BIOCATALYTIC USE OF NONHEME IRON PROTEINS FOR MOLECULAR FUNCTIONALIZATION

20250263677 ยท 2025-08-21

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided herein are methods of functionalizing C(sp3)-H bonds using reprogramed metalloenzymes to perform radical-relay C(sp3)-H functionalization, activating a (sp3)-H bond via a reactive radical (X.Math.) via hydrogen atom transfer (HAT); intercepting of the resulting carbon-centered radical by a redox-reactive metal complex; and obtaining a functionalized CY bond.

    Claims

    1. A non-heme metalloenzyme comprising (i) at least about 70% sequence identity to SEQ ID NO:1, and comprising at least 1 mutation relative to SEQ ID NO:1, or (ii) at least at least 98.2%, at least 98.4%, at least 98.6%, at least 98.8%, at least 99%, at least 99.2%, at least 99.4%, or at least 99.6% sequence identity to SEQ ID NO:2 or SEQ ID NO:3.

    2-3. (canceled)

    4. The non-heme metalloenzyme of claim 1, wherein the non-heme metalloenzyme comprises at least 1 mutation at SEQ ID NO:1 position H187, V189, N191, L228, S230, P243, N245, Q255, Q269, H270, F336, E349, F364, L367, F368, or a combination thereof, optionally wherein the mutations are V189A, N191A, F216A, S230L, P243A, P243G, N245Q, N245F, Q255A, Q255P, and L367I.

    5-6. (canceled)

    7. The non-heme metalloenzyme of claim 1, wherein the at least 1 mutation diminishes active site volume in the non-heme metalloenzyme.

    8. (canceled)

    9. A composition comprising a non-heme metalloenzyme of claim 1, an organic substrate comprising a CH bond, and one or more of a halogen source, a nucleophile source, and a radical precursor.

    10. A method for modifying an organic substrate comprising: contacting the organic substrate with a non-heme metalloenzyme; abstracting a hydrogen atom from the organic substrate; and coupling a nucleophile to the organic substrate, thereby converting the organic substrate to a modified organic substrate.

    11. The method of claim 10, wherein the non-heme metalloenzyme comprises an iron cofactor, a copper cofactor, a cobalt cofactor, a manganese cofactor, a nickel cofactor, or a chromium cofactor.

    12. (canceled)

    13. The method of claim 12, wherein the iron cofactor has a +2 oxidation state, interconverts between +2 and +3 oxidation states and/or does not adopt a +4 oxidation state.

    14-15. (canceled)

    16. The method of claim 10, wherein the non-heme metalloenzyme comprises at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.5% sequence identity to any one of SEQ ID NO:1-16.

    17. (canceled)

    18. The method of claim 16, wherein the non-heme metalloenzyme comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, at least fourteen, or fifteen mutations relative to SEQ ID NO:1 at positions selected from H187, V189, N191, L228, S230, P243, N245, Q255, Q269, H270, F336, E349, F364, L367, and F368.

    19. The method of claim 10, wherein the non-heme metalloenzyme catalyzes the coupling between the nucleophile and the organic substrate.

    20. The method of claim 10, wherein the nucleophile is (i) bonded to a metal cofactor of the non-heme metalloenzyme prior to the coupling or (ii) coupled to the carbon atom from which the hydrogen atom is abstracted.

    21. The method of claim 10, wherein the hydrogen atom is abstracted (i) from a carbon atom of the organic substrate or (ii) by an organic radical generated by the non-heme metalloenzyme.

    22. (canceled)

    23. The method of claim 10, wherein the nucleophile is an azide, a halogen, a nitrile, a thiocyanate, a nitro, a cyanide, an alkoxide, a thiolate, an amine, a sulfonamide, an amide, a heteroaryl, or a trifluoromethyl.

    24. (canceled)

    25. The method of claim 23, wherein the method has a chemoselectivity for azidation over fluorination of greater than about 3:2, greater than about 2:1, greater than about 3:1, greater than about 4:1, greater than about 5:1, greater than about 6:1, greater than about 7:1, greater than about 8:1, greater than about 9:1, greater than about 10:1, greater than about 12:1, greater than about 15:1, greater than about 20:1, or greater than about 25:1.

    26. The method of claim 10, wherein the nucleophile is derived from a nucleophile source with a structure according to any one of Formulas (VIII)(XVII) or (XIX): ##STR00016## or M.sup.+X.sup. (XIX); wherein each instance of R.sup.14, R.sup.15, R.sup.16 and R.sup.17 is independently H, optionally substituted C.sub.1-18 alkyl, C.sub.1-18 polyfluoroalkyl, optionally substituted C.sub.2-18 alkenyl, optionally substituted C.sub.2-18 alkynyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroaryl, optionally substituted 6- to 10-membered heterocyclyl, cyano, halo, nitro, NR.sup.18R.sup.19, BR.sup.21R.sup.22, SiR.sup.18R.sup.19R.sup.20, C(O)OR.sup.18, C(O)SR.sup.18, C(O)NR.sup.18R.sup.19, C(O)R.sup.18, C(O)ONR.sup.18R.sup.19, C(O)NR.sup.18OR.sup.19, C(O)C(O)OR.sup.18, S(O)OR.sup.18, S(O)SR.sup.18, S(O)NR.sup.18R.sup.19, S(O)R.sup.18, S(O)ONR.sup.18R.sup.19, S(O)NR.sup.18OR.sup.19, S(O)C(O)OR.sup.18, S(O).sub.2OR.sup.18, S(O).sub.2SR.sup.18, S(O).sub.2NR.sup.18R.sup.19, S(O).sub.2R.sup.18, S(O).sub.2ONR.sup.18R.sup.19, S(O).sub.2NR.sup.18OR.sup.19, S(O).sub.2C(O)OR.sup.18, or P(O)(OR.sup.18)(OR.sup.19) each instance of R.sup.18, R.sup.19, and R.sup.20 is independently H, C.sub.1-C.sub.3 alkyl, or C.sub.1-C.sub.3 haloalkyl; each instance of R.sup.21 and R.sup.22 is independently H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, or OR.sup.18; M.sup.+ is Na.sup.+, K.sup.+, Cs.sup.+, or [N(R.sup.12).sub.4].sup.+; X.sup. is F.sup., Cl.sup., Br.sup., I.sup., N.sub.3.sup., SCN.sup., CN.sup., NCO.sup., [SR.sup.13].sup., or [OR.sup.13].sup.; each instance of R.sup.12 is independently H, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.6 haloalkyl, or wherein two instances of R.sup.12 are taken together along with the nitrogen to which they are attached to form a C.sub.2-C.sub.8 heterocycloalkyl; and each instance of R.sup.13 is independently H, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.6 haloalkyl.

    27. (canceled)

    28. The method of claim 27, wherein the organic radical is generated through homolysis of a bond on a radical precursor.

    29. (canceled)

    30. The method of claim 28, wherein the bond on the radical precursor is a halogen-halogen bond, a carbon-halogen bond, a nitrogen-halogen bond, or an oxygen-oxygen bond.

    31. The method of claim 28, wherein the radical precursor is coupled to the organic substrate and has a structure according to any one of Formulas (I)(VII): ##STR00017## wherein each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently the organic substrate, H, optionally substituted C.sub.1-18 alkyl, optionally substituted C.sub.1-18 polyfluoroalkyl, optionally substituted C.sub.2-18 alkenyl, optionally substituted C.sub.2-18 alkynyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroaryl, optionally substituted 6- to 10-membered heterocyclyl, cyano, halo, nitro, NR.sup.7R.sup.8, BR.sup.10R.sup.11, SiR.sup.7R.sup.8R.sup.9, C(O)OR.sup.7, C(O)SR.sup.7, C(O)NR.sup.7R.sup.8, C(O)R.sup.7, C(O)ONR.sup.7R.sup.8, C(O)NR.sup.7OR.sup.8, C(O)C(O)OR.sup.7, S(O)OR.sup.7, S(O)SR.sup.7, S(O)NR.sup.7R.sup.8, S(O)R.sup.7, S(O)ONR.sup.7R.sup.8, S(O)NR.sup.7OR.sup.8, S(O)C(O)OR.sup.7, S(O).sub.2OR.sup.7, S(O).sub.2SR.sup.7, S(O).sub.2NR.sup.7R.sup.8, S(O).sub.2R.sup.7, S(O).sub.2ONR.sup.7R.sup.8, S(O).sub.2NR.sup.7OR.sup.8, S(O).sub.2C(O)OR.sup.7, or P(O)(OR.sup.7)(OR.sup.8); each instance of R.sup.7, R.sup.8, and R.sup.9 is independently H, C.sub.1-C.sub.3 alkyl, or C.sub.1-C.sub.3 haloalkyl; each instance of R.sup.10 and R.sup.11 is independently H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, or OR.sup.7; each instance of X.sup.1 is independently F, Cl, Br, or I; and each instance of X.sup.2 is independently F, Cl, or Br.

