeptides, peptides, and proteins and immunogenic fragments thereof for use in various embodiments can also be synthesized in solution or on a solid support in accordance with conventional techniques. See, for example, Stewart and Young, (1984); Tarn et al. (1983); Merrifield. (1986); and Barany and Merrifield (1979), each incorporated herein by reference.

    [0432] Briefly, a polyclonal antibody is prepared by immunizing an animal with an antigen or a portion thereof and collecting antisera from that immunized animal. The antigen may be altered compared to an antigen sequence found in nature. In some embodiments, a variant or altered antigenic peptide or polypeptide is employed to generate antibodies. Inocula are typically prepared by dispersing the antigenic composition in a physiologically tolerable diluent to form an aqueous composition. Antisera is subsequently collected by methods known in the arts, and the serum may be used as-is for various applications or else the desired antibody fraction may be purified by well-known methods, such as affinity chromatography (Harlow and Lane, Antibodies: A Laboratory Manual 1988).

    [0433] Methods of making monoclonal antibodies are also well known in the art (Kohler and Milstein, 1975; Harlow and Lane, 1988, U.S. Pat. No. 4,196,265, herein incorporated by reference in its entirety for all purposes). Typically, this technique involves immunizing a suitable animal with a selected immunogenic composition, e.g., a purified or partially purified protein, polypeptide, peptide or domain. Resulting antibody-producing B-cells from the immunized animal, or all dissociated splenocytes, are then induced to fuse with cells from an immortalized cell line to form hybridomas. Myeloma cell lines suited for use in hybridoma-producing fusion procedures preferably are non-antibody-producing and have high fusion efficiency and enzyme deficiencies that render then incapable of growing in certain selective media that support the growth of only the desired fused cells (hybridomas). Typically, the fusion partner includes a property that allows selection of the resulting hybridomas using specific media. For example, fusion partners can be hypoxanthine/aminopterin/thymidine (HAT)-sensitive. Methods for generating hybrids of antibody-producing spleen or lymph node cells and myeloma cells usually comprise mixing somatic cells with myeloma cells in the presence of an agent or agents (chemical or electrical) that promote the fusion of cell membranes. Next, selection of hybridomas can be performed by culturing the cells by single-clone dilution in microtiter plates, followed by testing the individual clonal supernatants (after about two to three weeks) for the desired reactivity. Fusion procedures for making hybridomas, immunization protocols, and techniques for isolation of immunized splenocytes for fusion are known in the art.

    [0434] Other techniques for producing monoclonal antibodies include the viral or oncogenic transformation of B-lymphocytes, a molecular cloning approach may be used to generate a nucleic acid or polypeptide, the selected lymphocyte antibody method (SLAM) (see, e.g., Babcook et al., Proc. Natl. Acad. Sci. USA 93:7843-7848 (1996), the preparation of combinatorial immunoglobulin phagemid libraries from RNA isolated from the spleen of the immunized animal and selection of phagemids expressing appropriate antibodies, or producing a cell expressing an antibody from a genomic sequence of the cell comprising a modified immunoglobulin locus using Cre-mediated site-specific recombination (see, e.g., U.S. Pat. No. 6,091,001).

    [0435] Monoclonal antibodies may be further purified using filtration, centrifugation, and various chromatographic methods such as HPLC or affinity chromatography. Monoclonal antibodies may be further screened or optimized for properties relating to specificity, avidity, half-life, immunogenicity, binding association, binding disassociation, or overall functional properties relative to being a treatment for infection. Thus, monoclonal antibodies may have alterations in the amino acid sequence of CDRs, including insertions, deletions, or substitutions with a conserved or non-conserved amino acid.

    [0436] The immunogenicity of a particular immunogen composition can be enhanced by the use of non-specific stimulators of the immune response, known as adjuvants. Adjuvants that may be used in accordance with embodiments include, but are not limited to, IL-1, IL-2, IL-4, IL-7, IL-12,-interferon, GMCSP, BCG, aluminum hydroxide, MDP compounds, such as thur-MDP and nor-MDP, CGP (MTP-PE), lipid A, and monophosphoryl lipid A (MPL). Exemplary adjuvants may include complete Freund's adjuvant (a non-specific stimulator of the immune response containing killed Mycobacterium tuberculosis), incomplete Freund's adjuvants, and/or aluminum hydroxide adjuvant. In addition to adjuvants, it may be desirable to co-administer biologic response modifiers (BRM), such as but not limited to, Cimetidine (CIM; 1200 mg/d) (Smith/Kline, PA); low-dose Cyclophosphamide (CYP; 300 mg/m.sup.2) (Johnson/Mead, NJ), cytokines such as -interferon, IL-2, or IL-12, or genes encoding proteins involved in immune helper functions, such as B-7. A phage-display system can be used to expand antibody molecule populations in vitro. Saiki, et al., Nature 324:163 (1986); Scharf et al., Science 233:1076 (1986); U.S. Pat. Nos. 4,683,195 and 4,683,202; Yang et al., J Mol Biol. 254:392 (1995); Barbas, III et al., Methods: Comp. Meth Enzymol. (1995) 8:94; Barbas, III et al., Proc Natl Acad Sci USA 88:7978 (1991).

    B. Fully Human Antibody Production

    [0437] Methods are available for making fully human antibodies. Using fully human antibodies can minimize the immunogenic and allergic responses that may be caused by administering non-human monoclonal antibodies to humans as therapeutic agents. In one embodiment, human antibodies may be produced in a non-human transgenic animal, e.g., a transgenic mouse capable of producing multiple isotypes of human antibodies to protein (e.g., IgG, IgA, and/or IgE) by undergoing V-D-J recombination and isotype switching. Accordingly, this aspect applies to antibodies, antibody fragments, and pharmaceutical compositions thereof, but also non-human transgenic animals, B-cells, host cells, and hybridomas that produce monoclonal antibodies. Applications of humanized antibodies include, but are not limited to, detect a cell expressing an anticipated protein, either in vivo or in vitro, pharmaceutical preparations containing the antibodies of the present disclosure, and methods of treating disorders by administering the antibodies.

    [0438] Fully human antibodies can be produced by immunizing transgenic animals (usually mice) that are capable of producing a repertoire of human antibodies in the absence of endogenous immunoglobulin production. Antigens for this purpose typically have six or more contiguous amino acids, and optionally are conjugated to a carrier, such as a hapten. See, for example, Jakobovits et al., Proc. Natl. Acad. Sci. USA 90:2551-2555 (1993); Jakobovits et al., Nature 362:255-258 (1993); Bruggermann et al., Year in Immunol. 7:33 (1993). In one example, transgenic animals are produced by incapacitating the endogenous mouse immunoglobulin loci encoding the mouse heavy and light immunoglobulin chains therein, and inserting into the mouse genome large fragments of human genome DNA containing loci that encode human heavy and light chain proteins. Partially modified animals, which have less than the full complement of human immunoglobulin loci, are then crossbred to obtain an animal having all of the desired immune system modifications. When administered an immunogen, these transgenic animals produce antibodies that are immunospecific for the immunogen but have human rather than murine amino acid sequences, including the variable regions. For further details of such methods, see, for example, International Patent Application Publication Nos. WO 96/33735 and WO 94/02602, which are hereby incorporated by reference in their entirety. Additional methods relating to transgenic mice for making human antibodies are described in U.S. Pat. Nos. 5,545,807; 6,713,610; 6,673,986; 6,162,963; 6,300,129; 6,255,458; 5,877,397; 5,874,299 and 5,545,806; in International Patent Application Publication Nos. WO 91/10741 and WO 90/04036; and in European Patent Nos. EP 546073B1 and EP 546073A1, all of which are hereby incorporated by reference in their entirety for all purposes.

    [0439] The transgenic mice described above, referred to herein as HuMAb mice, contain a human immunoglobulin gene minilocus that encodes unrearranged human heavy ( and ?) and ? light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous and ? chain loci (Lonberg et al., Nature 368:856-859 (1994)). Accordingly, the mice exhibit reduced expression of mouse IgM or ? chains and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgG? monoclonal antibodies (Lonberg et al., supra; Lonberg and Huszar, Intern. Ref. Immunol. 13:65-93 (1995); Harding and Lonberg, Ann. N.Y. Acad. Sci. 764:536-546 (1995)). The preparation of HuMAb mice is described in detail in Taylor et al., Nucl. Acids Res. 20:6287-6295 (1992); Chen et al., Int. Immunol. 5:647-656 (1993); Tuaillon et al., J. Immunol. 152:2912-2920 (1994); Lonberg et al., supra; Lonberg, Handbook of Exp. Pharmacol. 113:49-101 (1994); Taylor et al., Int. Immunol. 6:579-591 (1994); Lonberg and Huszar, Intern. Ref. Immunol. 13:65-93 (1995); Harding and Lonberg, Ann. N. Y. Acad. Sci. 764:536-546 (1995); Fishwild et al., Nat. Biotechnol. 14:845-851 (1996); the foregoing references are herein incorporated by reference in their entirety for all purposes. See further, U.S. Pat. Nos. 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,789,650; 5,877,397; 5,661,016; 5,814,318; 5,874,299; 5,770,429; and 5,545,807; as well as International Patent Application Publication Nos. WO 93/1227; WO 92/22646; and WO 92/03918, the disclosures of all of which are hereby incorporated by reference in their entirety for all purposes. Technologies utilized for producing human antibodies in these transgenic mice are disclosed also in WO 98/24893, and Mendez et al., Nat. Genetics 15:146-156 (1997), which are herein incorporated by reference. For example, the HCo7 and HCo12 transgenic mice strains can be used to generate human antibodies.

    [0440] Using hybridoma technology, antigen-specific humanized monoclonal antibodies with the desired specificity can be produced and selected from the transgenic mice such as those described above. Such antibodies may be cloned and expressed using a suitable vector and host cell, or the antibodies can be harvested from cultured hybridoma cells. Fully human antibodies can also be derived from phage-display libraries (as disclosed in Hoogenboom et al., J. Mol. Biol. 227:381 (1991); and Marks et al., J. Mol. Biol. 222:581 (1991)). One such technique is described in International Patent Application Publication No. WO 99/10494 (herein incorporated by reference), which describes the isolation of high affinity and functional agonistic antibodies for MPL- and msk-receptors using such an approach.

    C. Antibody Fragments Production

    [0441] Antibody fragments that retain the ability to recognize the antigen of interest will also find use herein. A number of antibody fragments are known in the art that comprise antigen-binding sites capable of exhibiting immunological binding properties of an intact antibody molecule and can be subsequently modified by methods known in the arts. Functional fragments, including only the variable regions of the heavy and light chains, can also be produced using standard techniques such as recombinant production or preferential proteolytic cleavage of immunoglobulin molecules. These fragments are known as Fv. Sec, e.g., Inbar et al., Proc. Nat. Acad. Sci. USA 69:2659-2662 (1972); Hochman et al., Biochem. 15:2706-2710 (1976); and Ehrlich et al., Biochem. 19:4091-4096 (1980).

    [0442] Single-chain variable fragments (scFvs) may be prepared by fusing DNA encoding a peptide linker between DNAs encoding the two variable domain polypeptides (VL and VH). scFvs can form antigen-binding monomers, or they can form multimers (e.g., dimers, trimers, or tetramers), depending on the length of a flexible linker between the two variable domains (Kortt et al., Prot. Eng. 10:423 (1997); Kort et al., Biomol. Eng. 18:95-108 (2001)). By combining different VL- and VH-comprising polypeptides, one can form multimeric scFvs that bind to different epitopes (Kriangkum et al., Biomol. Eng. 18:31-40 (2001)). Antigen-binding fragments are typically produced by recombinant DNA methods known to those skilled in the art. Although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined using recombinant methods by a synthetic linker that enables them to be made as a single chain polypeptide (known as single chain Fv (sFv or scFv); see e.g., Bird et al., Science 242:423-426 (1988); and Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883 (1988). Design criteria include determining the appropriate length to span the distance between the C-terminus of one chain and the N-terminus of the other, wherein the linker is generally formed from small hydrophilic amino acid residues that do not tend to coil or form secondary structures. Suitable linkers generally comprise polypeptide chains of alternating sets of glycine and serine residues, and may include glutamic acid and lysine residues inserted to enhance solubility. Antigen-binding fragments are screened for utility in the same manner as intact antibodies. Such fragments include those obtained by amino-terminal and/or carboxy-terminal deletions, where the remaining amino acid sequence is substantially identical to the corresponding positions in the naturally occurring sequence deduced, for example, from a full-length cDNA sequence.

    [0443] Antibodies may also be generated using peptide analogs of the epitopic determinants disclosed herein, which may consist of non-peptide compounds having properties analogous to those of the template peptide. These types of non-peptide compound are termed peptide mimetics or peptidomimetics. Fauchere, J. Adv. Drug Res. 15:29 (1986); Veber and Freidinger TINS p. 392 (1985); and Evans et al., J. Med. Chem. 30:1229 (1987). Liu et al. (2003) also describe antibody like binding peptidomimetics (ABiPs), which are peptides that act as pared-down antibodies and have certain advantages of longer serum half-life as well as less cumbersome synthesis methods. These analogs can be peptides, non-peptides or combinations of peptide and non-peptide regions. Fauchere, Adv. Drug Res. 15:29 (1986); Veber and Freidiner, TINS p. 392 (1985); and Evans et al., J. Med. Chem. 30:1229 (1987), which are incorporated herein by reference in their entirety for any purpose. Peptide mimetics that are structurally similar to therapeutically useful peptides may be used to produce a similar therapeutic or prophylactic effect. Such compounds are often developed with the aid of computerized molecular modeling. Generally, peptidomimetics of the disclosure are proteins that are structurally similar to an antibody displaying a desired biological activity, such as the ability to bind a protein, but have one or more peptide linkages optionally replaced by a linkage selected from: CH2NH, CH2S, CH2-CH2-, CHCH (cis and trans), COCH2-, CH(OH) CH2-, and CH2SO by methods well known in the art. Systematic substitution of one or more amino acids of a consensus sequence with a D-amino acid of the same type (e.g., D-lysine in place of L-lysine) may be used in certain embodiments of the disclosure to generate more stable proteins. In addition, constrained peptides comprising a consensus sequence or a substantially identical consensus sequence variation may be generated by methods known in the art (Rizo and Gierasch, Ann. Rev. Biochem. 61:387 (1992), incorporated herein by reference), for example, by adding internal cysteine residues capable of forming intramolecular disulfide bridges which cyclize the peptide.

    [0444] Once generated, a phage display library can be used to improve the immunological binding affinity of the Fab molecules using known techniques. See, e.g., Figini et al., J. Mol. Biol. 239:68 (1994). The coding sequences for the heavy and light chain portions of the Fab molecules selected from the phage display library can be isolated or synthesized and cloned into any suitable vector or replicon for expression. Any suitable expression system can be used.

    VII. Obtaining Encoded Antibodies and Polypeptides

    [0445] In some aspects, there are nucleic acid molecule encoding antibody polypeptides (e.g., heavy or light chain, variable domain only, or full-length) or other peptides of the disclosure. These may be generated by methods known in the art, e.g., isolated from B cells of mice that have been immunized and isolated, phage display, expressed in any suitable recombinant expression system and allowed to assemble to form antibody molecules.

    A. Expression

    [0446] The nucleic acid molecules may be used to express large quantities of recombinant antibodies or to produce chimeric antibodies, single chain antibodies, immunoadhesins, diabodies, mutated antibodies, and other antibody derivatives. If the nucleic acid molecules are derived from a non-human, non-transgenic animal, the nucleic acid molecules may be used for antibody humanization.

    B. Vectors

    [0447] In some aspects, contemplated are expression vectors comprising a nucleic acid molecule encoding a polypeptide of the desired sequence or a portion thereof (e.g., a fragment containing one or more CDRs or one or more variable region domains). Expression vectors comprising the nucleic acid molecules may encode the heavy chain, light chain, or the antigen-binding portion thereof. In some aspects, expression vectors comprising nucleic acid molecules may encode fusion proteins, modified antibodies, antibody fragments, and probes thereof. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well.

    [0448] To express the antibodies, or antigen-binding fragments thereof, DNAs encoding partial or full-length light and heavy chains are inserted into expression vectors such that the gene area is operatively linked to transcriptional and translational control sequences. In some aspects, a vector that encodes a functionally complete human CH or CL immunoglobulin sequence with appropriate restriction sites engineered so that any VH or VL sequence can be easily inserted and expressed. Typically, expression vectors used in any of the host cells contain sequences for plasmid or virus maintenance and for cloning and expression of exogenous nucleotide sequences. Such sequences, collectively referred to as flanking sequences typically include one or more of the following operatively linked nucleotide sequences: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a sequence encoding a leader sequence for polypeptide secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element. Such sequences and methods of using the same are well known in the art.

    1. Expression Systems

    [0449] Numerous expression systems exist that comprise at least a part or all of the expression vectors discussed above. Prokaryote- and/or eukaryote-based systems can be employed for use with an embodiment to produce nucleic acid sequences, or their cognate polypeptides, proteins and peptides. Commercially and widely available systems include in but are not limited to bacterial, mammalian, yeast, and insect cell systems. Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed. Those skilled in the art are able to express a vector to produce a nucleic acid sequence or its cognate polypeptide, protein, or peptide using an appropriate expression system.

    2. Methods of Gene Transfer

    [0450] Suitable methods for nucleic acid delivery to effect expression of compositions are anticipated to include virtually any method by which a nucleic acid (e.g., DNA, including viral and nonviral vectors) can be introduced into a cell, a tissue or an organism, as described herein or as would be known to one of ordinary skill in the art. Such methods include, but are not limited to, direct delivery of DNA such as by injection (U.S. Pat. No. 5,994,624, 5,981,274, 5,945,100, 5,780,448, 5,736,524, 5,702,932, 5,656,610, 5,589,466 and 5,580,859, each incorporated herein by reference), including microinjection (Harland and Weintraub, 1985; U.S. Pat. No. 5,789,215, incorporated herein by reference); by electroporation (U.S. Pat. No. 5,384,253, incorporated herein by reference); by calcium phosphate precipitation (Graham and Van Der Eb, 1973; Chen and Okayama, 1987; Rippe et al., 1990); by using DEAE dextran followed by polyethylene glycol (Gopal, 1985); by direct sonic loading (Fechheimer et al., 1987); by liposome mediated transfection (Nicolau and Sene, 1982; Fraley et al., 1979; Nicolau et al., 1987; Wong et al., 1980; Kaneda et al., 1989; Kato et al., 1991); by microprojectile bombardment (PCT Application Nos. WO 94/09699 and 95/06128; U.S. Pat. Nos. 5,610,042; 5,322,783, 5,563,055, 5,550,318, 5,538,877 and 5,538,880, and each incorporated herein by reference); by agitation with silicon carbide fibers (Kaeppler et al., 1990; U.S. Pat. Nos. 5,302,523 and 5,464,765, each incorporated herein by reference); by Agrobacterium mediated transformation (U.S. Pat. Nos. 5,591,616 and 5,563,055, each incorporated herein by reference); or by PEG mediated transformation of protoplasts (Omirulleh et al., 1993; U.S. Pat. Nos. 4,684,611 and 4,952,500, each incorporated herein by reference); by desiccation/inhibition mediated DNA uptake (Potrykus et al., 1985). Other methods include viral transduction, such as gene transfer by lentiviral or retroviral transduction.

    3. Host Cells

    [0451] In another aspect, contemplated are the use of host cells into which a recombinant expression vector has been introduced. Antibodies can be expressed in a variety of cell types. An expression construct encoding an antibody can be transfected into cells according to a variety of methods known in the art. Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells. In certain aspects, the antibody expression construct can be placed under control of a promoter that is linked to T-cell activation, such as one that is controlled by NFAT-1, which is atranscription factor that can be activated upon T-cell activation. Control of antibody expression allows T cells, such as tumor-targeting T cells, to sense their surroundings and perform real-time modulation of cytokine signaling, both in the T cells themselves and in surrounding endogenous immune cells. One of skill in the art would understand the conditions under which to incubate host cells to maintain them and to permit replication of a vector. Also understood and known are techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.

    [0452] For stable transfection of mammalian cells, it is known, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a selectable marker (e.g., for resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die), among other methods known in the arts.

    C. Isolation

    [0453] The nucleic acid molecule encoding either or both of the entire heavy and light chains of an antibody or the variable regions thereof may be obtained from any source that produces antibodies. Methods of isolating mRNA encoding an antibody are well known in the art. See e.g., Sambrook et al., supra. The sequences of human heavy and light chain constant region genes are also known in the art. See, e.g., Kabat et al., 1991, supra. Nucleic acid molecules encoding the full-length heavy and/or light chains may then be expressed in a cell into which they have been introduced and the antibody isolated.

    VIII. Assay Methods

    [0454] The present disclosure also provides methods for screening for and confirming therapeutic agents suitable for use in the present technology.