    32. The method of claim 10, wherein the modified organic substrate is coupled to the nucleophile through a carbon-nitrogen bond, a carbon-sulfur bond, a carbon-carbon bond, or a carbon halogen bond.

    33. The method of claim 10, wherein the organic substrate contains a carbon-halogen or nitrogen-halogen bond that is not cleaved during the method.

    34. The method of claim 10, further comprising dehalogenating the organic substrate.

    35. The method of claim 10, wherein the method is performed under anaerobic conditions and/or in the presence of a cell that expresses the non-heme metalloenzyme.

    36. The method of claim 10, wherein the modified organic substrate has an enantiomeric ratio of at least about 60:40, at least about 65:35, at least about 70:30, at least about 75:25, at least about 80:20, at least about 85:15, at least about 90:10, or at least about 95:5.

    37-38. (canceled)

    39. The method of claim 10, wherein the organic substrate has a structure according to Formula (XVIII): ##STR00018## wherein R.sup.23, R.sup.24, R.sup.25, R.sup.26, R.sup.27, R.sup.28, R.sup.29, R.sup.30, R.sup.31, R.sup.32, and R.sup.33 are independently H, optionally substituted C.sub.1-18 alkyl, C.sub.1-18 polyfluoroalkyl, optionally substituted C.sub.2-18 alkenyl, optionally substituted C.sub.2-18 alkynyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6-10-membered heteroaryl, optionally substituted 6- to 10-membered heterocyclyl, cyano, halo, nitro, NR.sup.34R.sup.35, BR.sup.37R.sup.38, SiR.sup.34R.sup.35R.sup.36, C(O)OR.sup.34, C(O)SR.sup.34, C(O)NR.sup.34R.sup.35, C(O)R.sup.34, C(O)ONR.sup.34R.sup.35, C(O)NR.sup.34OR.sup.35, C(O)C(O)OR.sup.34, S(O)OR.sup.34, S(O)SR.sup.34, S(O)NR.sup.34R.sup.35, S(O)R.sup.34, S(O)ONR.sup.34R.sup.35, S(O)NR.sup.34OR.sup.35, S(O)C(O)OR.sup.34, S(O).sub.2OR.sup.34, S(O).sub.2SR.sup.34, S(O).sub.2NR.sup.34R.sup.35, S(O).sub.2R.sup.34, S(O).sub.2ONR.sup.34R.sup.35, S(O).sub.2NR.sup.34OR.sup.35, S(O).sub.2C(O)OR.sup.34, or P(O)(OR.sup.34)(OR.sup.35); each instance of R.sup.34, R.sup.35, and R.sup.36 is independently H, C.sub.1-C.sub.3 alkyl, or C.sub.1-C.sub.3 haloalkyl; each instance of R.sup.3 and R.sup.38 is independently H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, or OR.sup.34; X.sub.3 is F, Cl, Br, or I, and X.sup.3 is abstracted by the non-heme metalloenzyme.

    40. (canceled)

    41. A method of functionalizing C(sp.sup.3)-H bonds comprising: using reprogramed metalloenzymes to perform radical-relay C(sp.sup.3)-H functionalization; activating a (sp.sup.3)-H bond via a reactive radical (X.Math.) via hydrogen atom transfer (HAT); intercepting of the resulting carbon-centered radical by a redox-reactive metal complex; and obtaining a functionalized CY bond, thereby functionalizing C(sp3)-H bonds.

    42. The method of claim 41, wherein the reprogrammed metalloenzymes are non-heme iron enzymes or enantioselective variants.

    43. (canceled)

    44. The method of claim 41, wherein the reactive radical (X.Math.) is a nitrogen radical (N.Math.) and/or an oxygen radical (O.Math.).

    45. The method of claim 41, wherein the functionalized CY bond is a CC, CS, CN, CF, and/or, C-halogen bond.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0022] FIG. 1 illustrates the mechanism of enzymatic system that can operate radical relay reaction mechanism for CH functionalization reactions.

    [0023] FIG. 2 illustrates mechanism and optimized conditionals for fluorination.

    [0024] FIGS. 3A-3C is an illustration with reaction products generated from exemplary substrate compounds. FIG. 3A shows the scope of Sav HppD Az1 and Sav HppD Az2-transformed products. Experiments were performed at analytical scale using suspensions of E. coli expressing Sav HppD variants in KPi buffer (pH 7.4) at room temperature under anaerobic conditions for 24 hours. The absolute configuration of enzymatically synthesized azidation product 1N was determined to be S via X-ray crystallography. The absolute configurations of all other azidation products were inferred by analogy. FIG. 3B summarizes a preparative scale synthesis and absolute configuration determination of product 1N. FIG. 3C is a reaction scheme for a one-pot chemoenzymatic synthesis of azidation product 11N followed by copper catalyzed azide-alkyne cycloaddition.

    [0025] FIG. 4 is an illustration of O-radical directed functionalization and results of such reactions.

    [0026] FIG. 5 is a thiocyanation reaction scheme and NMR data showing the progress of a thiocyanation reaction.

    [0027] FIG. 6 is an intermolecular radical relay azidation mechanism and a table showing activity screening data with various metalloenzymes.

    [0028] FIG. 7 is a set of tables with enantioselectivity data.

    [0029] FIGS. 8A-8C is a set of reaction schemes that cover enzymatic and non-enzymatic radical relay mechanisms. FIG. 8A is a reaction scheme for a radical relay CH functionalization that involves an initial hydrogen atom transfer (HAT) mediated by a heteroatom-centered radical (X.Math.) followed by the trapping of the carbon-centered radical with redox-active metal complex. FIG. 8B is a reaction scheme for a mechanism employed by natural non-heme iron enzymes for C(sp.sup.3)-H halogenation/azidation. FIG. 8C is a reaction scheme for a mechanism which integrates radical relay chemistry into non-heme iron enzymes to enable unnatural CH functionalization reactions.

    [0030] FIGS. 9A-9C is a computational model of the Sav HppD active site, a reaction scheme, and a plot of total turnovers for various Sav HppD variants. FIG. 9A shows protein residues selected for mutagenesis from among: (1) loop residues surrounded the active site (N191, F216, Q255, F359), (2) residues on the C-terminal a-helix (K361, L367, N363), and (3) residues on the barrel of the C-terminal domain (V189, S230, P243, N245, Q269, Q334, F336, R353). The computational model was generated from protein database entry 1T47. FIG. 9B provides the azidation reaction scheme for the reaction screened with a high-throughput screening platform. FIG. 9C provides representative variants identified during the directed evolution of Sav HppD. Experiments were performed at analytical scale using suspensions of E. coli expressing Sav HppD variants (OD.sub.600=10), 10 mM substrate 1NF, 25 mM NaN.sub.3, 2.5 mM Fe.sup.2+ in KPi buffer (pH 7.4) at room temperature under anaerobic conditions for 24 hours.

    [0031] FIG. 10 is a series of plots which summarize kinetics for non-heme iron enzyme mediated azidation reactions. The leftmost plot provides kinetics data for wild-type Sav HppD. The middle plot provides kinetics data for Az1 Sav HppD. The rightmost plot provides kinetics data for Az2 Sav HppD.

    [0032] FIG. 11 is an azidation reaction scheme and a table listing enantioselectivities for an azidation reaction mediated by several non-heme metalloenzymes.

    DETAILED DESCRIPTION OF THE INVENTION

    [0033] Before the present compositions and methods are described, it is to be understood that this invention is not limited to particular compositions, methods, and experimental conditions described, as such compositions, methods, and conditions may vary. It is also to be understood that the terminology used herein is for purposes of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only in the appended claims.

    [0034] As used herein, the term includes means includes but not limited to, the term including means including but not limited to. The term based on means based at least in part on. Additionally, where the disclosure or claims recite a, an, a first, or another element, or the equivalent thereof, it should be interpreted to include one or more than one such element, neither requiring nor excluding two or more such elements.

    [0035] The terms substituted, whether preceded by the term optionally or not, and substituent, as used herein, refer to the ability, as appreciated by one skilled in this art, to change one functional group for another functional group on a molecule, provided that the valency of all atoms is maintained. When more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position. The substituents also may be further substituted (e.g., an aryl group substituent may have another substituent off it, such as another aryl group, which is further substituted at one or more positions).

    [0036] Where substituent groups or linking groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents that would result from writing the structure from right to left, e.g., CH.sub.2O is equivalent to OCH.sub.2; C(O)O is equivalent to OC(O); OC(O)NR is equivalent to NRC(O)O, and the like.

    [0037] When the term independently selected is used, the substituents being referred to (e.g., R groups, such as groups R.sub.1, R.sub.2, and the like, or variables, such as m and n), can be identical or different. For example, both R.sub.1 and R.sub.2 can be substituted alkyls, or R.sub.1 can be hydrogen and R.sub.2 can be a substituted alkyl, and the like.

    [0038] A named R or group will generally have the structure that is recognized in the art as corresponding to a group having that name, unless specified otherwise herein. For the purposes of illustration, certain representative R groups as set forth above are defined below.