    [0455] The instant inventors have developed ex vivo primary tumor angiogenesis assays to study the effects of therapeutic agents on tumor angiogenesis. The assays utilize an ex vivo primary tumor model generated from a tumor block dissected from a primary tumor tissue. The dissected tumor block, which may conform to preferred dimensions suitable for ex vivo growth, is embedded in a biological matrix, e.g., within hours, days, or weeks after removal from the organism, and cultured under conditions that promote growth of endothelial cells from the tumor block. Endothelial cells grow out of the tumor block and form a 2-dimensionl or 3-dimensional outgrowth surrounding the tumor block, providing a suitable model system for drug testing. When treated with a candidate cancer therapeutic agent, death of the endothelial cells can effectively indicate the potential therapeutic efficacy of the agent on the tumor endothelial cells. In the same assay, the death of the tumor cells can be evaluated simultaneously to assess whether the reagent is specific to tumor endothelial cells or more generally cytotoxic.

    [0456] Experimental examples of this ex vivo primary tumor angiogenesis model are provided in Example 1. Additional examples are described in U.S. Provisional Patent Application No. 62/809,857, filed on Feb. 25, 2019, the content of which is incorporated to the present disclosure by reference.

    [0457] In certain aspects, provided herein are methods (e.g., in-vitro methods) of determining whether a test agent is a modulator of PLXDC1 and/or PLXDC2 (e.g., to select the agent as a potential therapeutic agent for the treatment of cancer), first by forming a test mixture comprising a test agent (e.g., a polynucleotide, a small molecule, an antibody or a peptide), incubating the test mixture with cells expressing PLXDC1 and/or PLXDC2 receptors and determining the level NF-B activation. In some embodiments, the level of NF-B activation may be determined, for example, by a cell culture based luciferase assay for receptor activation compared to a control mixture lacking the test agent. In some embodiments, a test agent that increases or triggers NF-B activation compared to the NF-B activation in a control mixture is a modulator of PLXDC1 and/or PLXDC2 receptor activity. In some embodiments, the test agent is an antibody, a peptide, a small molecule or a polynucleotide. In some embodiments, the test agent and/or the PLXDC1 and/or PLXDC2 receptor is linked to a detectable moiety. In some embodiments, the PLXDC1 and/or PLXDC2 receptor is ectopically expressed. In some embodiments, the control mixture is substantially identical to the test mixture except that the control mixture does not comprise a test agent. In some embodiments, the control mixture is substantially identical to the test mixture except that the control mixture comprises a placebo.

    [0458] An activator of PLXDC1 and/or PLXDC2 described herein may be identified using an assay (e.g., an assay for screening candidates or test compounds which modulate PLXDC1 and/or PLXDC2). In some embodiments, an activator maybe identified using an assay and a library of test agents, wherein a test agent is an activator if the activator enriches a population of PLXDC1 and/or PLXDC2 receptors or increases the activity of PLXDC1 and/or PLXDC2 receptors on a tumor blood vessel. For example, the assay systems used to identify compounds that modulate (i.e., increase) the activity of PLXDC1 and/or PLXDC2 receptors may involve preparing a test mixture containing test agents under conditions and for a time sufficient to allow the test agents to modulate the PLXDC1 and/or PLXDC2 receptor. In order to test an agent for modulatory activity, the reaction mixture is prepared in the presence and absence of the test compound. The test compound can be initially included in the reaction mixture, or subsequently added at a later time. Control mixtures are incubated without the test compound or with a placebo. The increase in intracellular signaling pathways associated with PLXDC1 and/or PLXDC2 may be then be evaluated. An increase of intracellular signaling pathways associated with PLXDC1 and/or PLXDC2 in the test mixture, but less or no such change in the control mixture indicates the test compound is an activator of a PLXDC1 and/or PLXDC2 receptor. The assay for compounds that modulate PLXDC1 and/or PLXDC2 activity may be conducted with isolated test agent or pooled test agents. Pooled test agents comprise a test mixture with one or more test agents. The order of addition of test agents may be varied.

    [0459] In some embodiments, the test agent is a member of a library of test agents. In some embodiments, assays used to identify agents useful in the methods include a reaction between PLXDC1 and/or PLXDC2 receptors and one or more assay components. The other components may be either a test compound (e.g. the agent), or a combination of test compounds. Agents identified via such assays, may be useful, for example, for preventing or treating cancer, or other PLXDC1 and/or PLXDC2 associated diseases. In some aspects, provided herein are methods of treating or preventing cancer in a subject comprising administering to the subject the test agent identified using the methods of identifying modulators of PLXDC1 and/or PLXDC2.

    [0460] In some embodiments, the test agent (e.g. a polypeptide, a polynucleotide, a RNA molecule, or a small molecule) or PLXDC1 and/or PLXDC2 receptor is linked to a detectable moiety. As used herein, a detectable moiety may comprise a test agent or PLXDC1 and/or PLXDC2 receptor of the present disclosure linked to a distinct polypeptide or moiety to which it is not linked in nature. For example, the detectable moiety can be fused to the N-terminus or C-terminus of the test agent either directly, through a peptide bond, or indirectly through a chemical linker.

    [0461] Agents useful in the methods of the present disclosure may be obtained from any available source, including systematic libraries of natural and/or synthetic compounds. Agents may also be obtained by any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; peptoid libraries (libraries of molecules having the functionalities of peptides, but with a novel, non-peptide backbone which are resistant to enzymatic degradation but which nevertheless remain bioactive; see, e.g., Zuckermann et al., 1994, J. Med. Chem. 37:2678-85); spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the one-bead one-compound library method; and synthetic library methods using affinity chromatography selection. The biological library and peptoid library approaches are limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds (Lam, 1997, Anticancer Drug Des. 12:145).

    [0462] Examples of methods for the synthesis of molecular libraries can be found in the art, for example in: DeWitt et al. (1993) Proc. Natl. Acad. Sci. U.S.A. 90:6909; Erb et al. (1994) Proc. Natl. Acad. Sci. USA 91:11422; Zuckermann et al. (1994). J. Med. Chem. 37:2678; Cho et al. (1993) Science 261:1303; Carrell et al. (1994) Angew. Chem. Int. Ed. Engl. 33:2059; Carell et al. (1994) Angew. Chem. Int. Ed. Engl. 33:2061; and in Gallop et al. (1994) J. Med. Chem. 37:1233.

    [0463] Libraries of agents may be presented in solution (e.g., Houghten, 1992, Biotechniques 13:412-421), or on beads (Lam, 1991, Nature 354:82-84), chips (Fodor, 1993, Nature 364:555-556), bacteria and/or spores, (Ladner, U.S. Pat. No. 5,223,409), plasmids (Cull et al, 1992, Proc Natl Acad Sci USA 89:1865-1869) or on phage (Scott and Smith, 1990, Science 249:386-390; Devlin, 1990, Science 249:404-406; Cwirla et al, 1990, Proc. Natl. Acad. Sci. 87:6378-6382; Felici, 1991, J. Mol. Biol. 222:301-310; Ladner, supra.).

    [0464] Agents useful in the methods of the present disclosure may be identified, for example, using assays for screening candidate or test compounds which modulate the activity of PLXDC1 and/or PLXDC2 receptors. For example, candidate or test compounds can be screened for the ability to alter NF-B signaling in a population of cells expressing PLXDC1 and/or PLXDC2. In some embodiments, the PLXDC1 and/or PLXDC2 are endogenously expressed. In some embodiments, the PLXDC1 and/or PLXDC2 are ectopically expressed. As described herein, the test compound is in a test mixture.

    [0465] The basic principle of the assay systems used to identify compounds that modulate the activity of PLXDC1 and/or PLXDC2 receptors involves preparing a test mixture containing test agents under conditions and for a time sufficient to allow the test agents to modulate the PLXDC1 and/or PLXDC2 receptor. In order to test an agent for modulatory activity, the reaction mixture is prepared in the presence and absence of the test compound. The test compound can be initially included in the reaction mixture, or subsequently added at a later time. Control mixtures are incubated without the test compound or with a placebo. The NF-B signaling may then tested. A change in NF-B signaling, such as an increase in signaling, in the test mixture, but less or no such change in the control mixture indicates the test compound is a modulator of an PLXDC1 and/or PLXDC2 receptor. The assay for compounds that modulate PLXDC1 and/or PLXDC2 may be conducted with isolated test agent or pooled test agents. Pooled test agents comprise a test mixture with one or more test agents. The order of addition of test agents may be varied. Mixtures of chemicals or agents are added at consistent or varied concentration. Cells are then analyzed for fluorescence corresponding to NF-B signaling.

    IX. Additional Therapies

    A. Immunotherapy

    [0466] In some embodiments, the methods comprise administration of a cancer immunotherapy. Cancer immunotherapy (sometimes called immuno-oncology, abbreviated IO) is the use of the immune system to treat cancer. Immunotherapies can be categorized as active, passive or hybrid (active and passive). These approaches exploit the fact that cancer cells often have molecules on their surface that can be detected by the immune system, known as tumour-associated antigens (TAAs); they are often proteins or other macromolecules (e.g. carbohydrates). Active immunotherapy directs the immune system to attack tumor cells by targeting TAAs. Passive immunotherapies enhance existing anti-tumor responses and include the use of monoclonal antibodies, lymphocytes and cytokines. Immumotherapies are known in the art, and some are described below.

    1. Inhibition of Co-Stimulatory Molecules

    [0467] In some embodiments, the immunotherapy comprises an inhibitor of a co-stimulatory molecule. In some embodiments, the inhibitor comprises an inhibitor of B7-1 (CD80), B7-2 (CD86), CD28, ICOS, OX40 (TNFRSF4), 4-1BB (CD137; TNFRSF9), CD40L (CD40LG), GITR (TNFRSF18), and combinations thereof. Inhibitors include inhibitory antibodies, polypeptides, compounds, and nucleic acids.

    2. Dendritic Cell Therapy

    [0468] Dendritic cell therapy provokes anti-tumor responses by causing dendritic cells to present tumor antigens to lymphocytes, which activates them, priming them to kill other cells that present the antigen. Dendritic cells are antigen presenting cells (APCs) in the mammalian immune system. In cancer treatment they aid cancer antigen targeting. One example of cellular cancer therapy based on dendritic cells is sipuleucel-T.

    [0469] One method of inducing dendritic cells to present tumor antigens is by vaccination with autologous tumor lysates or short peptides (small parts of protein that correspond to the protein antigens on cancer cells). These peptides are often given in combination with adjuvants (highly immunogenic substances) to increase the immune and anti-tumor responses. Other adjuvants include proteins or other chemicals that attract and/or activate dendritic cells, such as granulocyte macrophage colony-stimulating factor (GM-CSF).

    [0470] Dendritic cells can also be activated in vivo by making tumor cells express GM-CSF. This can be achieved by either genetically engineering tumor cells to produce GM-CSF or by infecting tumor cells with an oncolytic virus that expresses GM-CSF.

    [0471] Another strategy is to remove dendritic cells from the blood of a patient and activate them outside the body. The dendritic cells are activated in the presence of tumor antigens, which may be a single tumor-specific peptide/protein or a tumor cell lysate (a solution of broken down tumor cells). These cells (with optional adjuvants) are infused and provoke an immune response.

    [0472] Dendritic cell therapies include the use of antibodies that bind to receptors on the surface of dendritic cells. Antigens can be added to the antibody and can induce the dendritic cells to mature and provide immunity to the tumor. Dendritic cell receptors such as TLR3, TLR7, TLR8 or CD40 have been used as antibody targets.

    3. CAR-T Cell Therapy

    [0473] Chimeric antigen receptors (CARs, also known as chimeric immunoreceptors, chimeric T cell receptors or artificial T cell receptors) are engineered receptors that combine a new specificity with an immune cell to target cancer cells. Typically, these receptors graft the specificity of a monoclonal antibody onto a T cell. The receptors are called chimeric because they are fused of parts from different sources. CAR-T cell therapy refers to a treatment that uses such transformed cells for cancer therapy.

    [0474] The basic principle of CAR-T cell design involves recombinant receptors that combine antigen-binding and T-cell activating functions. The general premise of CAR-T cells is to artificially generate T-cells targeted to markers found on cancer cells. Scientists can remove T-cells from a person, genetically alter them, and put them back into the patient for them to attack the cancer cells. Once the T cell has been engineered to become a CAR-T cell, it acts as a living drug. CAR-T cells create a link between an extracellular ligand recognition domain to an intracellular signalling molecule which in turn activates T cells. The extracellular ligand recognition domain is usually a single-chain variable fragment (scFv). An important aspect of the safety of CAR-T cell therapy is how to ensure that only cancerous tumor cells are targeted, and not normal cells. The specificity of CAR-T cells is determined by the choice of molecule that is targeted.

    [0475] Exemplary CAR-T therapies include Tisagenlecleucel (Kymriah) and Axicabtagene ciloleucel (Yescarta). In some embodiments, the CAR-T therapy targets CD19.

    Cytokine Therapy

    [0476] Cytokines are proteins produced by many types of cells present within a tumor. They can modulate immune responses. The tumor often employs them to allow it to grow and reduce the immune response. These immune-modulating effects allow them to be used as drugs to provoke an immune response. Two commonly used cytokines are interferons and interleukins.

    [0477] Interferons are produced by the immune system. They are usually involved in anti-viral response, but also have use for cancer. They fall in three groups: type I (IFN and IFN), type II (IFN) and type III (IFN).

    [0478] Interleukins have an array of immune system effects. IL-2 is an exemplary interleukin cytokine therapy.

    4. Adoptive T-Cell Therapy

    [0479] Adoptive T cell therapy is a form of passive immunization by the transfusion of T-cells (adoptive cell transfer). They are found in blood and tissue and usually activate when they find foreign pathogens. Specifically they activate when the T-cell's surface receptors encounter cells that display parts of foreign proteins on their surface antigens. These can be either infected cells, or antigen presenting cells (APCs). They are found in normal tissue and in tumor tissue, where they are known as tumor infiltrating lymphocytes (TILs). They are activated by the presence of APCs such as dendritic cells that present tumor antigens. Although these cells can attack the tumor, the environment within the tumor is highly immunosuppressive, preventing immune-mediated tumour death. [60]

    [0480] Multiple ways of producing and obtaining tumour targeted T-cells have been developed. T-cells specific to a tumor antigen can be removed from a tumor sample (TILs) or filtered from blood. Subsequent activation and culturing is performed ex vivo, with the results reinfused. Activation can take place through gene therapy, or by exposing the T cells to tumor antigens.

    B. Chemotherapies

    [0481] In some embodiments, the additional therapy comprises a chemotherapy. Suitable classes of chemotherapeutic agents include (a) Alkylating Agents, such as nitrogen mustards (e.g., mechlorethamine, cylophosphamide, ifosfamide, melphalan, chlorambucil), ethylenimines and methylmelamines (e.g., hexamethylmelamine, thiotepa), alkyl sulfonates (e.g., busulfan), nitrosoureas (e.g., carmustine, lomustine, chlorozoticin, streptozocin) and triazines (e.g., dicarbazine), (b) Antimetabolites, such as folic acid analogs (e.g., methotrexate), pyrimidine analogs (e.g., 5-fluorouracil, floxuridine, cytarabine, azauridine) and purine analogs and related materials (e.g., 6-mercaptopurine, 6-thioguanine, pentostatin), (c) Natural Products, such as vinca alkaloids (e.g., vinblastine, vincristine), epipodophylotoxins (e.g., etoposide, teniposide), antibiotics (e.g., dactinomycin, daunorubicin, doxorubicin, bleomycin, plicamycin and mitoxanthrone), enzymes (e.g., L-asparaginase), and biological response modifiers (e.g., Interferon-a), and (d) Miscellaneous Agents, such as platinum coordination complexes (e.g., cisplatin, carboplatin), substituted ureas (e.g., hydroxyurea), methylhydiazine derivatives (e.g., procarbazine), and adreocortical suppressants (e.g., taxol and mitotane). In some embodiments, cisplatin is a particularly suitable chemotherapeutic agent.

    [0482] Cisplatin has been widely used to treat cancers such as, for example, metastatic testicular or ovarian carcinoma, advanced bladder cancer, head or neck cancer, cervical cancer, lung cancer or other tumors. Cisplatin is not absorbed orally and must therefore be delivered via other routes such as, for example, intravenous, subcutaneous, intratumoral or intraperitoneal injection. Cisplatin can be used alone or in combination with other agents, with efficacious doses used in clinical applications including about 15 mg/m2 to about 20 mg/m2 for 5 days every three weeks for a total of three courses being contemplated in certain embodiments. In some embodiments, the amount of cisplatin delivered to the cell and/or subject in conjunction with the construct comprising an Egr-1 promoter operably linked to a polynucleotide encoding the therapeutic polypeptide is less than the amount that would be delivered when using cisplatin alone.

    [0483] Other suitable chemotherapeutic agents include antimicrotubule agents, e.g., Paclitaxel (Taxol) and doxorubicin hydrochloride (doxorubicin). The combination of an Egr-1 promoter/TNF construct delivered via an adenoviral vector and doxorubicin was determined to be effective in overcoming resistance to chemotherapy and/or TNF-, which suggests that combination treatment with the construct and doxorubicin overcomes resistance to both doxorubicin and TNF-.

    [0484] Doxorubicin is absorbed poorly and is preferably administered intravenously. In certain embodiments, appropriate intravenous doses for an adult include about 60 mg/m2 to about 75 mg/m2 at about 21-day intervals or about 25 mg/m2 to about 30 mg/m2 on each of 2 or 3 successive days repeated at about 3 week to about 4 week intervals or about 20 mg/m2 once a week. The lowest dose should be used in elderly patients, when there is prior bone-marrow depression caused by prior chemotherapy or neoplastic marrow invasion, or when the drug is combined with other myelopoietic suppressant drugs.

    [0485] Nitrogen mustards are another suitable chemotherapeutic agent useful in the methods of the disclosure. A nitrogen mustard may include, but is not limited to, mechlorethamine (HN2), cyclophosphamide and/or ifosfamide, melphalan (L-sarcolysin), and chlorambucil. Cyclophosphamide (CYTOXAN) is available from Mead Johnson and NEOSTAR is available from Adria), is another suitable chemotherapeutic agent. Suitable oral doses for adults include, for example, about 1 mg/kg/day to about 5 mg/kg/day, intravenous doses include, for example, initially about 40 mg/kg to about 50 mg/kg in divided doses over a period of about 2 days to about 5 days or about 10 mg/kg to about 15 mg/kg about every 7 days to about 10 days or about 3 mg/kg to about 5 mg/kg twice a week or about 1.5 mg/kg/day to about 3 mg/kg/day. Because of adverse gastrointestinal effects, the intravenous route is preferred. The drug also sometimes is administered intramuscularly, by infiltration or into body cavities.

    [0486] Additional suitable chemotherapeutic agents include pyrimidine analogs, such as cytarabine (cytosine arabinoside), 5-fluorouracil (fluouracil; 5-FU) and floxuridine (fluorode-oxyuridine; FudR). 5-FU may be administered to a subject in a dosage of anywhere between about 7.5 to about 1000 mg/m2. Further, 5-FU dosing schedules may be for a variety of time periods, for example up to six weeks, or as determined by one of ordinary skill in the art to which this disclosure pertains.

    [0487] Gemcitabine diphosphate (GEMZAR, Eli Lilly & Co., gemcitabine), another suitable chemotherapeutic agent, is recommended for treatment of advanced and metastatic pancreatic cancer, and will therefore be useful in the present disclosure for these cancers as well.

    [0488] The amount of the chemotherapeutic agent delivered to the patient may be variable. In one suitable embodiment, the chemotherapeutic agent may be administered in an amount effective to cause arrest or regression of the cancer in a host, when the chemotherapy is administered with the construct. In other embodiments, the chemotherapeutic agent may be administered in an amount that is anywhere between 2 to 10,000 fold less than the chemotherapeutic effective dose of the chemotherapeutic agent. For example, the chemotherapeutic agent may be administered in an amount that is about 20 fold less, about 500 fold less or even about 5000 fold less than the chemotherapeutic effective dose of the chemotherapeutic agent. The chemotherapeutics of the disclosure can be tested in vivo for the desired therapeutic activity in combination with the construct, as well as for determination of effective dosages. For example, such compounds can be tested in suitable animal model systems prior to testing in humans, including, but not limited to, rats, mice, chicken, cows, monkeys, rabbits, etc. In vitro testing may also be used to determine suitable combinations and dosages, as described in the examples.

    C. Radiotherapy

    [0489] In some embodiments, the additional therapy or prior therapy comprises radiation, such as ionizing radiation. As used herein, ionizing radiation means radiation comprising particles or photons that have sufficient energy or can produce sufficient energy via nuclear interactions to produce ionization (gain or loss of electrons). An exemplary and preferred ionizing radiation is an x-radiation. Means for delivering x-radiation to a target tissue or cell are well known in the art.

    D. Surgery

    [0490] Approximately 60% of persons with cancer will undergo surgery of some type, which includes preventative, diagnostic or staging, curative, and palliative surgery. Curative surgery includes resection in which all or part of cancerous tissue is physically removed, excised, and/or destroyed and may be used in conjunction with other therapies, such as the treatment of the present embodiments, chemotherapy, radiotherapy, hormonal therapy, gene therapy, immunotherapy, and/or alternative therapies. Tumor resection refers to physical removal of at least part of a tumor. In addition to tumor resection, treatment by surgery includes laser surgery, cryosurgery, electrosurgery, and microscopically-controlled surgery (Mohs' surgery).