    [0039] Descriptions of compounds of the present disclosure are limited by principles of chemical bonding known to those skilled in the art. Accordingly, where a group may be substituted by one or more of a number of substituents, such substitutions are selected so as to comply with principles of chemical bonding and to give compounds which are not inherently unstable and/or would be known to one of ordinary skill in the art as likely to be unstable under ambient conditions, such as aqueous, neutral, and several known physiological conditions. For example, a heterocycloalkyl or heteroaryl is attached to the remainder of the molecule via a ring heteroatom in compliance with principles of chemical bonding known to those skilled in the art thereby avoiding inherently unstable compounds.

    [0040] Unless otherwise explicitly defined, a substituent group, as used herein, includes a functional group selected from one or more of the following moieties, which are defined herein:

    [0041] The term hydrocarbon, as used herein, refers to any chemical group comprising hydrogen and carbon. The hydrocarbon may be substituted or unsubstituted. As would be known to one skilled in this art, all valencies must be satisfied in making any substitutions. The hydrocarbon may be unsaturated, saturated, branched, unbranched, cyclic, polycyclic, or heterocyclic. Illustrative hydrocarbons are further defined herein below and include, for example, methyl, ethyl, n-propyl, isopropyl, cyclopropyl, allyl, vinyl, n-butyl, tert-butyl, ethynyl, cyclohexyl, and the like. Further, more generally, a carbyl refers to a carbon atom or a moiety comprising one or more carbon atoms acting as a bivalent radical.

    [0042] The term alkyl, by itself or as part of another substituent, means, unless otherwise stated, a straight (i.e., unbranched) or branched chain, acyclic or cyclic hydrocarbon group, or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent groups, having the number of carbon atoms designated (i.e., C.sub.1-C.sub.10 means one to ten carbons, including 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10 carbons). In particular embodiments, the term alkyl refers to C.sub.1-20 inclusive, including 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20 carbons, linear (i.e., straight-chain), branched, or cyclic, saturated or at least partially and in some cases fully unsaturated (i.e., alkenyl and alkynyl) hydrocarbon radicals derived from a hydrocarbon moiety containing between one and twenty carbon atoms by removal of a single hydrogen atom. Representative saturated hydrocarbon groups include, but are not limited to, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, sec-pentyl, isopentyl, neopentyl, n-hexyl, sec-hexyl, n-heptyl, n-octyl, n-decyl, n-undecyl, dodecyl, cyclohexyl, (cyclohexyl)methyl, cyclopropylmethyl, and homologs and isomers thereof.

    [0043] The term haloalkyl, by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or cyclic hydrocarbon group, or combinations thereof, consisting of at least one carbon atoms and at least one halogen selected from the group consisting of F, Cl, Br, and I. Representative haloalkyl groups include CH.sub.2F, CHClCH.sub.3, CHClCH.sub.2Cl, CH.sub.2CH.sub.2CF.sub.2CF.sub.3, and CF(CF.sub.2CF.sub.3).sub.2.

    [0044] Cyclic and cycloalkyl refer to a non-aromatic mono- or multicyclic ring system of about 3 to about 10 carbon atoms, e.g., 3, 4, 5, 6, 7, 8, 9, or 10 carbon atoms. The cycloalkyl group can be optionally partially unsaturated. The cycloalkyl group also can be optionally substituted with an alkyl group substituent as defined herein, oxo, and/or alkylene. There can be optionally inserted along the cyclic alkyl chain one or more oxygen, sulfur or substituted or unsubstituted nitrogen atoms, wherein the nitrogen substituent is hydrogen, unsubstituted alkyl, substituted alkyl, aryl, or substituted aryl, thus providing a heterocyclic group. Representative monocyclic cycloalkyl rings include cyclopentyl, cyclohexyl, and cycloheptyl. Multicyclic cycloalkyl rings include adamantyl, octahydronaphthyl, decalin, camphor, camphane, and noradamantyl, and fused ring systems, such as dihydro- and tetrahydronaphthalene, and the like.

    [0045] The terms heterocycloalkyl and cycloheteroalkyl refer to a non-aromatic ring system, unsaturated or partially unsaturated ring system, such as a 3- to 10-member substituted or unsubstituted cycloalkyl ring system, including one or more heteroatoms, which can be the same or different, and are selected from the group consisting of nitrogen (N), oxygen (O), sulfur (S), phosphorus (P), and silicon (Si), and optionally can include one or more double bonds.

    [0046] The cycloheteroalkyl ring can be optionally fused to or otherwise attached to other cycloheteroalkyl rings and/or non-aromatic hydrocarbon rings. Heterocyclic rings include those having from one to three heteroatoms independently selected from oxygen, sulfur, and nitrogen, in which the nitrogen and sulfur heteroatoms may optionally be oxidized and the nitrogen heteroatom may optionally be quaternized. In certain embodiments, the term heterocylic refers to a non-aromatic 5-, 6-, or 7-membered ring or a polycyclic group wherein at least one ring atom is a heteroatom selected from O, S, and N (wherein the nitrogen and sulfur heteroatoms may be optionally oxidized), including, but not limited to, a bi- or tri-cyclic group, comprising fused six-membered rings having between one and three heteroatoms independently selected from the oxygen, sulfur, and nitrogen, wherein (i) each 5-membered ring has 0 to 2 double bonds, each 6-membered ring has 0 to 2 double bonds, and each 7-membered ring has 0 to 3 double bonds, (ii) the nitrogen and sulfur heteroatoms may be optionally oxidized, (iii) the nitrogen heteroatom may optionally be quaternized, and (iv) any of the above heterocyclic rings may be fused to an aryl or heteroaryl ring. Representative cycloheteroalkyl ring systems include, but are not limited to pyrrolidinyl, pyrrolinyl, imidazolidinyl, imidazolinyl, pyrazolidinyl, pyrazolinyl, piperidyl, piperazinyl, indolinyl, quinuclidinyl, morpholinyl, thiomorpholinyl, thiadiazinanyl, tetrahydrofuranyl, and the like.

    [0047] The terms cycloalkyl and heterocycloalkyl, by themselves or in combination with other terms, represent, unless otherwise stated, cyclic versions of alkyl and heteroalkyl, respectively. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. Examples of cycloalkyl include, but are not limited to, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3-cyclohexenyl, cycloheptyl, and the like. Examples of heterocycloalkyl include, but are not limited to, 1-(1,2,5,6-tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4-morpholinyl, 3-morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl, tetrahydrothien-3-yl, 1-piperazinyl, 2-piperazinyl, and the like. The terms cycloalkylene and heterocycloalkylene refer to the divalent derivatives of cycloalkyl and heterocycloalkyl, respectively.

    [0048] An unsaturated alkyl group is one having one or more double bonds or triple bonds. Examples of unsaturated alkyl groups include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, 3-(1,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers. Alkyl groups which are limited to hydrocarbon groups are termed homoalkyl.

    [0049] More particularly, the term alkenyl as used herein refers to a monovalent group derived from a C.sub.1-20 inclusive straight or branched hydrocarbon moiety having at least one carbon-carbon double bond by the removal of a single hydrogen molecule. Alkenyl groups include, for example, ethenyl (i.e., vinyl), propenyl, butenyl, 1-methyl-2-buten-1-yl, pentenyl, hexenyl, octenyl, allenyl, and butadienyl.

    [0050] The term alkynyl as used herein refers to a monovalent group derived from a straight or branched C.sub.1-20 hydrocarbon of a designed number of carbon atoms containing at least one carbon-carbon triple bond. Examples of alkynyl include ethynyl, 2-propynyl (propargyl), I-propynyl, pentynyl, hexynyl, and heptynyl groups, and the like.

    [0051] The term alkylene by itself or a part of another substituent refers to a straight or branched bivalent aliphatic hydrocarbon group derived from an alkyl group having from 1 to about 20 carbon atoms, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 carbon atoms. The alkylene group can be straight, branched or cyclic. The alkylene group also can be optionally unsaturated and/or substituted with one or more alkyl group substituents. There can be optionally inserted along the alkylene group one or more oxygen, sulfur or substituted or unsubstituted nitrogen atoms (also referred to herein as alkylaminoalkyl), wherein the nitrogen substituent is alkyl as previously described. Exemplary alkylene groups include methylene (CH.sub.2); ethylene (CH.sub.2CH.sub.2); propylene ((CH.sub.2).sub.3); cyclohexylene (C.sub.6H.sub.10); CHCHCHCH; CHCHCH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.2, CH.sub.2CHCHCH.sub.2, CH.sub.2CsCCH.sub.2, CH.sub.2CH.sub.2CH(CH.sub.2CH.sub.2CH.sub.3)CH.sub.2, (CH.sub.2).sub.qN(R)(CH.sub.2).sub.r, wherein each of q and r is independently an integer from 0 to about 20, e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20, and R is hydrogen or lower alkyl; methylenedioxyl (OCH.sub.2O); and ethylenedioxyl (O(CH.sub.2).sub.2O). An alkylene group can have about 2 to about 3 carbon atoms and can further have 6-20 carbons. Typically, an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being some embodiments of the present disclosure. A lower alkyl or lower alkylene is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms.

    [0052] The term heteroaryl refers to aryl groups (or rings) that contain from one to four heteroatoms (in each separate ring in the case of multiple rings) selected from N, O, and S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized. A heteroaryl group can be attached to the remainder of the molecule through a carbon or heteroatom. Non-limiting examples of aryl and heteroaryl groups include phenyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3-pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2-pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-isoquinolyl, 5-isoquinolyl, 2-quinoxalinyl, 5-quinoxalinyl, 3-quinolyl, and 6-quinolyl. Substituents for each of above noted aryl and heteroaryl ring systems are selected from the group of acceptable substituents described below. The terms arylene and heteroarylene refer to the divalent forms of aryl and heteroaryl, respectively.

    [0053] For brevity, the term aryl when used in combination with other terms (e.g., aryloxy, arylthioxy, arylalkyl) includes both aryl and heteroaryl rings as defined above. Thus, the terms arylalkyl and heteroarylalkyl are meant to include those groups in which an aryl or heteroaryl group is attached to an alkyl group (e.g., benzyl, phenethyl, pyridylmethyl, furylmethyl, and the like) including those alkyl groups in which a carbon atom (e.g., a methylene group) has been replaced by, for example, an oxygen atom (e.g., phenoxymethyl, 2-pyridyloxymethyl, 3-(1-naphthyloxy)propyl, and the like). However, the term haloaryl, as used herein is meant to cover only aryls substituted with one or more halogens.

    [0054] A dashed line representing a bond in a cyclic ring structure indicates that the bond can be either present or absent in the ring. That is, a dashed line representing a bond in a cyclic ring structure indicates that the ring structure is selected from the group consisting of a saturated ring structure, a partially saturated ring structure, and an unsaturated ring structure.

    [0055] The symbols custom-character and - (e.g., as in OH) denote the point of attachment of a moiety to the remainder of a molecule.

    [0056] When a named atom of an aromatic ring or a heterocyclic aromatic ring is defined as being absent, the named atom is replaced by a direct bond.

    [0057] The terms alkoxyl or alkoxy are used interchangeably herein and refer to a saturated (i.e., alkyl-O) or unsaturated (i.e., alkenyl-O and alkynyl-O) group attached to the parent molecular moiety through an oxygen atom, wherein the terms alkyl, alkenyl, and alkynyl are as previously described and can include C.sub.1-20 inclusive, linear, branched, or cyclic, saturated or unsaturated oxo-hydrocarbon chains, including, for example, methoxyl, ethoxyl, propoxyl, isopropoxyl, n-butoxyl, sec-butoxyl, tert-butoxyl, and n-pentoxyl, neopentoxyl, n-hexoxyl, and the like.

    [0058] The term amino refers to the NH.sub.2 group and also refers to a nitrogen containing group as is known in the art derived from ammonia by the replacement of one or more hydrogen radicals by organic radicals. For example, the terms acylamino and alkylamino refer to specific N-substituted organic radicals with acyl and alkyl substituent groups respectively.

    [0059] The amino group is NRR, wherein R and R are typically selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.

    [0060] The terms halo, halide, or halogen as used herein refer to fluoro, chloro, bromo, and iodo groups. Additionally, terms, such as haloalkyl, are meant to include monohaloalkyl and polyhaloalkyl. For example, the term halo(C.sub.1-C.sub.4)alkyl is mean to include, but not be limited to, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.

    [0061] The term hydroxyl refers to the OH group.

    [0062] The term hydroxyalkyl refers to an alkyl group substituted with an OH group.

    [0063] The terms azide and azido refer to the group N.sub.3.

    [0064] The term peroxo denotes an OOR end group or an OO linking group.

    [0065] The term polyfluoroalkyl refers to an alkyl group in which all hydrogens are replaced by fluoride. Examples of polyfluoroalkyl groups include CF.sub.3, CF(CF.sub.3).sub.2, and CF.sub.2CF.sub.2CF.sub.3.

    [0066] The term thiocyanate as used herein refers to SCN group.

    [0067] Certain compounds of the present disclosure may possess asymmetric carbon atoms (optical or chiral centers) or double bonds; the enantiomers, racemates, diastereomers, tautomers, geometric isomers, stereoisometric forms that may be defined, in terms of absolute stereochemistry, as (R)- or (S)- or, as D- or L- for amino acids, and individual isomers are encompassed within the scope of the present disclosure. The compounds of the present disclosure do not include those which are known in art to be too unstable to synthesize and/or isolate. The present disclosure is meant to include compounds in racemic, scalemic, and optically pure forms. Optically active (R)- and (S)-, or D- and L-isomers may be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques. When the compounds described herein contain olefenic bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers.

    [0068] Unless otherwise stated, structures depicted herein are also meant to include all stereochemical forms of the structure; i.e., the R and S configurations for each asymmetric center. Therefore, single stereochemical isomers as well as enantiomeric and diastereomeric mixtures of the present compounds are within the scope of the disclosure.

    [0069] It will be apparent to one skilled in the art that certain compounds of this disclosure may exist in tautomeric forms, all such tautomeric forms of the compounds being within the scope of the disclosure. The term tautomer, as used herein, refers to one of two or more structural isomers which exist in equilibrium and which are readily converted from one isomeric form to another.

    [0070] Unless otherwise stated, structures depicted herein are also meant to include compounds which differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structures with the replacement of a hydrogen by a deuterium or tritium, or the replacement of a carbon by .sup.13C- or .sup.14C-enriched carbon are within the scope of this disclosure. The compounds of the present disclosure may also contain unnatural proportions of atomic isotopes at one or more of atoms that constitute such compounds. For example, the compounds may be radiolabeled with radioactive isotopes, such as for example tritium (.sup.3H), iodine-125 (.sup.125I) or carbon-14 (.sup.14C). All isotopic variations of the compounds of the present disclosure, whether radioactive or not, are encompassed within the scope of the present disclosure.

    [0071] The compounds of the present disclosure may exist as salts. The present disclosure includes such salts. Examples of applicable salt forms include hydrochlorides, hydrobromides, sulfates, methanesulfonates, nitrates, maleates, acetates, citrates, fumarates, tartrates (e.g., (+)-tartrates, ()-tartrates or mixtures thereof including racemic mixtures, succinates, benzoates and salts with amino acids, such as glutamic acid. These salts may be prepared by methods known to those skilled in art. Also included are base addition salts, such as sodium, potassium, calcium, ammonium, organic amino, or magnesium salt, or a similar salt. When compounds of the present disclosure contain relatively basic functionalities, acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent or by ion exchange. Examples of acceptable acid addition salts include those derived from inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric, dihydrogenphosphoric, sulfuric, monohydrogensulfuric, hydriodic, or phosphorous acids and the like, as well as the salts derived organic acids like acetic, propionic, isobutyric, maleic, malonic, benzoic, succinic, suberic, fumaric, lactic, mandelic, phthalic, benzenesulfonic, p-tolylsulfonic, citric, tartaric, methanesulfonic, and the like. Also included are salts of amino acids, such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like. Certain specific compounds of the present disclosure contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.

    [0072] Disclosed herein are metalloenzyme-mediated methods for CH bond activation. The methods can achieve H-atom abstraction (HAT) and form carbon-nitrogen, carbon-sulfur, carbon-carbon, and carbon-halogen bonds in a wide variety of substrates. The methods can be performed in vivo and in vitro, and are thus amenable to a range of bioorthogonal and synthetic applications.

    [0073] As used herein, the term H-atom abstraction (HAT) denotes the removal of a hydrogen atom from a substrate. Formally, H-atom abstraction includes hydrogen bond homolysis, resulting in the removal of a proton or deuteron and an electron from the substrate. H-atom abstraction often generates an organic radical at the site of hydrogen atom removal on the substrate.

    [0074] In certain aspects, the present invention provides a method for modifying an organic substrate by contacting the organic substrate with a non-heme metalloenzyme; abstracting a hydrogen atom from the organic substrate; and coupling a nucleophile to the organic substrate, thereby converting the organic substrate to a modified organic substrate. In some embodiments, the nucleophile is coupled to the carbon atom from which the hydrogen atom is abstracted. In some embodiments, the nucleophile is an azide, a halogen, a nitrile, a thiocyanate, a nitro, a cyanide, an alkoxide, a thiolate, an amine, a sulfonamide, an amide, a heteroaryl, or a trifluoromethyl. In some embodiments, the nucleophile is an azide or a halogen. In some embodiments, the nucleophile is an azide. In some embodiments, the nucleophile is a halogen. In some embodiments, the method has a chemoselectivity for azidation over fluorination of greater than about 3:2, greater than about 2:1, greater than about 3:1, greater than about 4:1, greater than about 5:1, greater than about 6:1, greater than about 7:1, greater than about 8:1, greater than about 9:1, greater than about 10:1, greater than about 12:1, greater than about 15:1, greater than about 20:1, or greater than about 25:1.