    [0491] Upon excision of part or all of cancerous cells, tissue, or tumor, a cavity may be formed in the body. Treatment may be accomplished by perfusion, direct injection, or local application of the area with an additional anti-cancer therapy. Such treatment may be repeated, for example, every 1, 2, 3, 4, 5, 6, or 7 days, or every 1, 2, 3, 4, and 5 weeks or every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months. These treatments may be of varying dosages as well.

    X. Treatments

    [0492] The present disclosure provides methods and compositions for treating pathogenic blood vessel disorders such as diabetic retinopathy, age-related macular degeneration (AMD), retinopathy of prematurity, or cancer. The treatment can be through killing tumor blood vessels. In some embodiments, a tumor patient that can be suitably treated by the present technology expresses a plexin domain-containing protein (e.g., PLXDC1 or PLXDC2). The expression may be on a tumor blood epithelial cell.

    [0493] As noted, the present technology not only can inhibit growth of new tumor blood vessels, but can also kill existing tumor blood vessels, thereby treating the tumor. In some embodiments, therefore, a tumor patient that can benefit from the present treatment is one that has a tumor that has undergone tumor angiogenesis. In some embodiments, the tumor comprises a vascularized tumor. In some embodiments, the tumor being treat has a diameter that is greater than about 0.1, 0.2, 0.3, 0.4, 0.5, 1, 1.5, 2, 2.5, 3, 4, 5, 6, 7, 8, 9 or 10 cm (or any derivable range therein). In some embodiments, the tumor already contains tumor blood vessels.

    [0494] In some embodiments, the tumor does not have a known tumor surface marker as target for immunotherapy. In some embodiments, the tumor does not contain a mutant gene that serves as a target for tumor therapy. In some embodiments, the therapy of the present disclosure does not include inducing antibody-dependent cell-mediated cytotoxicity (ADCC). In some embodiments, a therapeutic agent of the present disclosure does not induce ADCC.

    [0495] In some embodiments, the patient suffers from a cancer such as, polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyo sarcoma, colon carcinoma, pancreatic cancer, breast cancer, thyroid cancer, endometrial cancer, melanoma, prostate cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma and retinoblastoma.

    [0496] In some embodiments, the methods described herein may be used to treat any cancerous or pre-cancerous tumor, such as a solid tumor. Cancers that may be treated by methods and compositions provided herein include, but are not limited to, cancer cells from the bladder, blood, bone, bone marrow, brain, breast, colon, esophagus, gastrointestine, gum, head, kidney, liver, lung, nasopharynx, neck, ovary, prostate, skin, stomach, testis, tongue, or uterus. In addition, the cancer may specifically be of the following histological type, though it is not limited to these: neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma; lymphoepithelial carcinoma; basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo-alveolar adenocarcinoma; papillary adenocarcinoma; chromophobe carcinoma; acidophil carcinoma; oxyphilic adenocarcinoma; basophil carcinoma; clear cell adenocarcinoma; granular cell carcinoma; follicular adenocarcinoma; papillary and follicular adenocarcinoma; nonencapsulating sclerosing carcinoma; adrenal cortical carcinoma; endometrioid carcinoma; skin appendage carcinoma; apocrine adenocarcinoma; sebaceous adenocarcinoma; ceruminous adenocarcinoma; mucoepidermoid carcinoma; cystadenocarcinoma; papillary cystadenocarcinoma; papillary serous cystadenocarcinoma; mucinous cystadenocarcinoma; mucinous adenocarcinoma; signet ring cell carcinoma; infiltrating duct carcinoma; medullary carcinoma; lobular carcinoma; inflammatory carcinoma; mammary paget's disease; acinar cell carcinoma; adenosquamous carcinoma; adenocarcinoma w/squamous metaplasia; malignant thymoma; malignant ovarian stromal tumor; malignant thecoma; malignant granulosa cell tumor; and malignant roblastoma; sertoli cell carcinoma; malignant leydig cell tumor; malignant lipid cell tumor; malignant paraganglioma; malignant extra-mammary paraganglioma; pheochromocytoma; glomangiosarcoma; malignant melanoma; amelanotic melanoma; superficial spreading melanoma; malignant melanoma in giant pigmented nevus; epithelioid cell melanoma; malignant blue nevus; sarcoma; fibrosarcoma; malignant fibrous histiocytoma; myxosarcoma; liposarcoma; leiomyosarcoma; rhabdomyosarcoma; embryonal rhabdomyosarcoma; alveolar rhabdomyosarcoma; stromal sarcoma; malignant mixed tumor; mullerian mixed tumor; nephroblastoma; hepatoblastoma; carcinosarcoma; malignant mesenchymoma; malignant brenner tumor; malignant phyllodes tumor; synovial sarcoma; malignant mesothelioma; dysgerminoma; embryonal carcinoma; malignant teratoma; malignant struma ovarii; choriocarcinoma; malignant mesonephroma; hemangiosarcoma; malignant hemangioendothelioma; kaposi's sarcoma; malignant hemangiopericytoma; lymphangiosarcoma; osteosarcoma; juxtacortical osteosarcoma; chondrosarcoma; malignant chondroblastoma; mesenchymal chondrosarcoma; giant cell tumor of bone; ewing's sarcoma; malignant odontogenic tumor; ameloblastic odontosarcoma; malignant ameloblastoma; ameloblastic fibrosarcoma; malignant pinealoma; chordoma; malignant glioma; ependymoma; astrocytoma; protoplasmic astrocytoma; fibrillary astrocytoma; astroblastoma; glioblastoma; oligodendroglioma; oligodendroblastoma; primitive neuroectodermal; cerebellar sarcoma; ganglioneuroblastoma; neuroblastoma; retinoblastoma; olfactory neurogenic tumor; malignant meningioma; neurofibrosarcoma; malignant neurilemmoma; malignant granular cell tumor; malignant lymphoma; Hodgkin's disease; Hodgkin's lymphoma; paragranuloma; small lymphocytic malignant lymphoma; diffuse large cell malignant lymphoma; follicular malignant lymphoma; mycosis fungoides; other specified non-Hodgkin's lymphomas; malignant histiocytosis; multiple myeloma; mast cell sarcoma or immunoproliferative small intestinal disease.

    [0497] In some embodiments, the subject has cancer, preferably comprising a solid tumor. An agent disclosed herein may be administered locally to the tumor. In some embodiments, the tumor is an adenocarcinoma, an adrenal tumor, an anal tumor, a bile duct tumor, a bladder tumor, a bone tumor, a blood born tumor, a brain/CNS tumor, a breast tumor, a cervical tumor, a colorectal tumor, an endometrial tumor, an esophageal tumor, an Ewing tumor, an eye tumor, a gallbladder tumor, a gastrointestinal, a kidney tumor, a laryngeal or hypopharyngreal tumor, a liver tumor, a lung tumor, a mesothelioma tumor, a multiple myeloma tumor, a muscle tumor, a nasopharyngeal tumor, a neuroblastoma, an oral tumor, an osteosarcoma, an ovarian tumor, a pancreatic tumor, a penile tumor, a pituitary tumor, a primary tumor, a prostate tumor, a retinoblastoma, a Rhabdomyosarcoma, a salivary gland tumor, a soft tissue sarcoma, a melanoma, a metastatic tumor, a basal cell carcinoma, a Merkel cell tumor, a testicular tumor, a thymus tumor, a thyroid tumor, a uterine tumor, a vaginal tumor, a vulvar tumor, or a Wilms tumor. In some embodiments, a compound and/or composition described herein may be administered parenterally, at or near the site of a tumor, or distant from the site of the tumor.

    [0498] Actual dosage levels of the active ingredients in the pharmaceutical compositions may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.

    [0499] The selected dosage level will depend upon a variety of factors including the activity of the particular agent employed, the route of administration, the time of administration, the rate of excretion or metabolism of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compound employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.

    [0500] A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian could prescribe and/or administer doses of the compounds employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.

    [0501] The administration of one or more compounds as described herein may result in at least a 10% decrease (e.g., at least 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or even 100% decrease in one or more symptoms of a disease or condition, such as a decrease in tumor size.

    [0502] Compounds described herein can be used in methods for agonizing Pigment-Epithelium-Derived Factor (PEDF) receptors. Compounds described herein can also be used in methods for inhibiting angiogenesis.

    [0503] The PEDF receptors have been identified as two homologous membrane proteins called plexin domain containing 1 (PLXDC1) and plexin domain containing 2 (PLXDC2). They belong to a new type of cell-surface receptors and are the only proteins that are known to confer cell-surface binding to PEDF and to transduce PEDF signal into the target cells. Consistent with the ability of PEDF to suppress pathogenic angiogenesis in blinding diseases and in cancer without affecting healthy blood vessels, the PEDF receptors are highly expressed in pathogenic blood vessels in many diseases, including tumor blood vessels and diabetic retinopathy. The PEDF receptors are not detected in healthy blood vessels. One of the PEDF receptors (TEM7, PLXDC1) was well studied in the past as a tumor endothelial marker that is enriched in tumor blood vessels of diverse types of human cancer including colon, liver, lung, breast, pancreatic, brain, bladder, ovarian, kidney, esophagus, gastric and endometrial cancer and Kaposi sarcoma, liposarcoma and synovial sarcoma. In blinding diseases, PEDF receptor TEM7 (PLXDC1) is highly enriched in the pathogenic blood vessels of diabetic retinopathy, retinal occlusive vascular disease, retinopathy of prematurity, and choroidal neovascularization (pathogenic angiogenesis in AMD). This is consistent with the role of PEDF in suppressing pathogenic angiogenesis in these diseases without affecting healthy blood vessels.

    [0504] The compounds and methods described herein can therefore be used in treating disease mediated by PEDF receptors or associated with angiogenesis, such as cancer, retinal occlusive vascular disease, retinopathy of prematurity, diabetic retinopathy, and age-related macular degeneration.

    [0505] In certain embodiments, provided herein are methods for agonizing Pigment-Epithelium-Derived Factor (PEDF) receptors in a patient in need thereof comprising administering to said patient a therapeutically effective amount of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof.

    [0506] In certain embodiments, provided herein are methods for inhibiting angiogenesis in a patient in need thereof comprising administering to said patient a therapeutically effective amount of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof. In certain embodiments, the angiogenesis is pathogenic angiogenesis.

    [0507] Also provided herein are methods for treating a disease or disorder mediated by PEDF receptors in a patient in need thereof comprising administering to said patient a therapeutically effective amount of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof.

    [0508] Also provided herein are methods for treating a disease or disorder associated with angiogenesis in a patient in need thereof comprising administering to said patient a therapeutically effective amount of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof.

    [0509] Also provided herein are methods for treating a disease or disorder selected from a cancer, retinal occlusive vascular disease, retinopathy of prematurity, diabetic retinopathy, and age-related macular degeneration comprising administering to said patient a therapeutically effective amount of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof. In certain embodiments, the cancer is selected from colon, liver, lung, breast, pancreatic, brain, bladder, ovarian, kidney, esophagus, gastric and endometrial cancer and Kaposi sarcoma, liposarcoma and synovial sarcoma. In certain embodiments, the disease is a blinding disease. In certain embodiments, the disease is diabetic retinopathy, retinal occlusive vascular disease, retinopathy of prematurity, or choroidal neovascularization (pathogenic angiogenesis in AMD).

    [0510] In certain embodiments, provided herein is use of a compound of the disclosure, or a pharmaceutically acceptable salt prodrug thereof in a method for agonizing Pigment-Epithelium-Derived Factor (PEDF) receptors in a patient in need thereof comprising administering to said patient a therapeutically effective amount of the compound, or a pharmaceutically acceptable salt prodrug thereof.

    [0511] In certain embodiments, provided herein is use of a compound of the disclosure, or a pharmaceutically acceptable salt prodrug thereof in a method for inhibiting angiogenesis in a patient in need thereof comprising administering to said patient a therapeutically effective amount of the compound, or a pharmaceutically acceptable salt or prodrug thereof. In certain embodiments, the angiogenesis is pathogenic angiogenesis.

    [0512] Also provided herein is use of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof in a method for treating a disease or disorder mediated by PEDF receptors in a patient in need thereof comprising administering to said patient a therapeutically effective amount of the compound, or a pharmaceutically acceptable salt or prodrug thereof.

    [0513] Also provided herein is use of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof in a method for treating a disease or disorder associated with angiogenesis in a patient in need thereof comprising administering to said patient a therapeutically effective amount of the compound, or a pharmaceutically acceptable salt or prodrug thereof.

    [0514] Also provided herein is use of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof in a method for treating a disease or disorder selected from a cancer, retinal occlusive vascular disease, retinopathy of prematurity, diabetic retinopathy, and age-related macular degeneration comprising administering to said patient a therapeutically effective amount of the compound, or a pharmaceutically acceptable salt or prodrug thereof. In certain embodiments, the cancer is selected from colon, liver, lung, breast, pancreatic, brain, bladder, ovarian, kidney, esophagus, gastric and endometrial cancer and Kaposi sarcoma, liposarcoma and synovial sarcoma. In certain embodiments, the disease is a blinding disease. In certain embodiments, the disease is diabetic retinopathy, retinal occlusive vascular disease, retinopathy of prematurity, or choroidal neovascularization (pathogenic angiogenesis in AMD).

    [0515] In certain embodiments, provided herein is use of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof in the manufacture of a medicament for agonizing Pigment-Epithelium-Derived Factor (PEDF) receptors in a patient in need thereof.

    [0516] In certain embodiments, provided herein is use of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof in the manufacture of a medicament for inhibiting angiogenesis in a patient in need thereof. In certain embodiments, the angiogenesis is pathogenic angiogenesis.

    [0517] Also provided herein is use of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof in the manufacture of a medicament for treating a disease or disorder mediated by PEDF receptors in a patient in need thereof.

    [0518] Also provided herein is use of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof in the manufacture of a medicament for treating a disease or disorder associated with angiogenesis in a patient in need thereof.

    [0519] Also provided herein is use of a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof in the manufacture of a medicament for treating a disease or disorder selected from a cancer, retinal occlusive vascular disease, retinopathy of prematurity, diabetic retinopathy, and age-related macular degeneration. In certain embodiments, the cancer is selected from colon, liver, lung, breast, pancreatic, brain, bladder, ovarian, kidney, esophagus, gastric and endometrial cancer and Kaposi sarcoma, liposarcoma and synovial sarcoma. In certain embodiments, the disease is a blinding disease. In certain embodiments, the disease is diabetic retinopathy, retinal occlusive vascular disease, retinopathy of prematurity, or choroidal neovascularization (pathogenic angiogenesis in AMD)

    XI. Administration of Therapeutic Compositions

    [0520] The present disclosure also provides pharmaceutical compositions. In certain embodiments provided herein is a composition, e.g., a pharmaceutical composition, containing at least one antibody, small molecule, polynucleotide or polypeptide capable of modulating an PLXDC1 and/or PLXDC2 receptor described herein, formulated together with a pharmaceutically acceptable carrier. In some embodiments, the composition includes a combination of multiple (e.g., two or more) agents.

    [0521] The therapy provided herein may comprise administration of a combination of therapeutic agents, such as a first cancer therapy and a second cancer therapy. The therapies may be administered in any suitable manner known in the art. For example, the first and second cancer treatment may be administered sequentially (at different times) or concurrently (at the same time). In some embodiments, the first and second cancer treatments are administered in a separate composition. In some embodiments, the first and second cancer treatments are in the same composition.

    [0522] Embodiments of the disclosure relate to compositions and methods comprising therapeutic compositions. The different therapies may be administered in one composition or in more than one composition, such as 2 compositions, 3 compositions, or 4 compositions. Various combinations of the agents may be employed.

    [0523] The therapeutic agents of the disclosure may be administered by the same route of administration or by different routes of administration. In some embodiments, the cancer therapy is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally. In some embodiments, the antibiotic is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally. The appropriate dosage may be determined based on the type of disease to be treated, severity and course of the disease, the clinical condition of the individual, the individual's clinical history and response to the treatment, and the discretion of the attending physician.

    [0524] The treatments may include various unit doses. Unit dose is defined as containing a predetermined-quantity of the therapeutic composition. The quantity to be administered, and the particular route and formulation, is within the skill of determination of those in the clinical arts. A unit dose need not be administered as a single injection but may comprise continuous infusion over a set period of time. In some embodiments, a unit dose comprises a single administrable dose.

    [0525] The quantity to be administered, both according to number of treatments and unit dose, depends on the treatment effect desired. An effective dose is understood to refer to an amount necessary to achieve a particular effect. In the practice in certain embodiments, it is contemplated that doses in the range from 10 mg/kg to 200 mg/kg can affect the protective capability of these agents. Thus, it is contemplated that doses include doses of about 0.1, 0.5, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, and 200, 300, 400, 500, 1000 g/kg, mg/kg, g/day, or mg/day or any range derivable therein. Furthermore, such doses can be administered at multiple times during a day, and/or on multiple days, weeks, or months.

    [0526] In certain embodiments, the effective dose of the pharmaceutical composition is one which can provide a blood level of about 1 M to 150 M. In another embodiment, the effective dose provides a blood level of about 4 M to 100 M.; or about 1 M to 100 M; or about 1 M to 50 M; or about 1 M to 40 M; or about 1 M to 30 M; or about 1 M to 20 M; or about 1 M to 10 M; or about 10 UM to 150 M; or about 10 M to 100 M; or about 10 M to 50 M; or about 25 M to 150 UM; or about 25 M to 100 M; or about 25 M to 50 M; or about 50 M to 150 M; or about 50 M to 100 M (or any range derivable therein). In other embodiments, the dose can provide the following blood level of the agent that results from a therapeutic agent being administered to a subject: about, at least about, or at most about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 M or any range derivable therein. In certain embodiments, the therapeutic agent that is administered to a subject is metabolized in the body to a metabolized therapeutic agent, in which case the blood levels may refer to the amount of that agent. Alternatively, to the extent the therapeutic agent is not metabolized by a subject, the blood levels discussed herein may refer to the unmetabolized therapeutic agent.

    [0527] Precise amounts of the therapeutic composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting dose include physical and clinical state of the patient, the route of administration, the intended goal of treatment (alleviation of symptoms versus cure) and the potency, stability and toxicity of the particular therapeutic substance or other therapies a subject may be undergoing.

    [0528] It will be understood by those skilled in the art and made aware that dosage units of g/kg or mg/kg of body weight can be converted and expressed in comparable concentration units of g/ml or mM (blood levels), such as 4 M to 100 M. It is also understood that uptake is species and organ/tissue dependent. The applicable conversion factors and physiological assumptions to be made concerning uptake and concentration measurement are well-known and would permit those of skill in the art to convert one concentration measurement to another and make reasonable comparisons and conclusions regarding the doses, efficacies and results described herein.

    XII. Kits

    [0529] Certain aspects of the present disclosure also concern kits containing compositions of the disclosure or compositions to implement methods of the disclosure. In some embodiments, kits can be used to evaluate one or more biomarkers. In certain embodiments, a kit contains, contains at least or contains at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 100, 500, 1,000 or more probes, primers or primer sets, synthetic molecules or inhibitors, or any value or range and combination derivable therein. In some embodiments, there are kits for evaluating biomarker activity in a cell.

    [0530] Kits may comprise components, which may be individually packaged or placed in a container, such as a tube, bottle, vial, syringe, or other suitable container means.

    [0531] Individual components may also be provided in a kit in concentrated amounts; in some embodiments, a component is provided individually in the same concentration as it would be in a solution with other components. Concentrations of components may be provided as 1, 2, 5, 10, or 20 or more.

    [0532] Kits for using probes, synthetic nucleic acids, nonsynthetic nucleic acids, and/or inhibitors of the disclosure for prognostic or diagnostic applications are included as part of the disclosure. Specifically contemplated are any such molecules corresponding to any biomarker identified herein, which includes nucleic acid primers/primer sets and probes that are identical to or complementary to all or part of a biomarker, which may include noncoding sequences of the biomarker, as well as coding sequences of the biomarker.

    [0533] It is contemplated that any method or composition described herein can be implemented with respect to any other method or composition described herein and that different embodiments may be combined. The claims originally filed are contemplated to cover claims that are multiply dependent on any filed claim or combination of filed claims.

    [0534] Any embodiment of the disclosure involving specific biomarker by name is contemplated also to cover embodiments involving biomarkers whose sequences are at least 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99% identical to the mature sequence of the specified nucleic acid.

    [0535] Embodiments of the disclosure include kits for analysis of a pathological sample by assessing biomarker profile for a sample comprising, in suitable container means, two or more biomarker probes, wherein the biomarker probes detect one or more of the biomarkers identified herein. The kit can further comprise reagents for labeling nucleic acids in the sample. The kit may also include labeling reagents, including at least one of amine-modified nucleotide, poly (A) polymerase, and poly (A) polymerase buffer. Labeling reagents can include an amine-reactive dye.

    [0536] Provided herein are also kits that include a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof, and suitable packaging. In certain embodiments, a kit further includes instructions for use. In one aspect, a kit includes a compound of the disclosure, or a pharmaceutically acceptable salt or prodrug thereof, and a label and/or instructions for use of the compounds in the treatment of the indications, including the diseases or conditions, described herein.

    [0537] Provided herein are also articles of manufacture that include a compound described herein or a pharmaceutically acceptable salt or prodrug thereof in a suitable container. The container may be a vial, jar, ampoule, preloaded syringe and intravenous bag.