    [0075] In some embodiments, the non-heme metalloenzyme catalyzes the coupling between the nucleophile and the organic substrate. In some embodiments, the nucleophile is bonded to a metal cofactor of the non-heme metalloenzyme prior to the coupling. In particular embodiments, the nucleophile is bonded to the metal cofactor of the non-heme iron enzyme prior to the hydrogen atom abstraction. For example, the metal cofactor can be bonded to an azide or halide that is transferred from the metal cofactor to the substrate following hydrogen atom abstraction from the substrate.

    [0076] In particular aspects, the method includes contacting the organic substrate with a halogen source and a non-heme metalloenzyme, thereby abstracting a hydrogen from the organic substrate and coupling a halogen derived from the halogen source to the organic substrate. In some embodiments, the halogen is F, Cl, Br, or I. In some embodiments, the halogen is F. A general outline for this reaction is provided in SCHEME 1.

    ##STR00004##

    [0077] In some embodiments, the CH bond is an allylic CH bond, a benzylic CH bond, a propargylic CH bond, or an aliphatic CH bond. In some embodiments, the CH bond is an aliphatic CH bond. In some cases, the organic substrate is coupled to the halogen source, such that the reaction is an intramolecular reaction.

    [0078] In some embodiments, the halogen source has a structure according to any one of Formulas (I)(IV):

    ##STR00005##

    wherein: [0079] each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently the organic substrate, H, optionally substituted C.sub.1-18 alkyl, optionally substituted C.sub.1-18 polyfluoroalkyl, optionally substituted C.sub.2-18 alkenyl, optionally substituted C.sub.2-18 alkynyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroaryl, optionally substituted 6- to 10-membered heterocyclyl, cyano, halo, nitro, NR.sup.7R.sup.8, BR.sup.10R.sup.11, SiR.sup.7R.sup.8R.sup.9, C(O)OR.sup.7, C(O)SR.sup.7, C(O)NR.sup.7R.sup.8, C(O)R.sup.7, C(O)ONR.sup.7R.sup.8, C(O)NR.sup.7OR.sup.8, C(O)C(O)OR.sup.7, S(O)OR.sup.7, S(O)SR.sup.7, S(O)NR.sup.7R.sup.8, S(O)R.sup.7, S(O)ONR.sup.7R.sup.8, S(O)NR.sup.7OR.sup.8, S(O)C(O)OR.sup.7, S(O).sub.2OR.sup.7, S(O).sub.2SR.sup.7, S(O).sub.2NR.sup.7R.sup.8, S(O).sub.2R.sup.7, S(O).sub.2ONR.sup.7R.sup.8, S(O).sub.2NR.sup.7OR.sup.8, S(O).sub.2C(O)OR.sup.7, or P(O)(OR.sup.7)(OR.sup.8); [0080] each instance of R.sup.7, R.sup.8, and R.sup.9 is independently H, C.sub.1-C.sub.3 alkyl, or C.sub.1-C.sub.3 haloalkyl; [0081] each instance of R.sup.10 and R.sup.11 is independently H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, or OR.sup.7; [0082] each instance of X.sup.1 is independently F, Cl, Br, or I; and [0083] each instance of X.sup.2 is independently F, Cl, or Br.

    [0084] In some embodiments, each instance of X.sup.1 is independently F or Cl. In some embodiments, each instance of X.sup.1 is F. In some embodiments, each instance of X.sup.2 is independently F or Cl. In some embodiments, each instance of X.sup.2 is F.

    [0085] In some embodiments, each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently H, optionally substituted C.sub.1-18 alkyl, optionally substituted C.sub.1-18 polyfluoroalkyl, optionally substituted C.sub.2-18 alkenyl, optionally substituted C.sub.2-18 alkynyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroaryl, optionally substituted 6- to 10-membered heterocyclyl, cyano, halo, nitro, NR.sup.7R.sup.8, BR.sup.10R.sup.11, SiR.sup.7R.sup.8R.sup.9, C(O)OR.sup.7, C(O)SR.sup.7, C(O)NR.sup.7R.sup.8, C(O)R.sup.7, C(O)ONR.sup.7R.sup.8, C(O)NR.sup.7OR.sup.8, C(O)C(O)OR.sup.7, S(O)OR.sup.7, S(O)SR.sup.7, S(O)NR.sup.7R.sup.8, S(O)R.sup.7, S(O)ONR.sup.7R.sup.8, S(O)NR.sup.7OR.sup.8, S(O)C(O)OR.sup.7, S(O).sub.2OR.sup.7, S(O).sub.2SR.sup.7, S(O).sub.2NR.sup.7R.sup.8, S(O).sub.2R.sup.7, S(O).sub.2ONR.sup.7R.sup.8, S(O).sub.2NR.sup.7OR.sup.8, S(O).sub.2C(O)OR.sup.7, or P(O)(OR.sup.7)(OR.sup.8). In some embodiments, each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently H or optionally substituted C.sub.1-18 alkyl. In some embodiments, each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently H or optionally substituted C.sub.1-6 alkyl. In some embodiments, each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently H or C.sub.1-6 alkyl.

    [0086] In one embodiment, the hydrogen atom is abstracted by an organic radical generated by the non-heme metalloenzyme. In a particular embodiment, the organic radical is generated through homolysis of a bond on a radical precursor. In some embodiments, the radical precursor is coupled to the organic substrate. In some embodiments, the bond on the radical precursor is a halogen-halogen bond, a carbon-halogen bond, a nitrogen-halogen bond, or an oxygen-oxygen bond. In a specific embodiment, the method includes coupling a nucleophile to an organic substrate that contains a CH bond by contacting the organic substrate with a nucleophile source (M.sup.+X.sup.) containing the nucleophile, a radical precursor, and a non-heme metalloenzyme, thereby converting the organic substrate into a reaction product in which the CH bond is replaced by a bond between the carbon and the nucleophile group. A general outline for this reaction is provided in SCHEME 2, wherein RH is the organic substrate, M.sup.+X.sup. is the nucleophile source, and RX is the product.

    ##STR00006##

    [0087] In some embodiments, the CH bond is an allylic CH bond, a benzylic CH bond, a propargylic CH bond, or an aliphatic CH bond. In some embodiments, the CH bond is an aliphatic CH bond.

    [0088] In some embodiments, the nucleophile is fluoro, chloro, bromo, iodo, azido, thiocyanate, cyanate, isothiocyanate, isonitrile, cyanide, alkoxylate, thiolate, or a nitrogen-containing heterocycle. In some cases, the nucleophile source has a structure according to Formula (XIX):


    M.sup.+X.sup.(XIX)

    wherein M.sup.+ is Na.sup.+, K.sup.+, Cs.sup.+, or [N(R.sup.12).sub.4].sup.+; and wherein X.sup. is F.sup., Cl.sup., Br.sup., I.sup., N.sub.3.sup., SCN.sup., CN.sup., NCO.sup., [SR.sup.13].sup., or [OR.sup.13].sup.; wherein each instance of R.sup.12 is independently H, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.6 haloalkyl, or wherein two instances of R.sup.12 are taken together along with the nitrogen to which they are attached to form a C.sub.2-C.sub.8 heterocycloalkyl; and wherein each instance of R.sup.13 is independently H, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.6 haloalkyl. In some embodiments, the nucleophile source has a structure according to any one of Formulas (VIII)(XVII):

    ##STR00007##

    wherein each instance of R.sup.14, R.sup.15, R.sup.16, and R.sup.7 is independently H, optionally substituted C.sub.1-18 alkyl, C.sub.1-18 polyfluoroalkyl, optionally substituted C.sub.2-18 alkenyl, optionally substituted C.sub.2-18 alkynyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroaryl, optionally substituted 6- to 10-membered heterocyclyl, cyano, halo, nitro, NR.sup.18R.sup.19, BR.sup.21R.sup.22, SiR.sup.18R.sup.19R.sup.20, C(O)OR.sup.18, C(O)SR.sup.18, C(O)NR.sup.18R.sup.19, C(O)R.sup.18, C(O)ONR.sup.18R.sup.19, C(O)NR.sup.18OR.sup.19, C(O)C(O)OR.sup.18, S(O)OR.sup.18, S(O)SR.sup.18, S(O)NR.sup.18R.sup.19, S(O)R.sup.18, S(O)ONR.sup.18R.sup.19, S(O)NR.sup.18OR.sup.19, S(O)C(O)OR.sup.18, S(O).sub.2OR.sup.18, S(O).sub.2SR.sup.18, S(O).sub.2NR.sup.18R.sup.19, S(O).sub.2R.sup.18, S(O).sub.2ONR.sup.18R.sup.19, S(O).sub.2NR.sup.18OR.sup.19, S(O).sub.2C(O)OR.sup.18, or P(O)(OR.sup.18)(OR.sup.19); each instance of R.sup.18, R.sup.19, and R.sup.20 is independently H, C.sub.1-C.sub.3 alkyl, or C.sub.1-C.sub.3 haloalkyl; and each instance of R.sup.21 and R.sup.22 is independently H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, or OR.sup.18.