    XIII. Synthesis of the Compounds

    [0538] The compounds may be prepared using the methods disclosed herein and routine modifications thereof, which will be apparent given the disclosure herein and methods well known in the art. Conventional and well-known synthetic methods may be used in addition to the teachings herein. The synthesis of typical compounds described herein may be accomplished as described in the following examples. If available, reagents and starting materials may be purchased commercially, e.g., from Sigma Aldrich or other chemical suppliers.

    [0539] It will be appreciated that where typical or preferred process conditions (i.e., reaction temperatures, times, mole ratios of reactants, solvents, pressures, etc.) are given, other process conditions can also be used unless otherwise stated. Optimum reaction conditions may vary with the particular reactants or solvent used, but such conditions can be determined by one skilled in the art by routine optimization procedures.

    [0540] Additionally, conventional protecting groups may be necessary to prevent certain functional groups from undergoing undesired reactions. Suitable protecting groups for various functional groups as well as suitable conditions for protecting and deprotecting particular functional groups are well known in the art. For example, numerous protecting groups are described in Wuts, P. G. M., Greene, T. W., & Greene, T. W. (2006). Greene's protective groups in organic synthesis. Hoboken, N.J., Wiley-Interscience, and references cited therein.

    [0541] Furthermore, the compounds of this disclosure may contain one or more chiral centers. Accordingly, if desired, such compounds can be prepared or isolated as pure stereoisomers, i.e., as individual enantiomers or diastereomers or as stereoisomer-enriched mixtures. All such stereoisomers (and enriched mixtures) are included within the scope of this disclosure, unless otherwise indicated. Pure stereoisomers (or enriched mixtures) may be prepared using, for example, optically active starting materials or stereoselective reagents well-known in the art. Alternatively, racemic mixtures of such compounds can be separated using, for example, chiral column chromatography, chiral resolving agents, and the like.

    [0542] The starting materials for the following reactions are generally known compounds or can be prepared by known procedures or obvious modifications thereof. For example, many of the starting materials are available from commercial suppliers such as Aldrich Chemical Co. (Milwaukee, Wisconsin, USA), Bachem (Torrance, California, USA), Emka-Chemce or Sigma (St. Louis, Missouri, USA). Others may be prepared by procedures or obvious modifications thereof, described in standard reference texts such as Fieser and Fieser's Reagents for Organic Synthesis, Volumes 1-15 (John Wiley, and Sons, 1991), Rodd's Chemistry of Carbon Compounds, Volumes 1-5, and Supplementals (Elsevier Science Publishers, 1989) organic Reactions, Volumes 1-40 (John Wiley, and Sons, 1991), March's Advanced Organic Chemistry, (John Wiley, and Sons, 5th Edition, 2001), and Larock's Comprehensive Organic Transformations (VCH Publishers Inc., 1989).

    A. General Synthesis

    [0543] Scheme I illustrates a general method which can be employed for the synthesis of compounds described herein.

    ##STR00560## ##STR00561##

    [0544] Referring to Scheme I, wherein R.sup.1, R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8, R.sup.9 and n are as described herein, appropriate starting materials and reagents, such as compound I-1, can be purchased or prepared by methods known to one of skill in the art or by methods described herein, such as in Scheme II.

    [0545] Step I-1: Compound I-1 reacts with a sodium salt (e.g., Na.sub.2SO.sub.3) or a sodium base (e.g., NaHCO.sub.3), or a mixture thereof in an aqueous solution to give Compound I-2. The reaction can be carried out under heating conditions, such as at a temperature of from about 60 C. to about 100 C. Examples of the reaction are illustrated in Example 1, Step 1-2, and Example 6, Step 6-2.

    [0546] Step I-2: Compound I-2 reacts with Lg.sup.1-CH.sub.2C(O)OCH.sub.3, wherein Lg.sup.1 is a leaving group, such as Cl or Br, to provide I-3. The reaction can be carried out in a solvent, such as DMF, under heating conditions, such as at a temperature of from about 60 C. to about 100 C. An example of the reaction is illustrated in Example 1, Step 1-3.

    [0547] Step I-3: Compound I-3 reacts with triethyl orthoformate and acetic anhydride to provide Compound I-4. The reaction can be carried out under reflex conditions. An example of the reaction is illustrated in Example 1, Step 1-4.

    [0548] Step I-4: Compound I-4 reacts with amino Compound I-5 to provide Compound I-6. The reaction can be carried out in a solvent, such as diphenyl ether, under heating conditions, such as at a temperature of from about 100 C. to about 150 C. Compound I-6 then cyclizes to Compound I-7. The cyclization reaction can be carried out in a solvent, such as diphenyl ether, under reflux conditions. An example of the reaction is illustrated in Example 1, Step 1-5.

    [0549] Step I-5: Compound I-7 reacts with POCl.sub.3 to give Compound I-8. The reaction can be carried out under reflux conditions. Optionally, a solvent, such as DMF, may be used. Examples of the reaction are illustrated in Example 1, Step 1-6, and Example 3.

    [0550] Step I-5A: When R.sup.6 of Compound I-8 is SR.sup.16 (wherein R.sup.16 is as defined herein), the SR.sup.16 group can be oxidized to S(O) R.sup.16 using 1 eq. of an oxidizing reagent, such as mCPBA, to give Compound I-8 wherein R.sup.6 is S(O) R.sup.16. The reaction can be carried out at a low temperature of below 0 C., such as about 20 C. An example of the reaction is illustrated in Example 8, Step 8-1.

    [0551] Step I-5B: When R.sup.6 of Compound I-8 is SR.sup.16 (wherein R.sup.16 is as defined herein), the SR.sup.16 group can be oxidized to S(O).sub.2R.sup.16 by adding an excess amount of an oxidizing reagent, such as 2. eq. of mCPBA, to give Compound I-8 wherein R.sup.6 is S(O).sub.2R.sup.16. The reaction can be carried out at a temperature of about 0 C. An example of the reaction is illustrated in Example 9.

    [0552] Step I-6: Compound I-8 reacts with Compound R.sup.1H to give Compound I-9. The reaction can be carried out in a solvent, such as 1,4-dioxane and DMF, optionally with heating, such as at a temperature of about 30 C. to reflex. In certain embodiments, a base such as NaH can be added to deprotonate Compound R.sup.1H before reaction with Compound I-8. Examples of I-6 are illustrated in Example 1, Step 1-7 (I-6A), Example 2 (I-6B), and Example 5 (I-6C).

    [0553] Step I-7: When R.sup.6 of Compound I-9 is an ester-C(O) OR.sup.15 (wherein R.sup.15 is as defined herein but is not H), C(O) OR.sup.15 can be hydrolyzed to C(O) OH with a base such as LiOH, in an aqueous solution, to give Compound I-9 wherein R.sup.6 is C(O) OH. An example of the reaction is illustrated in Example 3, conversion of Compound 63 to Compound 66. Similarly, an ester group at other positions of a compound can be hydrolyzed to an acid group.

    [0554] Step I-8: Compound I-9 wherein R.sup.6 is C(O) OH can be converted to Compound I-9 wherein R.sup.6 is C(O) NR.sup.15R.sup.15 by reacting with an amine HNR.sup.15R.sup.15 under amide coupling reaction conditions. Amide coupling reaction conditions can include a solvent, such as NMP, DMF, DCM, a coupling reagent, such as EDCI, optionally an additional agent, such as HOBt, and optionally a base, such as triethylamine. The reaction can be carried out at about 0 C. to room temperature. An example of the reaction is illustrated in Example 7.

    ##STR00562##

    [0555] Scheme II shows a method of preparing starting material I-1 used in Scheme I from compound II-1.

    [0556] In certain embodiments, Compound II-1 reacts with phosphorus oxychloride and concentrated sulfuric acid to give Compound I-1 (II-A). The reaction may be carried out at an elevated temperature, such as about 60 C. to about 100 C. An example of the reaction is illustrated in Example 1, Step 1-1.

    [0557] In certain embodiments, Compound II-1 reacts with chlorosulfonic acid to give Compound I-1 (II-B). The reaction may be carried out at a low temperature, such as about 10 C. to about 10 C. An example of the reaction is illustrated in Example 6, Step 6-1.

    ##STR00563##

    [0558] Scheme III shows a method of preparing starting material II-1. Phenol Compound II-1 react with Lg.sup.2-R.sup.18 to give Compound II-2, wherein R.sup.2 is OR.sup.18, R.sup.9 and R.sup.18 are as defined herein, and Lg.sup.2 is a leaving group, such as a halo. The reaction can be carried out in a solvent, such as acetone in the presence of a base such as K.sub.2CO.sub.3, and a phase transfer catalyst, such as tetra-n-butylammonium iodide. An example of the reaction is illustrated in Example 10.

    ##STR00564##

    [0559] Scheme IV shows a method of preparing Intermediates such as IV-13, IV-14, and IV-15, wherein R.sup.2, R.sup.5, R.sup.6, R.sup.7, R.sup.8, R.sup.9, R.sup.15, R.sup.16, and n are as defined herein. An example of the method is illustrated in Example 18.

    XIV. Biological Examples

    [0560] The following examples are included to demonstrate preferred embodiments of the disclosure. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the disclosure, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the disclosure.

    Example 1. Killing Pathogenic Blood Vessels by Targeting PLXDC1/PLXDC2

    [0561] Pathogenic angiogenesis plays a key role in several major human diseases (Carmeliet, 2005). In addition to tumor growth and metastasis, angiogenesis is a major pathogenic driving force in several blinding diseases including diabetic retinopathy, age-related macular degeneration (AMD), and retinopathy of prematurity. AMD and diabetic retinopathy are the leading causes of blindness in the elderly and populations at the working age in the United States, respectively. Retinopathy of prematurity is a common reason that causes the loss of vision for newborn babies. Pathogenic blood vessels are blood vessels that exist in the diseased states such as tumor blood vessels in tumors and new blood vessels in AMD or diabetic retinopathy that are distinct from healthy blood vessels in the eye. As demonstrated in FIG. 1, PLXDC1 expression was highly enriched in pathogenic blood vessels in a mouse model of CNV (laser-induced choroidal neovascularization (CNV) (FIG. 1A-D), in pathogenic blood vessels in a mouse model of ischemia-induced retinopathy, but not in blood vessels of healthy retina (FIG. 1E-H).

    [0562] Pathogenic blood vessels differ from healthy blood vessels not only in tissue location and health state, but also in function. Pathogenic blood vessels drive pathogenic processes. For example, tumor blood vessels drive tumor growth and supply tumor with oxygen and nutrients that are essential for its survival. Choroidal neovascularization, the pathogenic blood vessels in AMD, cause blindness due to leakage that kills healthy neurons. While there are current therapeutic strategies for inhibiting the growth of new blood vessels, such as anti-angiogenesis therapies, there are no known strategies for destroying already existing pathogenic blood vessels. The binding agents of the disclosure can kill existing pathogenic blood vessels, thus providing an improvement over existing anti-angiogenic therapies.

    [0563] Two markers of pathogenic blood vessels, PLXDC1 (TEM7) and PLXDC2, are highly specifically expressed in the tumor blood vessels of diverse types of cancer (Beaty et al., 2007; Lu et al., 2007; Schwarze et al., 2005; St Croix et al., 2000; van Beijnum et al., 2009), and in the pathogenic blood vessels in diabetic retinopathy (Yamaji et al., 2008). This highly specific expression in pathogenic blood vessels is especially well documented for TEM7 (=Tumor Endothelial Marker 7), which was first described in 2000 (St Croix et al., 2000). This high enrichment is not present in healthy blood vessels (Beaty et al., 2007; Lu et al., 2007; Schwarze et al., 2005; St Croix et al., 2000; van Beijnum et al., 2009). We also identified high PLXDC1 expression in choroidal neovascularization (pathogenic angiogenesis in AMD) and ischemia-induced retinopathy (pathogenic angiogenesis in retinopathy of prematurity) (FIG. 1). The striking enrichment of PLXDC1 in the pathogenic blood vessels in several diseases is summarized in the table below:

    TABLE-US-00005 Highly specific expression in Pathogenic pathogenic blood angiogenesis vessles References Tumor blood vessles Yes St Croix et al., 2000 in diverse types of Carson-Walter et al., 2001 cancer Baley et al., 2011 Diabetic retinopathy Yes Yamji et al., 2008 Choroidal neovascular- Yes FIG. 1 ization Ischemia-induced Yes FIG. 1 retinopathy

    [0564] Although PLXDC1/PLXDC2 were known markers of pathogenic blood vessels, it was not known how to effectively target and kill the existing pathogenic blood vessels. In fact, anti-PLXDC1 antibodies have been developed as a potential anti-angiogenic therapy. In Bagley et al., Microvasc Res. 2011 November; 82 (3): 253-62, an anti-PLXDC1 antibody was identified that mediated antibody-dependent cellular cytotoxicity (ADCC) and phagocytosis. Such cancer immunotherapy approaches, however, have not yielded positive therapeutic results. Furthermore, Pigment Epithelium Derived Factor (PEDF), a natural ligand for PLXDC1 and PLXDC2 with anti-angiogenic properties, failed to kill existing PLXDC-expressing blood vessels. This example demonstrates that agents that modulate the PLXDC1/PLXDC2 receptor can effectively kill existing blood vessels.

    A. Ex Vivo Tumor Angiogenesis Model

    [0565] An ex vivo tumor angiogenesis model was developed to test the efficacy of anti-cancer candidate agents. The following protocol describes the Ex Vivo Tumor Angiogenesis Model.

    Protocol:

    [0566] 1. The day before the experiment, all necessary tools were sprayed with 70% ethanol and sterilized under UV light overnight, including blade, dissecting and micro-dissecting scissors and biceps. 24-well dishes were placed at 4 C. to pre-chill plates and Matrigel was thawed, 24 hours before tumor dissection. [0567] 2. 70% ethanol was sprayed on working bench. Two sterile petri dishes were prepared with 10 ml sterile PBS. The following steps 3 and 4 are necessary for mouse tumor models. For fresh human tumor, steps 3 and 4 are skipped. [0568] 3. The tumor-bearing mice were euthanized. 70% ethanol was sprayed on the mouse and the tumor was removed using sterilized dissecting tools (avoid the fur). The tumor was rinsed in petri dish with sterile PBS to remove ethanol and fur. The tumor was transferred to a new petri dish with PBS for dissection. The dish is placed on ice. [0569] 4. Pre-chilled sterile pipet tips were used to seed regular Matrigel in 24 well plates on ice. Matrigel (30 l) was dropped in the middle of each well without touching the edge of the well (avoid introducing bubbles if possible). [0570] 5. The tumor was cut in halves using the sterile blade. Healthy tumor tissue that is not necrotic and is within the tumor capsule was identified and isolated. The healthy tumor tissue was cut into small pieces. For instance, a suitable size for the tumor tissue is 0.5 mm (H)0.5 mm (L)0.3 mm (D) with a total volume of 0.075 mm.sup.3. [0571] 6. Each tumor piece was gently transferred and embedded in the Matrigel drop in the 24-well plate. The embedded piece was placed in the bottom and middle of each Matrigel drop. The plate was kept on ice all the time. [0572] 7. After seeding the tumor pieces, plates were incubated in a 37 C. cell culture incubator without medium for 10 minutes in order for the Matrigel to solidify. [0573] 8. Endothelial Growth Medium (0.5 ml) was added to each well and incubated at 37 C. with 5% CO.sub.2. Treatment was not added until the new endothelial cells was grown out of the tumor or were larger than 3 mm in diameter. This usually takes 4 days for the LL2 Lewis lung cancer model and 7 days for the CT26 colon cancer model. For human tumor models, the growth time is typically 2-3 weeks, depending on the tumor type. Media was changed every 4 days during prolonged culture. Typically, when the tumor tissue grows to 2 mm in diameter, it was good for drug testing. A size of about 3 mm in diameter can make visualization easier. [0574] 9. When the assay was ready to be analyzed for cell death (e.g., 48 hours after drug addition), the dye mixture was prepared by mixing 6 l of green dye to stain live cells (5 mg/ml Fluorescein diacetate or FDA in DMSO) with 30 l of red dye (2.5 mg/ml Propidium iodide or PI in PBS) to stain dead cells in an Eppendorf tube. The FDA dye needs to be stored frozen in a 20 C. freezer because it has a labile ester bond. [0575] 10. 1 l of the dye mixture was added to each well of the 24-well dish. It is usually preferred to do one 24-well dish at a time given the amount of time needed to take pictures (the green dye is not as stable in the cells in the long term). [0576] 11. The dish was gently rocked a few times to mix the dye with the media in the wells and incubate the dish at 37 C. for 10 min (too long incubation can make the green signal too intense). [0577] 12. Each well was washed with 0.5 ml of sterile PBS and then 0.5 ml of phenol red free SFM was added to each well. Alternatively 0.5 ml of regular Endothelial Cell Growth Media can be added to each well if this well needs to be continuously maintained after the experiment. [0578] 13. An inverted microscope using the 2 objective lens was used to observe morphological changes in the experimental wells. [0579] 14. Taking pictures in the red and green channels would allow not only the recording of the results but also more accurate quantitation of the results. To take pictures for all the wells, first a well that has robust red and green signals was picked. A picture at the red channel using the optimal setting (remember this setting) was taken and then a picture at the green channel using another optimal setting (remember this setting) was taken. The final picture is the merged picture of the red and green channels. Pictures of all other wells were taken in each channel using the same settings so that different wells can be compared.

    B. Results

    [0580] Using the model described above, the inventors designed and tested novel compounds and screened monoclonal antibodies of PLXDC1 for their ability to kill pathogenic blood vessels.

    1. Killing Pathogenic Blood Vessels in Vision Diseases

    [0581] FIG. 2 demonstrates that compound 369 (Table 3) targeting PLXDC1/PLXDC2 can kill the endothelial cells in an ex vivo model of choroidal neovascularization (see, for example, Shao, Z. et al., PLOS One. 2013 Jul. 26; 8 (7): e69552, which is herein incorporated by reference) without affecting the healthy tissue (choroid and retinal pigment epithelium (RPE)). In contrast and as demonstrated in FIG. 3, the current anti-angiogenic drug Eylea (currently the most commonly used drug for this purpose) can only inhibit angiogenesis, but does not kill existing endothelial cells from choroidal angiogenesis (even at a concentration much higher than what is used clinically). FIG. 3 is an example of human data showing that 24 injections of anti-VEGF drug Eylea over three years only partially inhibits pathogenic blood vessel growth but cannot kill pathogenic blood vessels.

    2. Killing Tumor Blood Vessels

    [0582] Previously there has been no drug (small molecule or large molecule) that can kill tumor (causing massive tumor necrosis) by killing existing tumor blood vessels. The reason why existing drugs that target blood vessels cannot achieve this therapeutic effect is that they are anti-angiogenic drugs and are designed to inhibit new blood vessel growth (and tumor growth). FIG. 4 shows that top compounds (e.g., compound 369) of the present disclosure targeting PLXDC1/PLXDC2 can kill existing tumor endothelial cells in an ex vivo model of tumor angiogenesis. In contrast, the current anti-angiogenic drug or anti-angiogenic factor PEDF cannot kill existing tumor endothelial cells.

    [0583] FIGS. 5 and 6 show that antibodies of the disclosure that target human PLXDC1 can kill existing tumor endothelial cells in ex vivo models of human tumor angiogenesis. FIG. 7 is an in vivo experiment demonstrating that systemic administration of compound 369 targeting PLXDC1/PLXDC2 can kill existing tumor blood vessels and lead to strong tumor death. The tumor died of massive coagulative necrosis, exactly the kind of cell death caused by killing blood vessels.

    [0584] FIG. 8 illustrates the differences between this new mechanism and anti-angiogenic drugs. Angiogenesis is the growth of new blood vessels from existing blood vessels. Tumor depends on angiogenesis to grow and to metastasize (FIG. 8A). Antiangiogenic drugs or factors inhibit angiogenesis and the growth of the tumor, but cannot kill the tumor because they cannot effectively kill existing tumor blood vessels (FIG. 8B). Drugs that target PLXDC1/PLXDC2 can kill existing tumor blood vessels to cause tumor death (FIG. 8C). Accordingly, agents and methods of the present disclosure are able to kill existing blood vessels associated with the tumors and thus are more potent in tumor treatment.

    3. Binding Agent/Receptor Interaction

    [0585] It was found that certain small molecule drug candidates and anti-PLXDC1 monoclonal antibodies can target PLXDC1 to kill pathogenic blood vessels. Further, these molecules can interact with PLXDC1 independently of Domain B, which is required for PEDF binding (FIG. 10).

    [0586] Similarly, it was found that antibody clones such as AA02, AA03, and AA94 interacted independently of domain B (FIG. 11), activated NF-B (FIG. 12) and also killed tumor endothelial cells (FIG. 5B-C. FIG. 6A). It is not surprising that PLXDC1, which has a large extracellular domain, has multiple sites for binding to factors and ligands.

    [0587] Many receptors are known to bind to different ligands. PEDF is known to bind to PLXDC1. Like all anti-angiogenic factors, PEDF can suppress angiogenesis, the growth of new blood vessels, but cannot kill existing blood vessels. In contrast, the compounds of the disclosure that target PLXDC1/PLXDC2 can kill tumor blood vessels.

    [0588] FIG. 4 shows a direct comparison between compounds of the disclosure, PEDF, and an anti-angiogenic agent, VEGF trap. In contrast to the PLXDC1/PLXDC2 modulators of the disclosure, PEDF, which interacts with Domain B of PLXDC1, didn't kill pathogenic blood vessels. In summary, it was found that antibodies and compounds of the disclosure were able to kill pathogenic blood vessels while PEDF, a natural ligand for PLXDC1/PLXDC2 and some current anti-angiogenic therapies, were not able to achieve this effect. This data exemplifies the importance of this novel therapeutic strategy for killing blood vessels and differentiates this strategy from current anti-angiogenic strategies that halt the development of new blood vessels.

    Example 2. Testing of Small Molecules in Mouse Model of Colon Cancer

    [0589] This example shows that the Ex Vivo Tumor Angiogenesis Model described in Example 1 is effective in screening for agents capable of killing tumor blood vessels.

    [0590] Select compounds from the following table were tested in the following examples.

    [0591] A tumor from xenograft mouse model of colon cancer (CT26.CL25) was grown using the method described in Example 1 to establish an ex vivo model of tumor angiogenesis. Treatment did not start until the new tumor endothelial cells had grown for 7 days. After drug treatment was done for two days, cell survival was assessed by a two-color assay using a mixture of fluorescein diacetate (green dye) and propidium iodide (red dye). Green cells represented live cells. Red cells represented dead cells. Orange cells represented a mixture of live and dead cells.

    [0592] The percent cell death is calculated according the ratio of the red area and total endothelial cell area.

    [0593] The activity of the tested compounds is provided in Table 4 below. Morphology observations after 48 hours are provided under the column 48 hrs, wherein: 0 indicates all cells have normal endothelial cell morphology (cells are elongated and connect to neighbor cells); * indicates 50% or less of cells vesicularize in cell shape; ** indicates more than 50% but less than 100% of endothelial cells vesicularize in cell shape; *** indicates 100% of endothelial cells vesicularize in cell shape; **** indicates 100% of endothelial cells vesicularize in cell shape and look flattened in morphology (indicating disintegration of the cell body). Vesicularization in cell shape indicates that the endothelial cells no longer have the elongated shape and no longer connect to neighbor cells.

    TABLE-US-00006 TABLE 4 Compound Colon CT26 ex vivo model of tumor angiogenesis No. 48 hrs Cell death Conc. (m) 42 0 0% 40 43 *** 90% 40 44 0 0% 40 45 0 0% 40 46 **** 100% 40 47 0 10% 40 48 0 10% 40 49 0 10% 40 50 *** 100% 40 51 *** 20% 40 52 0 0% 40 54 0 10% 40 55 0 50% 40 56 0 30% 40 57 * 60% 40 58 * 50% 40 59 0 50% 40 60 0 5% 40 61 0 20% 40 62 ** 70% 40 63 *** 70% 40 64 *** 100% 40 65 0 0% 40 66 0 0% 40 67 0 0% 40 68 ** 50% 40 69 0 0% 40 70 0 10% 40 71 0 0% 40 72 0 0% 40 73 0 0% 40 74 *** 100% 40 75 0 0% 40 76 ** 100% 40 77 0 40% 40 78 0 0% 40 79 *** 100% 10 80 *** 100% 10 81 0 0% 40 82 0 10% 40 84 * 100% 40 85 0 50% 40 86 *** 100% 10 87 0 0% 40 88 *** 60% 40 89 *** 100% 10 90 0 0% 40 91 *** 100% 10 92 0 0% 40 93 *** 100% 10 94 0 0% 40 95 0 0% 40 96 0 0% 10 97 *** 100% 10 98 *** 50% 10 99 0 0% 40 100 **** 100% 40 101 * 50% 20 102 0 5% 40 110 ** 10% 40 112 ** 10% 40 116 * 50% 20 117 *** 100% 20 118 *** 100% 20 119 0 50% 20 121 *** 40% 40 123 0 20% 40 124 0 20% 40 128 0 10% 40 129 0 0% 40 130 0 40% 40 131 ** 50% 40 132 * 40% 40 135 0 30% 40 136 0 30% 40 137 0 40% 40 138 0 20% 40 139 0 40% 40 140 ** 60% 40 144 0 30% 40 145 0 30% 40 146 0 0% 40 147 0 0% 40 148 0 0% 40 149 * 20% 40 150 0 10% 40 151 **** 100% 40 152 ** 30% 40 153 * 20% 40 154 * 30% 40 155 *** 20% 40 156 0 0% 40 157 **** 60% 40 158 **** 100% 40 159 **** 100% 40 160 **** 100% 40 161 **** 100% 40 162 *** 40 163 **** 100% 40 164 **** 100% 40 165 0 10% 40 166 *** 60% 40 191 0 10% 40 192 0 10% 40 201 * 10% 40 202 0 10% 40 206 **** 100% 40 207 **** 100% 40 208 0 20% 40 209 *** 90% 40 210 *** 70% 40 211 **** 100% 40 212 0 10% 40 214 **** 100% 40 215 0 20% 40 216 **** 100% 40 218 *** 90% 40 219 *** 90% 40 220 **** 100% 40 221 **** 100% 40 238 0 10% 10 241 0 0% 10 253 *** 80% 10 254 ** 40% 10 255 0 0% 10 256 *** 90% 10 257 **** 100% 10 258 *** 100% 10 259 *** 100% 20

    Example 3. Testing of Compounds in Mouse Lung Cancer Model

    [0594] This example tested the compounds of Example 2 in a mouse lung cancer model.

    [0595] A tumor from xenograft mouse model of lung cancer (LL/2) was grown using the methods described in Example 1 to establish an ex vivo model of tumor angiogenesis. Treatment did not start until the new tumor endothelial cells had grown for 5 days. After drug treatment was done for two days, cell survival was assessed by a two-color assay using a mixture of fluorescein diacetate (green dye) and propidium iodide (red dye). Green cells represented live cells. Red cells represented dead cells. Orange cells represented a mixture of live and dead cells. The percent cell death is calculated according the ratio of the red area and total endothelial cell area.

    [0596] The activity of the tested compounds is provided in Table 5 below. Morphology observations after 48 hours are provided under the column 48 hrs, wherein: 0 indicates all cells have normal endothelial cell morphology (cells are elongated and connect to neighbor cells); * indicates 50% or less of cells vesicularize in cell shape; *** indicates more than 50% but less than 100% of endothelial cells vesicularize in cell shape; *** indicates 100% of endothelial cells vesicularize in cell shape; **** indicates 100% of endothelial cells vesicularize in cell shape and look flattened in morphology (indicating disintegration of the cell body). Vesicularization in cell shape indicates that the endothelial cells no longer have the elongated shape and no longer connect to neighbor cells.

    TABLE-US-00007 TABLE 5 Lung LL2 ex vivo model of tumor angiogenesis No 48 hrs Cell death Conc. (m) 42 0 30% 40 43 *** 100% 40 44 ** 50% 40 45 ** 10% 40 46 **** 100% 40 47 0 50% 40 48 ** 60% 40 49 0 30% 40 50 *** 90% 40 51 **** 100% 40 52 ** 50% 40 54 0 50% 40 55 ** 70% 40 56 * 20% 40 57 0 40% 40 58 0 50% 40 59 0 40% 40 61 0 50% 40 62 *** 30% 40 63 ** 50% 40 64 *** 100% 40 65 0 10% 40 66 0 10% 40 67 0 10% 40 68 *** 80% 40 69 0 20% 40 70 *** 40% 40 71 * 10% 40 72 0 20% 40 73 0 10% 40 74 *** 60% 40 75 ** 80% 40 76 0 20% 40 77 ** 80% 40 78 0 40% 40 79 ** 20% 20 80 *** 100% 20 81 0 0% 40 82 0 60% 40 83 0 20% 40 84 ** 100% 40 85 0 80% 40 86 *** 100% 20 87 0 0% 40 88 0 70% 40 89 *** 100% 20 90 0 10% 40 91 *** 80% 20 92 0 10% 20 93 *** 100% 20 94 0 20% 40 95 0 10% 40 96 0 0% 20 97 ** 50% 20 98 ** 10% 20 99 0 10% 40 100 **** 100% 40 101 *** 100% 20 102 0 20% 20 103 0 10% 20 104 0 20% 20 105 0 0% 20 106 0 5% 20 107 0 0% 20 108 0 0% 20 109 0 0% 20 110 *** 95% 20 111 0 30% 20 112 *** 70% 20 113 0 10% 20 114 0 5% 20 115 0 10% 20 116 *** 100% 20 117 *** 100% 20 118 *** 100% 20 119 *** 100% 20 120 0 5% 20 121 ** 50% 40 122 0 10% 20 125 * 10% 20 126 0 10% 20 133 ** 10% 20 134 **** 20 141 **** 90% 20 142 **** 20 143 0 40% 40 151 **** 100% 40 152 * 20% 20 154 * 30% 40 155 *** 80% 40 156 ** 30% 40 157 *** 100% 40 158 **** 100% 40 159 **** 100% 40 160 **** 100% 40 161 **** 90% 40 162 *** 70% 40 163 **** 95% 40 164 **** 95% 40 165 * 10% 40 166 0 10% 40 167 0 40% 20 168 0 10% 20 169 0 40% 20 170 0 10% 20 171 0 40% 40 172 **** 100% 40 173 ** 50% 40 174 0 30% 40 175 0 30% 40 176 *** 100% 40 177 **** 100% 40 178 **** 100% 40 179 *** 60% 10 180 *** 70% 10 181 **** 100% 40 182 **** 100% 40 183 **** 100% 10 184 0 5% 10 185 * 30% 10 186 **** 90% 10 187 0 30% 40 191 0 30% 40 192 *** 60% 40 193 0 30% 40 195 0 40 196 0 30% 40 197 0 20% 40 198 0 30% 40 199 0 30% 40 200 0 30% 40 201 0 30% 40 202 ** 30% 40 206 0 30% 20 207 ** 20 208 0 50% 40 209 * 60% 40 210 0 50% 40 211 **** 100% 40 212 0 50% 40 213 0 30% 40 214 **** 100% 40 215 0 30% 40 216 **** 100% 40 217 0 30% 40 218 **** 100% 40 219 **** 60% 40 220 **** 100% 40 221 **** 100% 40 223 *** 30% (rim) 40 225 0 40% 40 226 * 10% 40 227 0 10% 40 228 0 5% 40 229 0 30% 40 230 *** 100% 40 231 *** 100% 40 232 0 10% 40 233 0 5% 40 234 *** 100% 40 235 0 10% 40 236 0 5% 40 237 *** 100% 40 238 *** 100% 40 239 0 40% 40 240 0 30% 40 241 0 40% 40 242 0 30% 40 243 0 20% 40 244 0 20% 40 245 0 40% 40 246 *** 95% 20 247 *** 60% 20 248 * 60% 20 249 *** 60% 20 250 *** 90% 20 251 *** 60% 20 253 **** 100% 20 254 *** 100% 20 255 * 10% 20 256 **** 100% 20 257 **** 100% 20 258 **** 100% 20 259 *** 95% 20 262 0 20% 10 263 **** 100% 10 264 * 20% 10 265 * 20% 10 266 0 5% 10 267 0 5% 10 268 *** 50% 20 269 **** 100% 20 270 * 50% 20 271 *** 60% 20 272 * 20% 20 273 *** 60% 20 274 0 10% 20 275 0 5% 20 276 *** 100% 20 277 ** 60% 10 278 * 50% 10 279 **** 100% 20 280 *** 100% 20 281 ** 50% 20 282 0 10% 10 283 0 5% 10 284 0 10% 10 285 *** 60% 10 286 0 0% 20 (24 hrs) (24 hrs) 287 * 40% 20 (24 hrs) (24 hrs) 288 *** 50% 10 289 ** 20% 20 290 *** 50% 10 291 * 10% 20 (24 hrs) (24 hrs) 292 * 10% 20 (24 hrs) (24 hrs) 294 * 50% 40 296 0 20% 40 300 0 20% 40 302 0 70% 40 306 0 40% 40 308 0 20% 40 310 0 10% 40 311 0 30% 40 312 **** 100% 40 317 0 30% 40 318 0 30% 40 320 0 30% 40 321 0 40% 40 322 0 30% 40 323 0 30% 40 324 0 60% 40 325 * 30% 40 326 0 30% 40 327 0 20% 40 328 0 30% 40 329 *** 40% 40 330 *** 50% 40 331 0 10% 40 332 0 0% 40 333 0 0% 40 336 0 0% 40 339 ** 50% 20 340 *** 60% 20 341 *** 80% 20 342 *** 60% 20 343 *** 50% 20 344 * 10% 20 345 *** 50% 20 346 * 20% 20 347 *** 30% 20 348 * 20% 20 350 0 20% 40 351 *** 100% 40 352 *** 100% 40 353 0 0% 40 354 0 0% 40 355 0 0% 40 356 0 0% 40 357 0 0% 40 358 0 0% 40 359 0 20% 40 360 0 20% 40 362 *** 20% 20 363 *** 30% 20 364 *** 30% 20 365 *** 20% 20 366 0 10% 20 367 0 5% 20 368 ** 20% 20 369 * 20% 20 370 ** 20% 20 371 *** 30% 20 372 ** 20% 20 373 * 20% 20 374 ** 20% 20 375 * 50% 20 376 0 10% 20 377 0 10% 20 378 *** 30% 20

    [0597] Certain other compounds described herein also showed activity in causing endothelial cell death in other angiogenesis assays.

    Example 4. Generation of PLXDC-Activating Antibodies

    [0598] This example describes the generation of monoclonal antibodies that bind and activate the PLXDC proteins.

    [0599] To the instant inventors' knowledge, no antibody drug exists that can active a cell-surface receptor. All existing antibody drugs are neutralizing antibodies that inhibit the ligand/receptor interaction, such as Humira (inhibiting TNF-, a ligand), Avastin (inhibiting VEGF, a ligand), Herceptin (inhibiting HER2, a receptor), and Keytruda (inhibiting PD-1, a receptor). It was, therefore, unexpected that the antibodies tested in Example 1 were able to activate PLXDC1, a single transmembrane cell-surface receptor. This example designed and tested a procedure that used it to obtain a large number of highly potent activating antibodies.

    [0600] At a first step, a customized human antibody library was created, which contained about 10 billion antibody clones. To screen for activating antibodies from this library, an screening assay was established with the human PLXDC1 protein (biotinylated at a biotin/PLXDC1 ratio of about 2.7) in the presence of an activating small molecule compound (e.g., compound 369 of Table 3).

    [0601] About 100 human antibody clones were identified with this method that preferentially bound to the small molecule-activated PLXDC1. The VH/VL sequences, and the corresponding CDR sequences of selected ones are presented in the tables below.