    [0089] In some embodiments, each instance of R.sup.14, R.sup.15, R.sup.16, and R.sup.17 is independently H or optionally substituted C.sub.1-18 alkyl. In some embodiments, each instance of R.sup.14, R.sup.15, R.sup.16, and R.sup.17 is independently H or optionally substituted C.sub.1-6 alkyl. In some embodiments, each instance of R.sup.14, R.sup.15, R.sup.16, and R.sup.17 is independently H or C.sub.1-6 alkyl.

    [0090] In some embodiments, the radical precursor has a structure according to any one of Formulas (I)(VII):

    ##STR00008## [0091] wherein each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently the organic substrate, H, optionally substituted C.sub.1-18 alkyl, optionally substituted C.sub.1-18 polyfluoroalkyl, optionally substituted C.sub.2-18 alkenyl, optionally substituted C.sub.2-18 alkynyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroaryl, optionally substituted 6- to 10-membered heterocyclyl, cyano, halo, nitro, NR.sup.7R.sup.8, BR.sup.10R.sup.11, SiR.sup.7R.sup.8R.sup.9, C(O)OR.sup.7, C(O)SR.sup.7, C(O)NR.sup.7R.sup.8, C(O)R.sup.7, C(O)ONR.sup.7R.sup.8, C(O)NR.sup.7OR.sup.8, C(O)C(O)OR.sup.7, S(O)OR.sup.7, S(O)SR.sup.7, S(O)NR.sup.7R.sup.8, S(O)R.sup.7, S(O)ONR.sup.7R.sup.8, S(O)NR.sup.7OR.sup.8, S(O)C(O)OR.sup.7, S(O).sub.2OR.sup.7, S(O).sub.2SR.sup.7, S(O).sub.2NR.sup.7R.sup.8, S(O).sub.2R.sup.7, S(O).sub.2ONR.sup.7R.sup.8, S(O).sub.2NR.sup.7OR.sup.8, S(O).sub.2C(O)OR.sup.7, or P(O)(OR.sup.7)(OR.sup.8); [0092] each instance of R.sup.7, R.sup.8, and R.sup.9 is independently H, C.sub.1-C.sub.3 alkyl, or C.sub.1-C.sub.3 haloalkyl; [0093] each instance of R.sup.10 and R.sup.11 is independently H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, or OR.sup.7; [0094] each instance of X.sup.1 is independently F, Cl, Br, or I; and [0095] each instance of X.sup.2 is independently F, Cl, or Br.

    [0096] In some embodiments, each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently H, optionally substituted C.sub.1-18 alkyl, optionally substituted C.sub.1-18 polyfluoroalkyl, optionally substituted C.sub.2-18 alkenyl, optionally substituted C.sub.2-18 alkynyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroaryl, optionally substituted 6- to 10-membered heterocyclyl, cyano, halo, nitro, NR.sup.7R.sup.8, BR.sup.10R.sup.11, SiR.sup.7R.sup.8R.sup.9, C(O)OR.sup.7, C(O)SR.sup.7, C(O)NR.sup.7R.sup.8, C(O)R.sup.7, C(O)ONR.sup.7R.sup.8, C(O)NR.sup.7OR.sup.8, C(O)C(O)OR.sup.7, S(O)OR.sup.7, S(O)SR.sup.7, S(O)NR.sup.7R.sup.8, S(O)R.sup.7, S(O)ONR.sup.7R.sup.8, S(O)NR.sup.7OR.sup.8, S(O)C(O)OR.sup.7, S(O).sub.2OR.sup.7, S(O).sub.2SR.sup.7, S(O).sub.2NR.sup.7R.sup.8, S(O).sub.2R.sup.7, S(O).sub.2ONR.sup.7R.sup.8, S(O).sub.2NR.sup.7OR.sup.8, S(O).sub.2C(O)OR.sup.7, or P(O)(OR.sup.7)(OR.sup.8). In some embodiments, each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently H or optionally substituted C.sub.1-18 alkyl. In some embodiments, each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently H or optionally substituted C.sub.1-6 alkyl. In some embodiments, each instance of R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5, and R.sup.6 is independently H or C.sub.1-6 alkyl. In some embodiments, each instance of X.sup.1 is independently F or Cl. In some embodiments, each instance of X.sup.1 is F. In some embodiments, each instance of X.sup.2 is independently F or Cl. In some embodiments, each instance of X.sup.2 is F.

    [0097] In some embodiments, the present invention provides a method for coupling a nucleophile group to an organic substrate that contains a CH bond by contacting the organic substrate with a nucleophile source (M.sup.+X.sup.) containing the nucleophile and a non-heme metalloenzyme, thereby converting the organic substrate to a reaction product in which the CH bond is replaced by a bond between the carbon and the nucleophile. Contrasting many radical transfer reactions, an N-haloamine of the organic substrate can be stable during the method (e.g. the N-haloamine is not dehalogenated in the presence of the non-heme metalloenzyme and nucleophile source). For example, in some embodiments, the compound containing the organic substrate has a structure according to Formula (XVIII):

    ##STR00009## [0098] wherein each instance of R.sup.23, R.sup.24, R.sup.25, R.sup.26, R.sup.27, R.sup.28, R.sup.29, R.sup.30, R.sup.31, R.sup.32, and R.sup.33 is independently H, optionally substituted C.sub.1-18 alkyl, C.sub.1-18 polyfluoroalkyl, optionally substituted C.sub.2-18 alkenyl, optionally substituted C.sub.2-18 alkynyl, optionally substituted C.sub.6-10 aryl, optionally substituted 6- to 10-membered heteroaryl, optionally substituted 6- to 10-membered heterocyclyl, cyano, halo, nitro, NR.sup.34R.sup.35, BR.sup.37R.sup.38, SiR.sup.34R.sup.35R.sup.36, C(O)OR.sup.34, C(O)SR.sup.34, C(O)NR.sup.34R.sup.35, C(O)R.sup.34, C(O)ONR.sup.34R.sup.35, C(O)NR.sup.34OR.sup.35, C(O)C(O)OR.sup.34, S(O)OR.sup.34, S(O)SR.sup.34, S(O)NR.sup.34R.sup.35, S(O)R.sup.34, S(O)ONR.sup.34R.sup.35, S(O)NR.sup.34OR.sup.35, S(O)C(O)OR.sup.34, S(O).sub.2OR.sup.34, S(O).sub.2SR.sup.34, S(O).sub.2NR.sup.34R.sup.35, S(O).sub.2R.sup.34, S(O).sub.2ONR.sup.34R.sup.35, S(O).sub.2NR.sup.34OR.sup.35, S(O).sub.2C(O)OR.sup.34, or P(O)(OR.sup.34)(OR.sup.35). [0099] each instance of R.sup.34, R.sup.35, and R.sup.36 is independently H, C.sub.1-C.sub.3 alkyl, or C.sub.1-C.sub.3 haloalkyl; [0100] each instance of R.sup.37 and R.sup.38 is independently H, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 haloalkyl, or OR.sup.34; and [0101] X.sub.3 is F, Cl, Br, or I.

    [0102] In such cases, the method may follow a reaction as outlined in SCHEME 3.

    ##STR00010##

    [0103] In some embodiments, the CH bond is an allylic CH bond, a benzylic CH bond, a propargylic CH bond, or an aliphatic CH bond. In some embodiments, the CH bond is an aliphatic CH bond.

    [0104] In some embodiments, the nucleophile is fluoro, chloro, bromo, iodo, azido, thiocyanate, cyanate, isothiocyanate, isonitrile, cyanide, alkoxylate, thiolate, or a nitrogen-containing heterocycle. In some embodiments, the nucleophile is a halogen or an azide. In some cases, the nucleophile source has a structure according to Formula (XIX):


    M.sup.+X.sup.(XIX),

    wherein M.sup.+ is Na.sup.+, K.sup.+, Cs.sup.+, or [N(R.sup.12).sub.4].sup.+; and wherein X.sup. is F.sup., Cl.sup., Br.sup., I.sup., N.sub.3.sup., SCN.sup., CN.sup., NCO.sup., [SR.sup.13].sup., or [OR.sup.13].sup.; wherein each instance of R.sup.12 is independently H, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.6 haloalkyl, or wherein two instances of R.sup.12 are taken together along with the nitrogen to which they are attached to form a C.sub.2-C.sub.8 heterocycloalkyl; and wherein each instance of R.sup.13 is independently H, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.6 haloalkyl. In some embodiments, the nucleophile source has a structure according to any one of Formulas (VIII)(XVII).

    [0105] In some embodiments, the method includes contacting the organic substrate with the non-heme metalloenzyme, thereby replacing a CH bond of a carbon with a bond between the carbon and a halogen. In some embodiments, the halogen is coupled to a nitrogen of the organic substrate (e.g., as an N-haloamine) prior to the method. In such cases, the method can transfer the CH bond hydrogen to the nitrogen of the nitrogen. For example, the method can utilize a compound of Formula (XVIII) and proceed according to SCHEME 4, wherein X.sup.3 is transferred from a nitrogen on the organic substrate to a carbon on the organic substrate, and a hydrogen is transferred from the carbon of the organic substrate to the nitrogen of the organic substrate.