    TABLE-US-00008 TABLE6 SelectPLXDC1-ActivatingAntibodies SEQID Name Sequence NO: 1-A1_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFTSYAMSWVRQAPGKGLEWVSAISAG 4 GGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYDYNSYFDSW GQGTLVTVSS 1-A1_VL QSTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNNNR 5 PSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDRSLSGWVFGGGTKLTV L 1-A5_VH QVQLVESGGGVVQPGRSLRLSCAASGYAFSSYGMHWVRQAPGKGLEWVAVISHS 6 GSNKYYANSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLAGWEVYPF DVWGQGTLVTVSS 1-A5_VL QSTQPPSVSGAPGQRVTISCTGSSSNIGAGEDVHWYQQLPGTAPKLLIYDNTNR 7 PSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDYSLRVWVFGGGTKLTV L 1- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSTISGG 8 H10_VH GTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSRYWYTKLISYT YGMDVWGQGTLVTVSS 1- QSVLTQPPSVSGAPGQRVTISCTGSSSNIGATYDVHWYQQLPGTAPKLLIYVNN 9 H10_VL NRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLRAWVFGGGTKL TVL 2-B4_VH QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAVISYH 10 GRNEYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGDDQDAFDPW GQGTLVTVSS 2-B4_VL DIQMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQKPGKAPKLLIYAASSL 11 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSFSAPYTFGQGTKVEIK 2-B5_VH QVQLVESGGGVVQPGRSLRLSCAASGFIFSDYDMHWVRQAPGKGLEWVAVISHS 12 GSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRSVYLYYGY HYYEGFDVWGQGTLVTVSS 2-B5_VL EIVMTQSPATLSVSPGERATLSCRASQSVYNNLAWYQQKPGQAPRLLIYGASTR 13 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNDLPLTFGQGTKVEIK 2-F7_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSSIYTS 14 GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGYRYFDHWGQ GTLVTVSS 2-F7_VL EIVMTQSPATLSVSPGERATLSCRASQSVRNNLAWYQQKPGQAPRLLIYGASTR 15 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYYTWPRTFGQGTKVEIK 2-F8_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFPNYAMSWVRQAPGKGLEWVSTIYGR 16 GERTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVSVVWSYAFD YWGQGTLVTVSS 2-F8_VL DIQMTQSPSSLSASVGDRVTITCRASQDISTYLNWYQQKPGKAPKLLIYAASSL 17 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPLTFGQGTKVEIK 2-G4_VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSNYYWGWIRQPPGKGLEWIGSVY 18 YTGRTYYNPSLKSRVTISVDTSKNQFSLRLSSVTAADTAVYYCARVFPYGAVDV WGQGTLVTVSS 2-G4_VL EIVLTQSPGTLSLSPGERATLSCRASQSVSGSYLAWYQQKPGQAPRLLIYGASS 19 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGGSLPYTFGQGTKVEI K 2-H2_VH QVQLVESGGGVVQPGRSLRLSCAASGFTFSDYGMHWVRQAPGKGLEWVAVISYE 20 GSNEYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGSEGSGFDVW GQGTLVTVSS 2-H2_VL DIQMTQSPSSLSASVGDRVTITCRASQRISNYLNWYQQKPGKAPKLLIYAASSL 21 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSPPYTFGQGTKVEIK 2-H9_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSSIYGS 22 GGKTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARTDYSLYYQFD YWGQGTLVTVSS 2-H9_VL DIQMTQSPSSLSASVGDRVTITCRASQSISRYLNWYQQKPGKAPKLLIYAASSL 23 QSGVPSRFSGSGSGTDFTLTISSLQPEDLATYYCQQSYSYPVTFGQGTKVEIK 3-A7_VH QVQLVESGGGVVQPGRSLRLSCAASGFTFTNYGMHWVRQAPGKGLEWVAVISFD 24 GSNKYYANSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGDEDGFDVW GQGTLVTVSS 3-A7_VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSL 25 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYRPPYTFGQGTKVEIK 3-A9_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSSITGS 26 GEYTNYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREVADYWDGGV YYYYDGGFDVWGQGTLVTVSS 3-A9_VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYGASS 27 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGRSAPITFGQGTKVEI K 3-B3_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTISGT 28 GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVDHYSGYAFD LWGQGTLVTVSS 3-B3_VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSL 29 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPLTFGQGTKVEIK 3-C4_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTIYGG 30 GSYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARAEVDDYWYLY MDVWGQGTLVTVSS 3-C4_VL DIQMTQSPSSLSASVGDRVTITCRASQDIGNYLNWYQQKPGKAPKLLIYAASSL 31 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTFPLTFGQGTKVEIK 3-C6_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSTIYGS 32 GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARTDHYSYYVMD YWGQGTLVTVSS 3-C6_VL DIQMTQSPSSLSASVGDRVTITCRASQSISKYLNWYQQKPGKAPKLLIYSASSL 33 QSGVPSRFSGSGSGTDFTLTISSLQPEDCATYYCQQSYSFPLTFGQGTKVEIK 3-C8_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSAIYGS 34 GSYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARTAYSYPYVYF DFWGQGTLVTVSS 3-C8_VL DIQMTQSPSSLSASVGDRVTITCRASQTITSYLNWYQQKPGKAPKLLIYAASSL 35 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTYPLTFGQGTKVEIK 3-C9_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFGNYAMSWVRQAPGKGLEWVSVISGG 36 GTNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSDSYYGVYDG YYYGMDVWGQGTLVTVSS 3-C9_VL DIQMTQSPSSLSASVGDRVTITCRASQTISRYLNWHQQKPGKAPKLLIYAASSL 37 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQTYSTPWTFGQGTKVEIK 3- EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTIYAS 38 C11_VH GATTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLKLYHAAFDI WGQGTLVTVSS 3- DIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYTASSL 39 C11_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPLTFGQGTKVEIK 3- EVQLLESGGGLVQPGGSLRLSCAASGFTFRDYAMSWVRQAPGKGLEWVSTIYGS 40 C12_VH GSRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVDHVHGYAFD YWGQGTLVTVSS 3- DIQMTQSPSSLSASVGDRVTITCRASQSISKYLNWYQQKPGKAPKLLIYAASSL 41 C12_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSFPPTFGQGTKVEIK 3-D3_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSTIYES 42 GGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVESYGYGEYI TYNYYGFDVWGQGTLVTVSS 3-D3_VL EIVLTQSPGTLSLSPGERATLSCRASQSVATGYLAWYQQKPGQAPRLLIYGASS 43 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYESSPPFTFGQGTKVEI K 3-D6_VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFTSYGIHWVRQAPGQGLEWMGRIVPI 44 LGTTNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARDPAVTLDTYV YADHGFDVWGQGTLVTVSS 3-D6_VL EIVMTQSPATLSVSPGERATLSCRASQSVYNNLAWYQQKPGQAPRLLIYGASTR 45 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNDWPLTFGQGTKVEIK 3-D7_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFKNYAMSWVRQAPGKGLEWVSGISEG 46 GANTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREPPKYGAYSY YGYGFDPWGQGTLVTVSS 3-D7_VL EIVLTQSPGTLSLSPGERATLSCRASQSVGSNYLAWYQQKPGQAPRLLIYGASS 47 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPYTFGQGTKVEIK 3- EVQLLESGGGLVQPGGSLRLSCAASGFTFKGYAMSWVRQAPGKGLEWVSSISVS 48 D12_VH GAGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYVRGVSFDVW GQGTLVTVSS 3- EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASS 49 D12_VL RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYETSPPVTFGQGTKVEI K 3-E2_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAIGGS 50 GGGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYGWEYQAFDY WGQGTLVTVSS 3-E2_VL DIQMTQSPSSLSASVGDRVTITCRASQSISRYLNWYQQKPGKAPKLLIYAASSL 51 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPWTFGQGTKVEIK 3-E5_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGITAG 52 GGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIAGLFDGFDV WGQGTLVTVSS 3-E5_VL EIVLTQSPGTLSLSPGERATLSCRASQSVRSSYLAWYQQKPGQAPRLLIYGASS 53 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYASLPLTFGQGTKVEIK 3-E7_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGISAS 54 GGGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSSRYGDTFDV WGQGTLVTVSS 3-E7_VL EIVMTQSPATLSVSPGERATLSCRASLSVGSNLAWYQQKPGQAPRLLIYGASTR 55 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNLPLTFGQGTKVEIK 3-E8_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYAMSWVRQAPGKGLEWVSGISVS 56 GGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLYAHHTYYY GGFDYWGQGTLVTVSS 3-E8_VL EIVMTQSPATLSVSPGERATLSCRASQSVGSNLAWYQQKPGQAPRLLIYGASTR 57 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYHNWPPTFGQGTKVEIK 3-E9_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFRSYAMSWVRQAPGKGLEWVSTIYGT 58 GEDTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDYFWSPRGSI YDYDYFDVWGQGTLVTVSS 3-E9_VL DIQMTQSPSSLSASVGDRVTITCRASQSISRYLNWYQQKPGKAPKLLIYSASSL 59 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYFSAPYTFGQGTKVEIK 3-F5_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFKGYAMSWVRQAPGKGLEWVSSISVS 60 GAGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYVRGVSFDVW GQGTLVTVSS 3-F5_VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYGASS 61 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPAVTFGQGTKVEI K 3-F6_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSAISSS 62 GGTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDAGWSYYGLW IYYYYMDVWGQGTLVTVSS 3-F6_VL EIVLTQSPGTLSLSPGERATLSCRASQSVRSNYLAWYQQKPGQAPRLLIYGASS 63 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGASPQTFGQGTKVEIK 3- EVQLLESGGGLVQPGGSLRLSCAASGFTFKDYAMSWVRQAPGKGLEWVSGISGS 64 F12_VH GGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARKLGGFDENYT YGMDVWGQGTLVTVSS 3- EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASS 65 F12_VL RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPEYTFGQGTKVEI K 3-G4_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSGISAG 66 GGARTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVHHFGYYSL DVWGQGTLVTVSS 3-G4_VL DIQMTQSPSSLSASVGDRVTITCRASQTISNYLNWYQQKPGKAPKLLIYAASSL 67 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTYPLTFGQGTKVEIK 3-G5_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSVIYGS 68 GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHDPRYQLDVW GQGTLVTVSS 3-G5_VL DIQMTQSPSSLSASVGDRVTITCRASQSIGSYLNWYQQKPGKAPKLLIYTASSL 69 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTYPLTFGQGTKVEIK 3-G6_VH QVQLVESGGGVVQPGRSLRLSCAASGFTFSDYGMHWVRQAPGKGLEWVAVISYD 70 GSRKYYANSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGSYSDGFDVW GQGTLVTVSS 3-G6_VL DIQMTQSPSSLSASVGDRVTITCRASQSISRYLNWYQQKTGKAPKLLIYGASSL 71 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPYTFGQGTKVEIK 3-G7_VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSTEYISWVRQAPGQGLEWMGRIIPV 72 LGITNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARHLGPPYLVTY SHGFDVWGQGTLVTVSS 3-G7_VL EIVMTQSPATLSVSPGERATLSCRASQSLGTNLAWYQQKPGQAPRLLIYGASTR 73 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYYEAPPTFGQGTKVEIK 3-G8_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAIYGS 74 GGKTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLKYGFYQFDY WGQGTLVTVSS 3-G8_VL DIQMTQSPSSLSASVGDRVTITCRASQSIRNYLNWYEQKPGKAPKLLIYAASSL 75 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPLTFGQGTKVEIK 3-H1_VH EVQLLESGGGLVQPGGSLKLSCAASGFTFSNYAMSWVRQAPGKGLEWVSVIYAG 76 GARTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWGGDGFYAMD YWGQGTLVTVSS 3-H1_VL DIQMTQSPSSLSASVGDRVTITCRASQTISTYLNWYQQKPGKAPKLLIYAASIL 77 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTVPLTFGQGTKVEIK 3-H4_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISGS 78 GGTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKKYGSAGYT VGFDSWGQGTLVTVSS 3-H4_VL EIVMTQSPATLSVSPGERATLSCRASQSVGSYLAWYQQKPGQAPRLLIYGASTR 79 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYYNAPITFGQGTKVEIK 4-A7_VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSSYYWGWIRQPPGKGLEWIGNIY 80 YTGTTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARIKVPWYYSS YYFDYWGQGTLVTVSS 4-A7_VL QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNK 81 NRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDTSLSAWVFGGGTKL TVL 4-A8_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFKNYAMSWVRQAPGKGLEWVSAISAS 82 GGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGRWGAFDYWG QGTLVTVSS 4-A8_VL QSVLTQPPSVSGAPGQRVTISCTGSSSNIGSGYDVHWYQQLPGTAPKLLIYGNR 83 NRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLKTWVFGGGTKL TVL 4-B1_VH EVQLLESGGGLVQPGGSLKLSCAASGFTFSDYAMSWVRQAPGKGLEWVSGISRG 84 GARTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYLFGHYMDWG QGTLVTVSS 4-B1_VL QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNT 85 NRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDGRLGVSVFGGGTKL TVL 4-B2_VH QVQLVESGGGVVQPGRSLRLSCAASGFTFSRYAMHWVRQAPGKGLEWVAVISHS 86 GSTKYYANSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSRGWRGFDSW GQGTLVTVSS 4-B2_VL QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAYVVHWYQQLPGTAPKLLIYGNTN 87 RPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDRTLSSYVFGGGTKLT VL 4- QVQLVESGGGVVQPGRSLRLSCAASGFAFSGYGMHWVRQAPGKGLEWVAVISHH 88 B11_VH GSYKYYANSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGADVGYFYS TFYYYMDVWGQGTLVTVSS 4- QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAAFDVHWYQQLPGTAPKLLIYDNY 89 B11_VL NRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSVWVFGGGTKL TVL 4- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISRG 90 D12_VH GGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWGGDGFYAMD YWGQGTLVTVSS 4- QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYANN 91 D12_VL NRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDYSLSGWVFGGGTKL TVL 4-F4_VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSRGYYWAWIKQPPGKGLEWIGSIY 92 YSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARLVSYGAYYV FDYWGQGTLVTVSS 4-F4_VL QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNR 93 NRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDTRLSAWVFGGGTKL TVL 4- EVQLLESGGGLVRPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGS 94 G12_VH GGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDKRLTYWGQG TMVTVSS 4- QSVVTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNK 95 G12_VL RPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSARVFGGGTKVT VL 5-C9_VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAINWVRQAPGQGLEWMGRIIPL 96 LETADYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREWPGEYFDVW GQGTLVTVSS 5-C9_VL EIVLTQSPGTLSLSPGERATLSCRASQSVASSYLAWYQQKPGQAPRLLIYGASS 97 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSQLTFGQGTKVEIK 5-E2_VH QVQLVESGGGVVQPGRSLRLSCAASGFTFRDYGMHWVRQAPGKGLEWVAVISYH 98 GRNEYYANSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGAYGDDFDVW GQGTLVTVSS 5-E2_VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKTGKAPKLLIYAASSL 99 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSAPYTFGQGTKVEIK 5- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSTISGG 100 E12_VH GRTTNYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSTPIPSYYPY IYSYYFDVWGQGTLVTVSS 5- EIVMTQSPATLSVSPGERATLSCRASQSVSNNLAWYQQKPGQAPRLLIYGASTR 101 E12_VL ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYGNYPPTFGQGTKVEIK 6-G4_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSSISSS 102 GANTYYADSGKGRFTISRDNSKNILYLQMNSLRAEDTAVYYCARSVVTWVTYAF DYWGQGTLVTVSS 6-G4_VL QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYDNT 103 NRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSGLSGWVFGGGTKL TVL 6-H5_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISAT 104 GGATYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSVRERYTYYM DYWGQGTLVTVSS 6-H5_VL QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYDNT 105 NRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDVSLGVWVFGGGTKL TVL 8-A2_VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYYISWVRQAPGQGLEWMGGIIPV 106 FGVAHYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGYPGEYFDYW GQGTLVTVSS 8-A2_VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYAASS 107 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYGGSPGYTFGQGTKVEI K 8-A4_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFGSYAMSWVRQAPGKGLEWVSSIYAG 108 GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWGGDGFYAMD YWGQGTLVTVSS 8-A4_VL DIQMTQSPSSLSASVGDRVTITCRASQTISNYLNWYQQKPGKAPKLLIYGASSL 109 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSFTFPLTFGQGTKVEIK 8-A6_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSTIYSG 110 GVRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLVSFRGYAF DYWGQGTLVTVSS 8-A6_VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSL 111 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTIPPTFGQGTKVEIK 8-A7_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFRNYAMSWVRQAPGKGLEWVSSISGG 112 GINTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVRSYSGPGYF DYWGQGTLVTVSS 8-A7_VL EIVMTQSPATLSVSPGDRATLSCRASRSVSSNLAWYQQKPGQAPRLLIYGASTR 113 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYYNWPLTFGQGTKVEIK 8-A8_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSVIYGS 114 GARTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARISPHYDFDVW GQGTLVTVSS 8-A8_VL DIQMTQSPSSLSASVGDRVTITCRASQTISKYLNWYQQKPGKAPKLLIYAASSL 115 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPITFGQGTKVEIK 8-A9_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISGG 116 GSRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREARVLGYSLD YWGQGTLVTVSS 8-A9_VL DIQMTQSPSSLSASVGDRVTITCRASQRIGKYLNWYQQKPGKAPKLLIYAASSL 117 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPLTFGQGTKVEIK 8-C4_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAIYGS 118 GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLRYGFYQFDY WGQGTLVTVSS 8-C4_VL DIQMTQSPSSLSASVGDRVTITCRASQSIRNYLNWYEQKPGKAPKLLIYAASSL 119 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPLTFGQGTKVEIK 8-C6_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYAMSWVRQAPGKGLEWVSTIYSS 120 GHRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLYPLHSYAFD HWGQGTLVTVS 8-C6_VL DIQMTQSHSSLSASVGDRVTITCRASQSISRYLNWYQQKPGKAPKLLIYAASSL 121 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSVPLTFGQGTKVEIK 8-C9_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFKSYAMSWVRQAPGKGLEWVSLISSS 122 GENTYYADSVKGRFISRDNSKNTLYLQMNSLRAEDTAVYYCARVRFGYGSWRY RKYMDVWGQGTLVTVSS 8-C9_VL DIQMTQSPSSLSASVGDRVTITCRASQSIATYLNWYQQKPGKAPKLLIYGASSL 123 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPLTFGQGTKVEIK 8- EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTISAS 124 C10_VH GATYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGPYSYYYYSFD YWGQGTLVTVSS 8- DIQMTQSPSSLSASVGDRVTITCRASQTISTYLNWYQQKPGKAPKLLIYAASSL 125 C10_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYRYPLTFGQGTKVEIK 8- EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTIYVG 126 C11_VH GHRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVGWSWGFDPW GQGTLVTVSS 8- DIQMTQSPSSLSASVGDRVTITCRASQTISKYLNWYQQKPGKAPKLLIYSASSL 127 C11_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTYPLTFGQGTKVEIK 8- EVQLVESGGGLVKPGGSLRLSCAASGFTFTNAWMSWVRQAPGKGLEWVGRIKSI 128 D11_VH TEGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARVWHTDDYY EGFDVWGQGTLVTVSS 8- EIVLTQSPGTLSLSPGERATLSCRASQSVSGSYLAWYQQKPGQAPRLLIYDASS 129 D11_VL RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTTPQTFGQGTKVEIK 8-D4_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFRSYAMSWVRQAPGKGLEWVSTIYGS 130 GARTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWGGDGFYAMD YWGQGTLVTVSS 8-D4_VL DIQMTQSPSSLSASVGDRVTITCRASQSIYTYLNWYQQKPGKAPKLLIYAASSL 131 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSFPLTFGQGTKVEIK 8-D7_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSGISTS 132 GGTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVVGRAVFDIW GQGTLVTVSS 8-D7_VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSTYLAWYQQKPGQAPRLLIYAASS 133 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYAALPITFGQGTKVEIK 8-E2_VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSDEAIHWVRQAPGQGLEWMGRIIPV 134 LGIASYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGLSRKAFYFD YWGQGTLVTVSS 8-E2_VL DIQMTQSPSSLSASVGDRVTITCRASQTIGNYLNWYQQKPGKAPKLLIYVASSL 135 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYRYPYTFGQGTKVEIK 8-E3_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSTIYRG 136 AGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDASWYGPFSYY YYYGFDVWGQGTLVTVSS 8-E3_VL EIVMTQSPATLSVSPGERATLSCRASQSVYTNLAWYQQKPGQAPRLLIYDASTR 137 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNDWPLTFGQGTKVEIK 8-E9_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSIITES 138 GVNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHPSVGSASRS YYFDVWGQGTLVTVSS 8-E9_VL EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYAASS 139 RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYYSAPLTFGQGTKVEIK 8-F1_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYAMSWVRQAPGKGLEWVSGISGS 140 GGVGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGEYGSSIAY SYYYGFDVWGQGTLVTVSS 8-F1_VL EIVMTQSPATLSVSPGERATLSCRASQSVYNNLAWYQQKPGQAPRLLIYDASTR 141 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNDWPYTFGQGTKVEIK 8-F2_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISGG 142 GSRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREARVLGYSLD YWGQGTLVTVSS 8-F2_VL DIQMTQSPSSLSASVGDRVTITCRASQRIGKYLNWYQQKPGKAPKLLIYAASSL 143 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPLTFGQGTKVEIK 8-F4_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSAIRGG 144 GGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVGPLRLYGFDY WGQGTLVTVSS 8-F4_VL DIQMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQKPGKAPKLLIYAASSL 145 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPLTFGQGTKVEIK 8-F6_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSVISGS 146 GGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREVRHDSYYYY YYSGMDVWGQGTLVTVSS 8-F6_VL EIVMTQSPATLSVSPGERATLSCRASQSVYNNLAWYQQKPGQAPRLLIYDASTR 147 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYSDYPFTFGQGTKVEIK 8- QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYAINWVRQAPGQGLEWMGRIIPT 148 F11_VH LGIANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARAAYFAGPAAR YGYFDIWGQGTLVTVSS 8- EIVLTQSPGTLSLSPGERATLSCRASQSVRSNYLAWYQQKPGQAPRLLIYDASS 149 F11_VL RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYAYAPWTFGQGTKVEIK 8- EVQLLESGGGLVQPGGSLRLSCAASGFTFRGYAMSWVRQAPGKGLEWVSSISVS 150 G12_VH GAGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYVRGVSFDVW GQGTLVTVSS 8- EIVLTQSPGTLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYGASS 151 G12_VL RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPAVTFGQGTKVEI K 8-H7_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAIYGS 152 GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLRYGFYQFDY WGQGTLVTVSS 8-H7_VL DIQMTQSPSSLSASVGDRVTITCRASQSIRNYLNWYEQKPGKAPKLLIYAASSL 153 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPLTFGQGTKVEIK 9-A6_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSTIYSG 154 GVRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLVSFRGYAF DYWGQGTLVTVSS 9-A6_VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSL 155 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTIPPTFGQGTKVEIK 9-B3_VH QVQLVESGGGVVQPGRSLRLSCAASGFTFSDYGMHWVRQAPGKGLEWVAVISYD 156 GSRKYYANSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGSYSDGFDVW GQGTLVTVSS 9-B3_VL DIQMTQSPSSLSASVGDRMTITCRASQSISNYLNWYQQKPGKAPKLLIYAASSL 157 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYAPPYTFGQGTKVEIK 9- EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSGISES 158 B10_VH GGGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLVPWQLAFDV WGQGTLVTVSS 9- EIVMTQSPATLSVSPGERATLSCRASQSVYNNLAWYQQKPGQAPRLLIYDASTR 159 B10_VL ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYYYWPITFGQGTKVEIK 9-C2_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSVISGS 160 GGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREVRHDSYYYY YYSGMDVWGQGTLVTVSS 9-C2_VL EIVMTQSPATLSVSPGERATLSCRASQSVYNNLAWYQQKPGQAPRLLIYDASTR 161 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYSDYPFTFGQGTKVEIK 9-D8_VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSEAISWVRQAPGQGLEWMGRIIPI 162 SGRPNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAREASYYVAGYY RYYGFDVWGQGTLVTVSS 9-D8_VL EIVMTQSPATLSVSPGERATLSCRASRSLSNNLAWYQQKPGQAPRLLIYDASTR 163 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNAWPYTFGQGTKVEIK 9-E4_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSVISGS 164 GGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREVRHDSYYYY YYSGMDVWGQGTLVTVSS 9-E4_VL EIVMTQSPATLSVSPGERATLSCRASQSVYNNLAWYQQKPGQAPRLLIYDASTR 165 ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYSDYPFTFGQGTKVEIK 9-E5_VH QVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSK 166 IEGGTTDYAPPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCARDPTWYVSG HYYGFDVWGQGTLVTVSS 9-E5_VL DIQMTQSPSSLSASVGDRVTITCRASQSIANYLNWYQQKPGKAPKLLIYAASSL 167 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYFSTPPTFGQGTKVEIK 9-G1_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFGNYAMSWVRQAPGKGLEWVSTISAG 168 GSRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGWYPILYYAF DYWGQGTLVTVSS 9-G1_VL DIQMTQSPSSLSASVGDRVTITCRASQSIGNYLNWYQQKPGKAPKLLIYSASSL 169 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQTYTIPLTFGQGTKVEIK 9-G3_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTIYRS 170 GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGAYPLGSYYG FDPWGQGTLVTVSS 9-G3_VL DIQMTQSPSSLSASVGDRVTITCRASQSIATYLNWYQQKPGKAPKLLIYAASSL 171 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTYPVTFGQGTKVEIK 9-H9_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSTIYGS 172 GVRTYYADGVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGWIPHSFYAF DYWGQGTLVTVSS 9-H9_VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYGASSL 173 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSFTAPVTFGQGTKVEIK 2-C8_VH EVQLLESGGGLVQPGGSLRLSCAASGFTFTNYAMSWVRQAPGKGLEWVSSISGS 174 GISTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGPGPGYWYAF DVWGQGTLVTVSS 2-C8_VL DIQMTQSPSSLSASVGDRVTITCRASQTISRYLNWYQQKPGKAPKLLIYAASSL 175 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTYPITFGQGTKVEIK 8-D9_VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSDEAIHWVRQAPGQGLEWMGRIIPV 176 LGIASYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGLSRRAFYFD YWGQGTLVTVSS 8-D9_VL DIQMTQSPSSLSASVGDRVTITCRASQTIGNYLNWYQQKPGKAPKLLIYVASSL 177 QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYRYPYTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFTNYAMSWVRQAPGKGLEWVSSISGS 178 A9_VH GISTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGPGPGYWYAF DVWGQGTLVTVSS 10- DIQMTQSPSSLSASVGDRVTITCRASQTISRYLNWYQQKPGKAPKLLIYSASSL 179 A9_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTYPITFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSTIYSG 180 B2_VH GVRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLVSFKGYAF DYWGQGTLVTVSS 10- DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSL 181 B2_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTIPPTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAIYGA 182 B5_VH GGKTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARISHGWGFDVW GQGTLVTVSS 10- DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLLIYAASSL 183 B5_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTYPLTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSVIYGS 184 C1_VH GTRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVASSYHYAFD YWGQGTLVTVSS 10- DIQMTQSPSSLSASVGDRVTITCRASQSISTYLNWYQQKPGKAPKLLIYAASSL 185 C1_VL QSGVSSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTFPLTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSVIYGS 186 C3_VH GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVEDTSYYGMD YWGQGTLVTVSS 10- DIQMTQSPSSLSASVGDRVTITCRASQTIGIYLNWYQQKPGKAPTLLIYAASSL 187 C3_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTYPLTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAIYGS 188 C9_VH GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLEAGFYSLDI WGQGTLVTVSS 10- DIQMTQSPSSLSASVGDRVTITCRASQTIGTYLNWYQQKPGKAPKLLIYAASSL 189 C9_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSYPLTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLKLSCAASGFTFGSYAMSWVRQAPGKGLEWVSVISSG 190 C11_VH GSYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVSGVVGALDI WGQGTLVTVSS 10- EIVMTQSPATLSVSPGERATLSCRASQSVSNNLAWYQQKPGQAPRLLIYGASTR 191 C11_VL ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPYTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSTIYSS 192 D7_VH GSRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWGGDGFYAMD YWGQGTLVTVSS 10- DIQMTQSPSSLSASVGDRVTITCRASQSISTYLNWYQQKPGKAPKLLIYAASSL 193 D7_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTVPLTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSTIYSG 194 E1_VH GVRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLVSFKGYAF DYWGQGTLVTVSS 10- DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSL 195 E1_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTIPPTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAIYGS 196 E6_VH GGDTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARTEYDGYFDVW GQGTLVTVSS 10- DIQMTQSPSSLSASVGDRVTITCRASQDIYNYLNWYQQKPGKAPKLLIYGASSL 197 E6_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSDGFPPTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFTDYAMSWVRQAPGKGLEWVSVIYGS 198 E7_VH GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVEDSHYSFDV WGQGTLVTVSS 10- DIQMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQKPGKAPKLLIYAASSL 199 E7_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTVPWTFGQGTKVEIK 10- QVQLVESGGGVVQPGRSLRLSCAASGFPFSDYAMHWLRQAPGKGLEWVAVISYD 200 F11_VH GNIEYYANSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRIGSSTYYG YYNGFDVWGQGTLVTVSS 10- EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTR 201 F11_VL ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNDYPLTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAIKGS 202 F12_VH GGGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGYLWLDPWG QGTLVTVSS 10- EIVMTQSPATLSVSPGERATLSCRASQSISSNLAWYQQKPGQAPRLLIYDASTR 203 F12_VL ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYYNWPLTFGQGTKVEIK 10- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAISGS 204 G5_VH GTYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVRISGYGPGY FGGFDVWGQGTLVTVSS 10- EIVMTQSPATLSVSPGERATLSCRASQSVYSNLAWYQQKPGQAPRLLIYGASTR 205 G5_VL ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYSNWPLTFGQGTKVEIK 11- EVQLLESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSIISGT 206 B6_VH GGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIDTFAYYYSL YRAFDLWGQGTLVTVSS 11- EIVMTQSPATLSVSPGERATLSCRASQSVGGNLAWYQQKPGQAPRLLIYDASTR 207 B6_VL ATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNDWPLTFGQGTKVEIK 11- EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSSISEG 208 D8_VH GGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARTKRYFAGGSY YWMDVWGQGTLVTVSS 11- DIQMTQSPSSLSASVGDRVTITCRASQRISSYLNWYQQKPGKAPKLLIYAASSL 209 D8_VL QSGVPSRFSGSGSGTDFALTISSLQPEDFATYYCQQSYSYPITFGQGTKVEIK 11- EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSVISGG 210 D10_VH SGHTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHGGGRFAMD VWGQGTLVTVSS 11- EIVLTQSPGTLSLSPGERATLSCRASQSVASPYLAWYQQKPGQAPRLLIYGASS 211 D10_VL RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYYESPITFGQGTKVEIK 11- EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSSISGS 212 D11_VH GGKTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDIYGITYDGY TYYDGMDVWGQGTLVTVSS 11- DIQMTQSPSSLSASVGDRVTITCRASQSIYNYLNWHQQKPGKAPKLLIYAASSL 213 D11_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSDSPPWTFGQGTKVEIK 11- QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYYISWVRQAPGQGLEWMGGIIPV 214 G2_VH FGVAHYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGYPGEYFDYW GQGTLVTVSS 11- EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYAASS 215 G2_VL RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYGGSPGYTFGQGTKVEI K 11- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSTISGS 216 G5_VH GANTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHHDIAPSWIY YFDYWGQGTLVTVSS 11- EIVLTQSPGTLSLSPGERATLSCRARQSVPSNYLAWYQQKPGQAPRLLIYGASS 217 G5_VL RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYYSSPLTFGQGTKVEIK 11- EVQLLESGGGLVQPGGSLRLSCAASGFTFPDYAMSWVRQAPGKGLEWVSTIYAG 218 G9_VH GGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLTRHYGYSF DHWGQGTLVTVSS 11- DIQMTQSPSSLSASVGDRVTITCRASQTISSYLNWYQQKPGKAPKLLIYSASSL 219 G9_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTFPLTFGQGTKVEIK 11- EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSSIYGS 220 H8_VH GHRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVASSAEYAFD HWGQGTLVTVSS 11- DIQMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQKSGKAPKLLIYAASSL 221 H8_VL QSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTVPLTFGQGTKVEIK 11- EVQLLESGGGLVQPGGSLRLSCAASGFTFKNYAMSWVRQAPGKGLEWVSGISEG 222 H11_VH GANTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREPPKYGAYSY YGYGFDPWGQGTLVTVSS 11- EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASS 223 H11_VL RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSSSPTYTFGQGTKVEI K

    TABLE-US-00009 TABLE7 CDRSequencesoftheAntibodies(Kabat) SEQ SEQ SEQ ID ID ID Name CDR1 NO: CDR2 NO: CDR3 NO: 1-A1_VH SYAMS 224 AISAGGGYTYYADSVKG 248 YDYNSYFDS 341 1-A5_VH SYGMH 225 VISHSGSNKYYANSVKG 249 GLAGWEVYPFDV 342 1-H10_VH NYAMS 226 TISGGGTYYADSVKG 250 SRYWYTKLISYTYGMDV 343 2-B4_VH NYGMH 227 VISYHGRNEYYADSVKG 251 GDDQDAFDP 344 2-B5_VH DYDMH 228 VISHSGSNKYYADSVKG 252 DRSVYLYYGYHYYEGFDV 345 2-F7_VH DYAMS 229 SIYTSGGRTYYADSVKG 253 GYRYFDH 346 2-F8_VH NYAMS 226 TIYGRGERTYYADSVKG 254 VSVVWSYAFDY 347 2-G4_VH SSNYYWG 230 SVYYTGRTYYNPSLKS 255 VFPYGAVDV 348 2-H2_VH DYGMH 231 VISYEGSNEYYADSVKG 256 GSEGSGFDV 349 2-H9_VH TYAMS 232 SIYGSGGKTYYADSVKG 257 TDYSLYYQFDY 350 3-A7_VH NYGMH 227 VISFDGSNKYYANSVKG 258 GGDEDGFDV 351 3-A9_VH NYAMS 226 SITGSGEYTNYADSVKG 259 EVADYWDGGVYYYYDGGF 352 DV 3-B3_VH SYAMS 224 TISGTGGRTYYADSVKG 260 VDHYSGYAFDL 353 3-C4_VH SYAMS 224 TIYGGGSYTYYADSVKG 261 AEVDDYWYLYMDV 354 3-C6_VH TYAMS 232 TIYGSGGRTYYADSVKG 262 TDHYSYYVMDY 355 3-C8_VH DYAMS 229 AIYGSGSYTYYADSVKG 263 TAYSYPYVYFDF 356 3-C9_VH NYAMS 226 VISGGGTNTYYADSVKG 264 SDSYYGVYDGYYYGMDV 357 3-C11_VH SYAMS 224 TIYASGATTYYADSVKG 265 LKLYHAAFDI 358 3-C12_VH DYAMS 229 TIYGSGSRTYYADSVKG 266 VDHVHGYAFDY 359 3-D3_VH NYAMS 226 TIYESGGYTYYADSVKG 267 VESYGYGEYITYNYYGFD 360 V 3-D6_VH SYGIH 233 RIVPILGTTNYAQKFQG 268 DPAVTLDTYVYADHGFDV 361 3-D7_VH NYAMS 226 GISEGGANTYYADSVKG 269 EPPKYGAYSYYGYGFDP 362 3-D12_VH GYAMS 234 SISVSGAGTYYADSVKG 270 YVRGVSFDV 363 3-E2_VH NYAMS 226 AIGGSGGGTYYADSVKG 271 YGWEYQAFDY 364 3-E5_VH NYAMS 226 GITAGGGNTYYADSVKG 272 IAGLFDGFDV 365 3-E7_VH NYAMS 226 GISASGGGTYYADSVKG 273 SSRYGDTFDV 366 3-E8_VH DYAMS 229 GISVSGGYTYYADSVKG 274 GLYAHHTYYYGGFDY 367 3-E9_VH SYAMS 224 TIYGTGEDTYYADSVKG 275 DYFWSPRGSIYDYDYFDV 368 3-F5_VH GYAMS 234 SISVSGAGTYYADSVKG 270 YVRGVSFDV 363 3-F6_VH DYAMS 229 AISSSGGTTYYADSVKG 276 DAGWSYYGLWIYYYYMDV 369 3-F12_VH DYAMS 229 GISGSGGYTYYADSVKG 277 KLGGFDENYTYGMDV 370 3-G4_VH TYAMS 232 GISAGGGARTYYADSVKG 278 VHHFGYYSLDV 371 3-G5_VH SYAMS 224 VIYGSGGRTYYADSVKG 279 HDPRYQLDV 372 3-G6_VH DYGMH 231 VISYDGSRKYYANSVKG 280 GSYSDGFDV 373 3-G7_VH TEYIS 235 RIIPVLGITNYAQKFQG 281 HLGPPYLVTYSHGFDV 374 3-G8_VH NYAMS 226 AIYGSGGKTYYADSVKG 282 LKYGFYQFDY 375 3-H1_VH NYAMS 226 VIYAGGARTYYADSVKG 283 WGGDGFYAMDY 376 3-H4_VH NYAMS 226 AISGSGGTTYYADSVKG 284 IKKYGSAGYTVGFDS 377 4-A7_VH SSSYYWG 236 NIYYTGTTYYNPSLKS 285 IKVPWYYSSYYFDY 378 4-A8_VH NYAMS 226 AISASGGYTYYADSVKG 286 GRWGAFDY 379 4-B1_VH DYAMS 229 GISRGGARTYYADSVKG 287 YLFGHYMD 380 4-B2_VH RYAMH 237 VISHSGSTKYYANSVKG 288 SRGWRGFDS 381 4-B11_VH GYGMH 238 VISHHGSYKYYANSVKG 289 GGADVGYFYSTFYYYMDV 382 4-D12_VH NYAMS 226 AISRGGGYTYYADSVKG 290 WGGDGFYAMDY 376 4-F4_VH SRGYYWA 239 SIYYSGSTYYNPSLKS 291 LVSYGAYYVFDY 383 4-G12_VH SYAMS 224 AISGSGGSTYYADSVKG 292 DKRLTY 384 5-C9_VH SYAIN 240 RIIPLLETADYAQKFQG 293 EWPGEYFDV 385 5-E2_VH DYGMH 231 VISYHGRNEYYANSVKG 294 GAYGDDFDV 386 5-E12_VH NYAMS 226 TISGGGRTTNYADSVKG 293 STPIPSYYPYIYSYYFDV 387 6-G4_VH DYAMS 229 SISSSGANTYYADSGKG 296 SVVTWVTYAFDY 388 6-H5_VH NYAMS 226 AISATGGATYYADSVKG 297 SVRERYTYYMDY 389 8-A2_VH NYYIS 241 GIIPVFGVAHYAQKFQG 298 GYPGEYFDY 390 8-A4_VH SYAMS 224 SIYAGGGRTYYADSVKG 299 WGGDGFYAMDY 376 8-A6_VH DYAMS 229 TIYSGGVRTYYADSVKG 300 GLVSFRGYAFDY 391 8-A7_VH NYAMS 226 SISGGGINTYYADSVKG 301 VRSYSGPGYFDY 392 8-A8_VH NYAMS 226 VIYGSGARTYYADSVKG 302 ISPHYDFDV 393 8-A9_VH NYAMS 226 AISGGGSRTYYADSVKG 303 EARVLGYSLDY 394 8-C4_VH NYAMS 226 AIYGSGGRTYYADSVKG 304 LRYGFYQFDY 395 8-C6_VH DYAMS 229 TIYSSGHRTYYADSVKG 305 LYPLHSYAFDH 396 8-C9_VH SYAMS 224 LISSSGENTYYADSVKG 306 VRFGYGSWRYRKYMDV 397 8-C10_VH SYAMS 224 TISASGATYYADSVKG 307 GPYSYYYYSFDY 398 8-C11_VH SYAMS 224 TIYVGGHRTYYADSVKG 308 VGWSWGFDP 399 8-D11_VH NAWMS 242 RIKSITEGGTTDYAAPVKG 309 VWHTDDYYEGFDV 400 8-04_VH SYAMS 224 TIYGSGARTYYADSVKG 310 WGGDGFYAMDY 376 8-07_VH SYAMS 224 GISTSGGTTYYADSVKG 311 VVGRAVFDI 401 8-E2_VH DEAIH 243 RIIPVLGIASYAQKFQG 312 GLSRKAFYFDY 402 8-E3_VH NYAMS 226 TIYRGAGTYYADSVKG 313 DASWYGPFSYYYYYGFDV 403 8-E9_VH DYAMS 229 IITESGVNTYYADSVKG 314 HPSVGSASRSYYFDV 404 8-F1_VH DYAMS 229 GISGSGGVGTYYADSVKG 313 GEYGSSIAYSYYYGFDV 405 8-F2_VH NYAMS 226 AISGGGSRTYYADSVKG 303 EARVLGYSLDY 394 8-F4_VH GYAMS 234 AIRGGGGTYYADSVKG 316 VGPLRLYGFDY 406 8-F6_VH SYAMS 224 VISGSGGNTYYADSVKG 317 EVRHDSYYYYYYSGMDV 407 8-F11_VH NYAIN 244 RIIPTLGIANYAQKFQG 318 AAYFAGPAARYGYFDI 408 8-G12_VH GYAMS 234 SISVSGAGTYYADSVKG 270 YVRGVSFDV 363 8-H7_VH NYAMS 226 AIYGSGGRTYYADSVKG 304 LRYGFYQFDY 395 9-A6_VH DYAMS 229 TIYSGGVRTYYADSVKG 300 GLVSFRGYAFDY 391 9-B3_VH DYGMH 231 VISYDGSRKYYANSVKG 280 GSYSDGFDV 373 9-B10_VH SYAMS 224 GISESGGGTYYADSVKG 319 LVPWQLAFDV 409 9-C2_VH SYAMS 224 VISGSGGNTYYADSVKG 317 EVRHDSYYYYYYSGMDV 407 9-D8_VH SEAIS 245 RIIPISGRPNYAQKFQG 320 EASYYVAGYYRYYGFDV 410 9-E4_VH SYAMS 224 VISGSGGNTYYADSVKG 317 EVRHDSYYYYYYSGMDV 407 9-E5_VH NAWMS 242 RIKSKIEGGTTDYAPPVKG 321 DPTWYVSGHYYGFDV 411 9-G1_VH NYAMS 226 TISAGGSRTYYADSVKG 322 GWYPILYYAFDY 412 9-G3_VH SYAMS 224 TIYRSGGRTYYADSVKG 323 GAYPLGSYYGFDP 413 9-H9_VH NYAMS 226 TIYGSGVRTYYADGVKG 324 GWIPHSFYAFDY 414 2-C8_VH NYAMS 226 SISGSGISTYYADSVKG 323 GPGPGYWYAFDV 415 8-D9_VH DEAIH 243 RIIPVLGIASYAQKFQG 312 GLSRRAFYFDY 416 10-A9_VH NYAMS 226 SISGSGISTYYADSVKG 325 GPGPGYWYAFDV 415 10-B2_VH DYAMS 229 TIYSGGVRTYYADSVKG 300 GLVSFKGYAFDY 417 10-B5_VH SYAMS 224 AIYGAGGKTYYADSVKG 326 ISHGWGFDV 418 10-C1_VH NYAMS 226 VIYGSGTRTYYADSVKG 327 VASSYHYAFDY 419 10-C3_VH NYAMS 226 VIYGSGGRTYYADSVKG 279 VEDTSYYGMDY 420 10-C9_VH NYAMS 226 AIYGSGGRTYYADSVKG 304 LEAGFYSLDI 421 10- SYAMS 224 VISSGGSYTYYADSVKG 328 VSGVVGALDI 422 C11_VH 10-D7_VH NYAMS 226 TIYSSGSRTYYADSVKG 329 WGGDGFYAMDY 376 10-E1_VH DYAMS 229 TIYSGGVRTYYADSVKG 300 GLVSFKGYAFDY 417 10-E6_VH SYAMS 224 AIYGSGGDTYYADSVKG 330 TEYDGYFDV 423 10-E7_VH DYAMS 229 VIYGSGGRTYYADSVKG 279 VEDSHYSFDV 424 10- DYAMH 246 VISYDGMIEYYANSVKG 331 DRIGSSTYYGYYNGFDV 425 F11_VH 10- NYAMS 226 AIKGSGGGTYYADSVKG 332 GGYLWLDP 426 F12_VH 10-G5_VH NYAMS 226 AISGSGTYTYYADSVKG 333 VRISGYGPGYFGGFDV 427 11-B6_VH RYAMS 247 IISGTGGNTYYADSVKG 334 IDTFAYYYSLYRAFDL 428 11-D8_VH DYAMS 229 SISEGGGSTYYADSVKG 335 TKRYFAGGSYYWMDV 429 11- SYAMS 224 VISGGSGHTTYYADSVKG 336 HGGGRFAMDV 430 D10_VH 11- TYAMS 232 SISGSGGKTYYADSVKG 337 DIYGITYDGYTYYDGMDV 431 D11_VH 11-G2_VH MYYIS 241 GIIPVFGVAHYAQKFQG 298 GYPGEYFDY 390 11-G5_VH NYAMS 226 TISGSGANTYYADSVKG 338 HHDIAPSWIYYFDY 432 11-G9_VH DYAMS 229 TIYAGGGRTYYADSVKG 339 GLTRHYGYSFDH 433 11-H8_VH NYAMS 226 SIYGSGHRTYYADSVKG 340 VASSAEYAFDH 434 11- NYAMS 226 GISEGGANTYYADSVKG 269 EPPKYGAYSYYGYGFDP 362 H11_VH 1-A1_VL TGSSSMIGAGYDVH 435 GNNNRPS 497 QSYDRSLSGWV 517 1-A5_VL TGSSSMIGAGFDVH 436 DNTNRPS 498 QSYDYSLRVWV 518 1-H10_VL TGSSSMIGATYDVH 437 VNNNRPS 499 QSYDSSLRAWV 519 2-B4_VL RASQSISNYLN 438 AASSLQS 500 QQSFSAPYT 520 2-B5_VL RASQSVYNNLA 439 GASTRAT 501 QQYNDLPLT 521 2-F7_VL RASQSVRNNLA 440 GASTRAT 501 QQYYTWPRT 522 2-F8_VL RASQDISTYLN 441 AASSLQS 500 QQSYSYPLT 523 2-G4_VL RASQSVSGSYLA 442 GASSRAT 502 QQYGGSLPYT 524 2-H2_VL RASQRISNYLN 443 AASSLQS 500 QQSYSPPYT 525 2-H9_VL RASQSISRYLN 444 AASSLQS 500 QQSYSYPVT 526 3-A7_VL RASQSISSYLN 445 AASSLQS 300 QQSYRPPYT 527 3-A9_VL RASQSVSSNYLA 446 GASSRAT 502 QQYGRSAPIT 528 3-B3_VL RASQSISSYLN 445 AASSLQS 500 QQSYSYPLT 523 3-C4_VL RASQDIGNYLN 447 AASSLQS 300 QQSYTFPLT 529 3-C6_VL RASQSISKYLN 448 SASSLQS 503 QQSYSFPLT 530 3-C8_VL RASQTITSYLN 449 AASSLQS 300 QQSYTYPLT 531 3-C9_VL RASQTISRYLN 450 AASSLQS 300 QQTYSTPWT 532 3-C11_VL RASQDISSYLN 451 TASSLQS 504 QQSYSYPLT 523 3-C12_VL RASQSISKYLN 448 AASSLQS 300 QQSYSFPPT 533 3-D3_VL RASQSVATGYLA 452 GASSRAT 502 QQYESSPPFT 534 3-D6_VL RASQSVYNNLA 439 GASTRAT 501 QQYNDWPLT 535 3-D7_VL RASQSVGSNYLA 433 GASSRAT 502 QQYGSSPYT 536 3-D12_VL RASQSVSSSYLA 454 GASSRAT 302 QQYETSPPVT 537 3-E2_VL RASQSISRYLN 444 AASSLQS 300 QQSYSTPWT 538 3-E5_VL RASQSVRSSYLA 433 GASSRAT 502 QQYASLPLT 539 3-E7_VL RASLSVGSNLA 456 GASTRAT 501 QQYNNLPLT 540 3-E8_VL RASQSVGSNLA 437 GASTRAT 501 QQYHNWPPT 541 3-E9_VL RASQSISRYLN 444 SASSLQS 303 QQYFSAPYT 542 3-F5_VL RASQSVSSNYLA 446 GASSRAT 502 QQYGSSPAVT 543 3-F6_VL RASQSVRSNYLA 438 GASSRAT 502 QQYGASPQT 544 3-F12_VL RASQSVSSSYLA 454 GASSRAT 502 QQYGSSPEYT 545 3-G4_VL RASQTISNYLN 439 AASSLQS 300 QQSYTYPLT 531 3-G5_VL RASQSIGSYLN 460 TASSLQS 504 QQSYTYPLT 531 3-G6_VL RASQSISRYLN 444 GASSLQS 303 QQSYSTPYT 546 3-G7_VL RASQSLGTNLA 461 GASTRAT 501 QQYYEAPPT 547 3-G8_VL RASQSIRNYLN 462 AASSLQS 300 QQSYSYPLT 523 3-H1_VL RASQTISTYLN 463 AASILQS 506 QQSYTVPLT 548 3-H4_VL RASQSVGSYLA 464 GASTRAT 501 QQYYNAPIT 549 4-A7_VL TGSSSNIGAGYDVH 433 GNKNRPS 307 QSYDTSLSAWV 550 4-A8_VL TGSSSNIGSGYDVH 465 GNRNRPS 308 QSYDSSLKTWV 551 4-B1_VL TGSSSNIGAGYDVH 433 GNTNRPS 309 QSYDGRLGVSV 552 4-B2_VL TGSSSNIGAYVVH 466 GNTNRPS 309 QSYDRTLSSYV 553 4-B11_VL TGSSSNIGAAFDVH 467 DNYNRPS 510 QSYDSSLSVWV 554 4-D12_VL TGSSSNIGAGYDVH 433 ANNNRPS 511 QSYDYSLSGWV 555 4-F4_VL TGSSSNIGAGYDVH 433 GNRNRPS 308 QSYDTRLSAWV 556 4-G12_VL SGSSSNIGNNYVS 468 DNNKRPS 512 GTWDSSLSARV 557 5-C9_VL RASQSVASSYLA 469 GASSRAT 502 QQYGSSQLT 558 5-E2_VL RASQSISSYLN 445 AASSLQS 300 QQSYSAPYT 559 5-E12_VL RASQSVSNNLA 470 GASTRAT 501 QQYGNYPPT 560 6-G4_VL TGSSSNIGAGYDVH 433 DNTNRPS 498 QSYDSGLSGWV 561 6-H5_VL TGSSSNIGAGYDVH 433 DNTNRPS 498 QSYDVSLGVWV 562 8-A2_VL RASQSVSSSYLA 454 AASSRAT 313 QHYGGSPGYT 563 8-A4_VL RASQTISNYLN 439 GASSLQS 303 QQSFTFPLT 564 8-A6_VL RASQSISSYLN 445 AASSLQS 300 QQSYTIPPT 565 8-A7_VL RASRSVSSNLA 471 GASTRAT 501 QQYYNWPLT 566 8-A8_VL RASQTISKYLN 472 AASSLQS 500 QQSYSYPIT 567 8-A9_VL RASQRIGKYLN 473 AASSLQS 300 QQSYSYPLT 523 8-C4_VL RASQSIRNYLN 462 AASSLQS 300 QQSYSYPLT 523 8-C6_VL RASQSISRYLN 444 AASSLQS 300 QQSYSVPLT 568 8-C9_VL RASQSIATYLN 474 GASSLQS 303 QQSYSTPLT 569 8-C10_VL RASQTISTYLN 463 AASSLQS 300 QQSYRYPLT 570 8-C11_VL RASQTISKYLN 472 SASSLQS 303 QQSYTYPLT 531 8-011_VL RASQSVSGSYLA 442 DASSRAT 514 QQYGTTPQT 571 8-D4_VL RASQSIYTYLN 473 AASSLQS 300 QQSYSFPLT 530 8-D7_VL RASQSVSSTYLA 476 AASSRAT 313 QQYAALPIT 572 8-E2_VL RASQTIGNYLN 477 VASSLQS 313 QQSYRYPYT 573 8-E3_VL RASQSVYTNLA 478 DASTRAT 516 QQYNDWPLT 535 8-E9_VL RASQSVGSSYLA 479 AASSRAT 313 QQYYSAPLT 574 8-F1_VL RASQSVYNNLA 439 DASTRAT 516 QQYNDWPYT 575 8-F2_VL RASQRIGKYLN 473 AASSLQS 300 QQSYSYPLT 523 8-F4_VL RASQSISNYLN 438 AASSLQS 300 QQSYSYPLT 523 8-F6_VL RASQSVYNNLA 439 DASTRAT 516 QQYSDYPFT 576 8-F11_VL RASQSVRSNYLA 438 DASSRAT 514 QQYAYAPWT 577 8-G12_VL RASQSVSSNYLA 446 GASSRAT 502 QQYGSSPAVT 543 8-H7_VL RASQSIRNYLN 462 AASSLQS 300 QQSYSYPLT 523 9-A6_VL RASQSISSYLN 445 AASSLQS 300 QQSYTIPPT 565 9-B3_VL RASQSISNYLN 438 AASSLQS 300 QQSYAPPYT 578 9-B10_VL RASQSVYNNLA 439 DASTRAT 516 QQYYYWPIT 579 9-C2_VL RASQSVYNNLA 439 DASTRAT 516 QQYSDYPFT 576 9-D8_VL RASRSLSNNLA 480 DASTRAT 516 QQYNAWPYT 580 9-E4_VL RASQSVYNNLA 439 DASTRAT 516 QQYSDYPFT 576 9-E5_VL RASQSIANYLN 481 AASSLQS 300 QQYFSTETT 581 9-G1_VL RASQSIGNYLN 482 SASSLQS 303 QQTYTIPLT 582 9-G3_VL RASQSIATYLN 474 AASSLQS 300 QQSYTYPVT 583 9-H9_VL RASQSISSYLN 445 GASSLQS 303 QQSFTAPVT 584 2-C8_VL RASQTISRYLN 450 AASSLQS 300 QQSYTYPIT 585 8-D9_VL RASQTIGNYLN 477 VASSLQS 313 QQSYRYPYT 573 10-A9_VL RASQTISRYLN 450 SASSLQS 303 QQSYTYPIT 585 10-B2_VL RASQSISSYLN 445 AASSLQS 300 QQSYTIPPT 565 10-B5_VL RASQDISNYLN 483 AASSLQS 300 QQSYTYPLT 531 10-C1_VL RASQSISTYLN 484 AASSLQS 300 QQSYTFPLT 529 10-C3_VL RASQTIGIYLN 483 AASSLQS 300 QQSYTYPLT 531 10-C9_VL RASQTIGTYLN 486 AASSLQS 300 QQSYSYPLT 523 10- RASQSVSNNLA 470 GASTRAT 501 QQYNNWPYT 586 C11_VL 10-D7_VL RASQSISTYLN 484 AASSLQS 300 QQSYTVPLT 548 10-E1_VL RASQSISSYLN 445 AASSLQS 300 QQSYTIPPT 565 10-E6_VL RASQDIYNYLN 487 GASSLQS 505 QQSDGFPPT 587 10-E7_VL RASQSISNYLN 438 AASSLQS 300 QQSYTVPWT 588 10- RASQSVSSNLA 488 GASTRAT 501 QQYNDYPLT 589 F11_VL 10- RASQSISSNLA 489 DASTRAT 516 QQYYNWPLT 566 F12_VL 10-G5_VL RASQSVYSNLA 490 GASTRAT 501 QQYSNWPLT 590 11-B6_VL RASQSVGGNLA 491 DASTRAT 516 QQYNDWPLT 535 11-D8_VL RASQRISSYLN 492 AASSLQS 300 QQSYSYPIT 567 11- RASQSVASPYLA 493 GASSRAT 502 QQYYESPIT 591 D10_VL 11- RASQSIYNYLN 494 AASSLQS 500 QQSDSPPWT 592 D11_VL 11-G2_VL RASQSVSSSYLA 454 AASSRAT 313 QHYGGSPGYT 563 11-G5_VL RARQSVPSNYLA 493 GASSRAT 502 QQYYSSPLT 593 11-G9_VL RASQTISSYLN 496 SASSLQS 303 QQSYTFPLT 529 11-H8_VL RASQSISNYLN 438 AASSLQS 300 QQSYTVPLT 548 11- RASQSVSSSYLA 454 GASSRAT 502 QQYSSSPTYT 594 H11_VL