    ##STR00011##

    [0106] As detailed further herein, the use of non-heme metalloenzymes can provide high degrees of stereochemical control over a reaction. While many radical mechanisms racemize substrates, active site sterics imposed by the non-heme metalloenzyme can impose isomerism upon transition states and reaction intermediates (e.g. H- or X-atom abstracted organic substrates) to achieve asymmetric catalysis. In some cases, a reaction product has an enantiomeric ratio of at least about 60:40, at least about 65:35, at least about 70:30, at least about 75:25, at least about 80:20, at least about 85:15, at least about 90:10, or at least about 95:5. In some cases, the reaction product has an excess of (R)-enantiomers relative to (S)-enantiomers. In some cases, the reaction product has an excess of (S)-enantiomers relative to (R)-enantiomers.

    [0107] The non-heme metalloenzyme can be an enzyme containing a non-heme metal cofactor. While heme enzymes are unique among natural enzymes in their ability to oxidize stable substrates and stabilize low spin and high valence iron centers (e.g., iron(IV)) that can promote 2-electron oxidation chemistry over controlled one electron radical mechanisms. As disclosed herein, repurposed non-heme metalloenzymes can utilize non-heme metal cofactors to generate and manipulate radical intermediates with high degrees of chemical and stereochemical control. The non-heme metalloenzyme can catalyze the in vitro and in vivo formation of carbon-nitrogen, carbon-sulfur, carbon-carbon, and carbon-halogen bonds by combining different synthetic radical CH activation mechanisms with metal-mediated bond forming processes.

    [0108] In some embodiments, the non-heme metalloenzyme includes an iron cofactor, a copper cofactor, a cobalt cofactor, a manganese cofactor, a nickel cofactor, or a chromium cofactor (e.g., the cofactor that mediates a reaction disclosed herein). In some cases, the non-heme metalloenzyme includes an iron cofactor. In some cases, the non-heme metalloenzyme includes a nonnative metal cofactor. For example, the non-heme metalloenzyme can be a non-heme iron enzyme expressed in apo form and loaded with a copper, cobalt, manganese, nickel, or a chromium cofactor. Alternatively, the non-heme metalloenzyme that natively utilizes a non-iron metal cofactor can be repurposed with an iron cofactor for use in a method disclosed herein.

    [0109] In some embodiments, the non-heme metalloenzyme is an iron(II) enzyme (e.g., contains an iron cofactor with a +2 oxidation state). The non-heme iron enzyme can serve as a catalyst, interconverting between iron(II) and iron(III) states during the method. In particular cases, the non-heme metalloenzyme includes iron(II) that converts to iron (III) upon radical generation (e.g., H- or X-atom abstraction (halogen atom abstraction) from the organic substrate or halogen source) and converts back to iron(II) upon H- or X-atom donation (halogen atom donation) to the substrate or halogen source. In some embodiments, the iron cofactor does not adopt a +4 oxidation state. As iron(IV) can be a strong oxidant, avoiding iron(IV) oxidation states can limit promiscuous oxidation chemistry and side product generation by the iron cofactor.

    [0110] In some aspects, the methods are performed in the absence of oxygen (i.e., under anoxic or anaerobic conditions) to prevent oxidation or inactivation of the non-heme iron enzyme, to limit radical intermediate quenching, and, in the case of in vivo reactions, to limit aerobic metabolism. As used herein, absence of oxygen can denote less than 1000 parts per million (ppm) O.sub.2, less than 500 ppm O.sub.2, less than 400 ppm O.sub.2, less than 300 ppm O.sub.2, less than 200 ppm O.sub.2, less than 100 ppm O.sub.2, less than 50 ppm O.sub.2, less than 25 ppm O.sub.2, less than 10 ppm O.sub.2, or less than 5 ppm O.sub.2 in the atmosphere surrounding a reaction system or dissolved within a reaction system.

    [0111] In some embodiments, the non-heme metalloenzyme is Sav HppD (SEQ ID NO:1) or a fragment or mutant thereof. In some embodiments, the non-heme metalloenzyme has at least about 70% sequence identity to SEQ ID NO:1 and at least 1 mutation relative to SEQ ID NO:1. In some embodiments, In some embodiments the non-heme metalloenzyme has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.5% sequence identity to SEQ ID NO:1. In some cases, the non-heme metalloenzyme has at least one mutation relative to SEQ ID NO:1. In some cases, the at least one mutation includes at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, or at least 15 mutations relative to SEQ ID NO:1. In some cases, the non-heme metalloenzyme includes at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, at least fourteen, or all fifteen mutations relative to SEQ ID NO:1 at positions selected from H187, V189, N191, L228, S230, P243, N245, Q255, Q269, H270, F336, E349, F364, L367, and F368. In some cases, the non-heme metalloenzyme includes at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or at least eleven mutations relative to SEQ ID NO:1 selected from V189A, N191A, F216A, S230L, P243A, P243G, N245Q, N245F, Q255A, Q255P, and L367I. In some cases, the at least one mutation diminishes active site volume in the non-heme metalloenzyme.

    [0112] In some embodiments, the non-heme metalloenzyme has at least at least 98.2%, at least 98.4%, at least 98.6%, at least 98.8%, at least 99%, at least 99.2%, at least 99.4%, or at least 99.6% sequence identity to SEQ ID NO:2 or SEQ ID NO:3. In some embodiments, the non-heme metalloenzyme is Sav HppD Az1 (SEQ ID NO:2) or a fragment or mutant thereof. In some embodiments the non-heme metalloenzyme has at least 98.2%, at least 98.4%, at least 98.6%, at least 98.8%, at least 99%, at least 99.2%, at least 99.4%, or at least 99.6% sequence identity to SEQ ID NO:2. In some embodiments, the non-heme metalloenzyme is Sav HppD Az2 (SEQ ID NO:3) or a fragment or mutant thereof. In some embodiments the non-heme metalloenzyme has at least 98.2%, at least 98.4%, at least 98.6%, at least 98.8%, at least 99%, at least 99.2%, at least 99.4%, or at least 99.6% sequence identity SEQ ID NO:3.

    [0113] Exemplary non-heme metalloenzymes which can be utilized for the methods of the present invention are listed in TABLE 1. In certain embodiments, the non-heme metalloenzyme is 4-hydroxymandelate synthase from Amycolatopsis orientalis, 4-hydroxyphenylpyruvate dioxygenase from Streptomyces avermitilis, isopenicillin N synthase from Emericella nidulans, 2-hydroxypropylphosphonic acid epoxidase from Streptomyces viridochromogenes, phenylalanine hydroxylase from Chromobacterium violaceum, hercynine oxygenase from Mycolicibacterium thermoresistibile, -ketoglutarate-dependent dioxygenase AlkB from Escherichia coli, -ketoglutarate-dependent halogeanse SyrB2 from Pseudomonas syringae, -ketoglutarate-dependent halogeanse BesD from Streptantibioticus cattleyicolor, -ketoglutarate-dependent dioxygenase SadA from Burkholderia ambifaria, -ketoglutarate-dependent dioxygenase Evdo2 from Micromonospora carbonacea, proline cis-4-hydroxylase from Mesorhizobium japonicum, polyoxin hydroxylase from Streptomyces aureochromogenes, or a variant thereof. In certain embodiments, the non-heme metalloenzyme has at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.5% sequence identity to any one of SEQ ID NO:1-16. In some embodiments, the non-heme metalloenzyme has at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten mutations relative to any one of SEQ ID NO:1-16.