    Example 5. Preferential Binding to PLXDC1 by Antibodies in Presence of Binding Compound

    [0602] This example shows that compounds of the disclosure bind to the extracellular domain of PLXDC. Further, such binding by the small molecule compounds serve as an efficient and specific way for evaluation and screening of antibodies that activate PLXDC proteins to kill tumor endothelial cells.

    [0603] The high affinity interaction between compound 346 (Table 3) and the extracellular domain of PLXDC1 (PLXDC1-ECD). Compound 346 suppressed the endogenous tryptophan fluorescence of PLXDC1-ECD in a dose-dependent manner (FIG. 15A-B). FIG. 15A presents raw data of the tryptophan fluorescence of PLXDC1-ECD as measured in a fluorometer after adding different concentrations of the compound, and FIG. 15B shows the dose-dependent curve of the suppression of tryptophan fluorescence. Tryptophan fluorescence without the compound added is defined as 1. The estimated Kd value is 50 nM.

    [0604] Binding of the antibodies (3-G7 and 8-C.sub.9) to PLXDC expressed on live cells was also tested. Human PLXDC1 and PLXDC2 proteins were tagged with an epitope tag on the N-terminus. Binding of an antibody against the epitope tag demonstrates the expression of human PLXDC1 (FIG. 16A, left picture) and human PLXDC2 (FIG. 16A, middle picture) in their transfected cells, while it did not bind to untransfected cells (FIG. 16A, right picture).

    [0605] Binding of antibody 3-G7 to cells transfected with human PLXDC1 is shown in FIG. 16A-B, left pictures. This antibody did not bind to human PLXDC2 (middle pictures) or untransfected control cells (right pictures). Likewise, FIG. 16D-E show the binding of antibody 8-C.sub.9 to cells transfected with human PLXDC1 (left pictures) and this antibody did not bind to human PLXDC2 (middle pictures) or untransfected control cells (right pictures).

    [0606] To verify that the activating antibodies preferably bind to the PLXDC1 protein in its activated state, bindings were measured by coating purified PLXDC1-ECD protein on the wells and adding serial dilution of antibodies. Compound 346 (Table 3) was added in the samples. As shown in FIG. 17A, antibody 3-G7 bound to PLXDC1-ECD with high avidity (9.6 nM) with the presence of compound 346. When compound 346 was added, the avidity was increased to 1.5 nM. Likewise, as shown in FIG. 17B, antibody 8-C.sub.9 bound to PLXDC1-ECD with high avidity (1.9 nM) in the absence of compound 346, which was increased to 0.9 nM when the compound was added.

    [0607] This example, therefore, validates the antibody-screening approach that employs compound-activated PLXDC proteins.

    Example 6. Killing of Tumor Endothelial Cells by PLXDC-Activating Compounds and Antibodies

    [0608] This example investigates the mechanism by which the compounds and antibodies kill tumor endothelial cells, and demonstrates their killing activities.

    [0609] Through RNAseq analysis of PLXDC1-expressing endothelial cells killing by PLXDC1-activating compounds, this example a transcriptional factor called Gfi1b specifically induced during PLXDC1-mediated cell killing. By linking its promotor to a luciferase reporter gene, this example developed a PLXDC1 receptor activation assay. PLXDC1-activating compounds 346 and 342 (Table 3, labeled as A-Compound-1 and A-Compound-2, respectively) highly activated the promotor activity in PLXDC1-expressing cells, but not in cells without PLXDC1 (FIG. 18A). Likewise, these compounds activated the promotor activity in PLXDC2-expressing cells, but not in cells without PLXDC2 (FIG. 18B).

    [0610] FIG. 18 therefore shows that the compounds activated both PLXDC1 and PLXDC2 and that they preferentially activate PLXDC1 over PLXDC2. One of the compounds, A-Com-2, strongly differentiates between the two receptors. As a control, Fluorouracil, a chemotherapy agent that kills dividing cells by apoptosis does not activate this promoter. This data demonstrates that the cell death mediated by PLXDC1 activation is different from chemotherapy agent-triggered apoptosis.

    [0611] Activation of PLXDC1 by antibodies was demonstrated in FIG. 19. As shown, PLXDC1-activating antibodies 3-G7 and 8-C.sub.9 (labeled as A-TEM7-Ab-1 and A-TEM7-Ab-2, respectively) activated the promotor activity in PLXDC1-expressing cells, but not in cells without PLXDC1.

    [0612] The killing of human PLXDC1-expressing endothelial cells by the compounds is visualized in FIG. 20. The top three pictures represent control cells and the lower three pictures represent compound-treated cells, showing light microscopy picture (FIG. 20A, left), live cell (middle) and dead cell staining (right). Live cells were stained using Fluorescein diacetate (green signal) and dead cells were stained using propidium iodide (red signal). Quantitation of the killing of human PLXDC1-expressing endothelial cells by the compounds and antibodies (antibodies 3-G7 and 8-C.sub.9, labeled as A-TEM7-Ab-1 and A-TEM7-Ab-2, respectively) are shown in FIG. 20B. Incubation time of the compounds and antibodies was 24 hours.

    [0613] The killing of human tumor endothelial cells was also tested ex vivo. With the ex vivo model of tumor angiogenesis demonstrated in Example 1, antibodies were added after tumor endothelial cells grew out of the tumor (FIG. 21, marked in the middle). The pictures represent one day after antibody addition and the right pictures represent 8 days after antibody addition. Incubation of human lung tumor endothelial cells with control IgG (500 nM) did not lead to the death of tumor endothelial cells expressing PLXDC1 (FIG. 21, green signal). Incubation of human lung tumor endothelial cells with PLXDC1-activating IgG 3-G7/A-TEM7-Ab-1 (500 nM) led to the death of tumor endothelial cells expressing PLXDC1 (FIG. 21B, green signal), as evident by comparing the tumor endothelial cell signal between day 1 and day 8. Incubation of human lung tumor endothelial cells with PLXDC1-activating IgG 8-C.sub.9/A-TEM7-Ab-2 (500 nM) also led to the death of tumor endothelial cells expressing PLXDC1 (green signal), as evident by comparing the tumor endothelial cell signal between day 1 and day 8.

    Example 7. Specific Killing of Pathogenic Blood Vessels in Ischemia-Induced Retinopathy/Tumor

    [0614] This example examines the expression of the PLXDC proteins on pathogenic blood vessels and normal healthy blood vessels, in different diseases, and confirms that the compounds and antibodies of the instant disclosure specifically kill the pathogenic blood vessels.

    [0615] The expression of PLXDC1 in pathogenic blood vessels of ischemia-induced retinopathy was examined and shown in FIG. 1, which shows that PLXDC1 was not expressed in healthy blood vessels. It was then demonstrated that the compounds (e.g., compounds 346) specifically suppressed pathogenic blood vessels in vivo without affecting healthy blood vessels in ischemia-induced retinopathy (FIG. 22). FIG. 22A includes a schematic diagram of the experimental design for ischemia-induced retinopathy. The high oxygen environment caused blood vessel loss (vaso-obliteration). In room air, loss of vessels triggered abnormal angiogenesis that generated pathogenic blood vessels on the top of the retina (marked in yellow in FIG. 22D). Treatment was applied during the return to room air by subcutaneous injection. The lower graph in FIG. 22A shows quantitation of healthy blood vessels, vaso-obliteration and pathogenic blood vessels between the control (n=10) and treated retinas (n=10).

    [0616] Treatment by PLXDC1-activating compound (compound 346/A-Compound-1) highly suppressed pathogenic blood vessels (two asterisks) while improving the amount of healthy blood vessels (one asterisk). FIG. 22B includes representative images of flat-mounted control retinas (upper two images) and retinas from compound treated mice (lower two images). The same retinas in B with vaso-obliteration areas marked in white color (FIG. 22C). These images illustrate that compound-treated retinas went through vaso-obliteration like the control retinas. The same retinas in B with pathogenic blood vessels marked in yellow color (FIG. 22D). These images illustrate that compound-treated retinas have highly decreased pathogenic blood vessels as compared to the control retinas.

    [0617] The killing activity was further demonstrated with tumor samples in vivo. Treatment was done at day 0 by bolus IV injection of compound 346 in a tumor animal model. FIG. 23A charts raw data of tumor growth curves of the mice in the control group. FIG. 23B presents raw data of tumor growth curves of the mice in the treatment group. FIG. 23C compares the combined growth data of the control group and the treatment group. Unlike in the control group, compound 346 shrank the tumors significantly.

    [0618] Tumor morphological changes on live animals due to the treatment by PLXDC1-activating compound were examined. Pictures of the whole animals in the experiment described in FIG. 25 show tumor morphological and color changes on day 1 and day 3 (FIG. 24). Tumors in the treatment groups becomes darker in color on day 1 due to the destruction of tumor blood vessels and accumulation of blood in the tumors. Tumors in the treatment groups started to become yellower in color on day 3, consistent with the onset of tumor necrosis due to the lack of tumor blood vessels.

    [0619] FIG. 25 presents pictures of the whole animals showing tumor morphological and color changes on day 7. tumors in the control group have grown to large sizes, tumors in the treatment groups have highly shrunk in size and become yellow in color.

    [0620] FIG. 26 shows morphological changes of dissected tumors due to the treatment by the compound. Pictures of the dissected tumors showed tumor morphological and color changes on day 7. While the tumors in the control group are reddish in color, tumors in the treatment groups had highly shrunk in size and become yellow in color, consistent with the lack of tumor blood vessels and tumor necrosis. These data, therefore, demonstrate that the PLXDC1-activating compounds can kill tumor blood vessels in vivo to cause strong tumor necrosis and shrinkage.

    Example 8. Activating Antibodies Interact with PLXDC1 Differently from PEDF

    [0621] This example shows that the PLXDC1-activating antibodies 3-G7 and 8-C.sub.9 (labeled as A-TEM7-Ab-1 and A-TEM7-Ab-2, respectively) do not require binding to domain B of PLXDC1, where PEDF binds.

    [0622] Example 1 already has demonstrated that antibodies AA02, AA03, and AA94 interacted with PLXDC1 even when domain B was deleted (FIG. 11). It is further demonstrated here that antibodies A-TEM7-Ab-1 and A-TEM7-Ab-2 also do not bind to PLXDC1 through domain B (FIG. 27A-B). This is in sharp contrast to PEDF, which depends on domain B to bind to PLXDC1. The fact that both small molecules and antibodies of the present disclosure do not depend on domain B to bind to PLXDC1 differentiate these novel ligands from PEDF and is consistent with the distinct activity of these new ligands (killing of tumor endothelial cells) that PEDF is not capable of doing.

    [0623] All of the methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this disclosure have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the disclosure. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the disclosure as defined by the appended claims.

    REFERENCES

    [0624] The following references, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference. [0625] Beaty, R. M., Edwards, J. B., Boon, K., Siu, I. M., Conway, J. E., and Riggins, G. J. (2007). PLXDC1 (TEM7) is identified in a genome-wide expression screen of glioblastoma endothelium. J Neurooncol 81, 241-248. [0626] Carmeliet, P. (2005). Angiogenesis in life, disease and medicine. Nature 438, 932-936. [0627] Lee, H. K., Seo, I. A., Park, H. K., and Park, H. T. (2006). Identification of the basement membrane protein nidogen as a candidate ligand for tumor endothelial marker 7 in vitro and in vivo. FEBS Lett 580, 2253-2257. [0628] Lu, C., Bonome, T., Li, Y., Kamat, A. A., Han, L. Y., Schmandt, R., Coleman, R. L., Gershenson, D. M., Jaffe, R. B., Birrer, M. J., et al. (2007). Gene alterations identified by expression profiling in tumor-associated endothelial cells from invasive ovarian carcinoma. Cancer Res 67, 1757-1768. [0629] Schwarze, S. R., Fu, V. X., Desotelle, J. A., Kenowski, M. L., and Jarrard, D. F. (2005). The identification of senescence-specific genes during the induction of senescence in prostate cancer cells. Neoplasia 7, 816-823. [0630] St Croix, B., Rago, C., Velculescu, V., Traverso, G., Romans, K. E., Montgomery, E., Lal, A., Riggins, G. J., Lengauer, C., Vogelstein, B., et al. (2000). Genes expressed in human tumor endothelium. Science 289, 1197-1202. [0631] van Beijnum, J. R., Petersen, K., and Griffioen, A. W. (2009). Tumor endothelium is characterized by a matrix remodeling signature. Front Biosci (Schol Ed) 1, 216-225. [0632] Yamaji, Y., Yoshida, S., Ishikawa, K., Sengoku, A., Sato, K., Yoshida, A., Kuwahara, R., Ohuchida, K., Oki, E., Enaida, H., et al. (2008). TEM7 (PLXDC1) in neovascular endothelial cells of fibrovascular membranes from patients with proliferative diabetic retinopathy. Invest Ophthalmol Vis Sci 49, 3151-3157.