    TABLE-US-00001 TABLE1 SEQ Enzyme IDNO SEQUENCE SavHppD SEQID MTQTTHHTPDTARQADPFPVKGMDAVVFAVGN NO:1 AKQAAHYYSTAFGMQLVAYSGPENGSRETASY VLTNGSARFVLTSVIKPATPWGHFLADHVAEHG DGVVDLAIEVPDARAAHAYAIEHGARSVAEPYE LKDEHGTVVLAAIATYGKTRHTLVDRTGYDGPY LPGYVAAAPIVEPPAHRTFQAIDHCVGNVELGR MNEWVGFYNKVMGFTNMKEFVGDDIATEYSAL MSKVVADGTLKVKFPINEPALAKKKSQIDEYLEF YGGAGVQHIALNTGDIVETVRTMRAAGVQFLDT PDSYYDTLGEWVGDTRVPVDTLRELKILADRDE DGYLLQIFTKPVQDRPTVFFEIIERHGSMGFGKGN FKALFEAIEREQEKRGNL SavHppDAz1 SEQID MTQTTHHTPDTARQADPFPVKGMDAVVFAVGN NO:2 AKQAAHYYSTAFGMQLVAYSGPENGSRETASY VLTNGSARFVLTSVIKPATPWGHFLADHVAEHG DGVVDLAIEVPDARAAHAYAIEHGARSVAEPYE LKDEHGTVVLAAIATYGKTRHTLVDRTGYDGPY LPGYVAAAPIVEPPAHRTFQAIDHCAGNVELGR MNEWVGFYNKVMGFTNMKEAVGDDIATEYSAL MSKVVADGTLKVKFAIQEPALAKKKSAIDEYLEF YGGAGVQHIALNTGDIVETVRTMRAAGVQFLDT PDSYYDTLGEWVGDTRVPVDTLRELKILADRDE DGYLLQIFTKPVQDRPTVFFEIIERHGSMGFGKGN FKAIFEAIEREQEKRGNL SavHppDAz2 SEQID MTQTTHHTPDTARQADPFPVKGMDAVVFAVGN NO:3 AKQAAHYYSTAFGMQLVAYSGPENGSRETASY VLTNGSARFVLTSVIKPATPWGHFLADHVAEHG DGVVDLAIEVPDARAAHAYAIEHGARSVAEPYE LKDEHGTVVLAAIATYGKTRHTLVDRTGYDGPY LPGYVAAAPIVEPPAHRTFQAIDHCAGAVELGR MNEWVGFYNKVMGFTNMKEFVGDDIATEYSAL MLKVVADGTLKVKFGIFEPALAKKKSPIDEYLEF YGGAGVQHIALNTGDIVETVRTMRAAGVQFLDT PDSYYDTLGEWVGDTRVPVDTLRELKILADRDE DGYLLQIFTKPVQDRPTVFFEIIERHGSMGFGKGN FKAIFEAIEREQEKRGNL Amycolatopsisorientalis SEQID MQNFEIDYVEMYVENLEVAAFSWVDKYAFAVA 4-hydroxymandelate NO:4 GTSRSADHRSIALRQGQVTLVLTEPTSDRHPAAA synthase YLQTHGDGVADIAMATSDVAAAYEAAVRAGAE AVRAPGQHSEAAVTTATIGGFGDVVHTLIQRDG TSAELPPGFTGSMDVTNHGKGDVDLLGIDHFAIC LNAGDLGPTVEYYERALGFRQIFDEHIVVGAQA MNSTVVQSASGAVTLTLIEPDRNADPGQIDEFLK DHQGAGVQHIAFNSNDAVRAVKALSERGVEFLK TPGAYYDLLGERITLQTHSLDDLRATNVLADED HGGQLFQIFTASTHPRHTIFFEVIERQGAGTFGSS NIKALYEAVELERTGQSEFGAARR Streptomycesavermitilis SEQID MTQTTHHTPDTARQADPFPVKGMDAVVFAVGN 4-hydroxyphenylpyruvate NO:5 AKQAAHYYSTAFGMQLVAYSGPENGSRETASY dioxygenase VLTNGSARFVLTSVIKPATPWGHFLADHVAEHG DGVVDLAIEVPDARAAHAYAIEHGARSVAEPYE LKDEHGTVVLAAIATYGKTRHTLVDRTGYDGPY LPGYVAAAPIVEPPAHRTFQAIDHCVGNVELGR MNEWVGFYNKVMGFTNMKEFVGDDIATEYSAL MSKVVADGTLKVKFPINEPALAKKKSQIDEYLEF YGGAGVQHIALNTGDIVETVRTMRAAGVQFLDT PDSYYDTLGEWVGDTRVPVDTLRELKILADRDE DGYLLQIFTKPVQDRPTVFFEIIERHGSMGFGKGN FKALFEAIEREQEKRGNL Emericellanidulans SEQID MGSVSKANVPKIDVSPLFGDDQAAKMRVAQQID isopenicillinNsynthase NO:6 AASRDTGFFYAVNHGINVQRLSQKTKEFHMSITP EEKWDLAIRAYNKEHQDQVRAGYYLSIPGKKAV ESFCYLNPNFTPDHPRIQAKTPTHEVNVWPDETK HPGFQDFAEQYYWDVFGLSSALLKGYALALGKE ENFFARHFKPDDTLASVVLIRYPYLDPYPEAAIKT AADGTKLSFEWHEDVSLITVLYQSNVQNLQVET AAGYQDIEADDTGYLINCGSYMAHLTNNYYKAP IHRVKWVNAERQSLPFFVNLGYDSVIDPFDPREP NGKSDREPLSYGDYLQNGLVSLINKNGQT Streptomyces SEQID MSNTKTASTGFAELLKDRREQVKMDHAALASLL viridochromogenes2- NO:7 GETPETVAAWENGEGGELTLTQLGRIAHVLGTSI hydroxypropylphosphonic GALTPPAGNDLDDGVIIQMPDERPILKGVRDNVD acidepoxidase YYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKF NSGHAGNEFLFVLEGEIHMKWGDKENPKEALLP TGASMFVEEHVPHAFTAAKGTGSAKLIAVNF Chromobacterium SEQID MNDRADFVVPDITTRKNVGLSHDANDFTLPQPL violaceumphenylalanine NO:8 DRYSAEDHATWATLYQRQCKLLPGRACDEFME hydroxylase GLERLEVDADRVPDFNKLNQKLMAATGWKIVA VPGLIPDDVFFEHLANRRFPVTWWLREPHQLDY LQEPDVFHDLFGHVPLLINPVFADYLEAYGKGG VKAKALGALPMLARLYWYTVEFGLINTPAGMRI YGAGILSSKSESIYCLDSASPNRVGFDLMRIMNTR YRIDTFQKTYFVIDSFKQLFDATAPDFAPLYLQLA DAQPWGAGDVAPDDLVLNAGDRQGWADTEDV hercynineoxygenasefrom SEQID MTGVAVPHRAELARQLIDARNRTLRLVDFDDAE Mycolicibacterium NO:9 LRRQYDPLMSPLVWDLAHIGQQEELWLLRGGDP thermoresistibile, RRPGLLEPAVEQLYDAFVHPRASRVHLPLLSPAQ ARRFCATVRSAVLDALDRLPEDADTFAFGMVVS HEHQHDETMLQALNLRSGEPLLGSGTALPPGRP GVAGTSVLVPGGPFVLGVDLADEPYALDNERPA HVVDVPAFRIGRVPVTNAEWRAFIDDGGYRQRR WWSDAGWAYRCEAGLTAPQFWNPDGTRTRFG HVEDIPPDEPVQHVTYFEAEAYAAWAGARLPTEI EWEKACAWDPATGRRRRYPWGDAAPTAALANL GGDALRPAPVGAYPAGASACGAEQMLGDVWE WTSSPLRPWPGFTPMIYQRYSQPFFEGAGSGDYR VLRGGSWAVAADILRPSFRNWDHPIRRQIFAGVR LAWDVDRQTARPGPVGGC Escherichiacoli- SEQID MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLI ketoglutarate-dependent NO:10 RDINDVASQSPFRQMVTPGGYTMSVAMTNCGHL dioxygenaseAlkB GWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLC QRAATAAGYPDFQPDACLINRYAPGAKLSLHQD KDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRL LLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTID CRYNLTFRQAGKKE Pseudomonassyringae- SEQID MSKKFALTAEQRASFEKNGFIGPFDAYSPEEMKE ketoglutarate-dependent NO:11 TWKRTRLRLLDRSAAAYQDLDAISGGTNIANYD halogeanseSyrB2 RHLDDDFLASHICRPEICDRVESILGPNVLCWRTE FFPKYPGDEGTDWHQADTFANASGKPQIIWPENE EFGGTITVWTAFTDANIANGCLQFIPGTQNSMNY DETKRMTYEPDANNSVVKDGVRRGFFGYDYRQ LQIDENWKPDEASAVPMQMKAGQFIIFWSTLMH ASYPHSGESQEMRMGFASRYVPSFVHVYPDSDHI EEYGGRISLEKYGAVQVIGDETPEYNRLVTHTTR GKKFEAV Streptantibioticus SEQID MCAPLEKDDIRRLSQAFHRFGIVTVTELIEPHTRK cattleyicolor- NO:12 LVRAEADRLLDQYAERRDLRLATTDYTRRSMSV ketoglutarate-dependent VPSETIAANSELVTGLYAHRELLAPLEAIAGERLH halogeanseBesD PCPKADEEFLITRQEQRGDTHGWHWGDFSFALI WVLQAPPIDVGGLLQCVPHTTWDKASPQINRYL VENPIDTYHFESGDVYFLRTDTTLHRTIPLREDTT RIILNMTWAGERDLSRKLAADDRWWDNAEVSA ARAI Burkholderiaambifaria- SEQID MQHTYPAQLMRFGTAARAEHMTIAAAIHALDA ketoglutarate-dependent NO:13 DEADAIVMDIVPDGERDAWWDDEGFSSSPFTKN dioxygenaseSadA AHHAGIVATSVTLGQLQREQGDKLVSKAAEYFG IACRVNDGLRTTRFVRLESDALDAKPLTIGHDYE VEFLLATRRVYEPFEAPFNFAPHCDDVSYGRDTV NWPLKRSFPRQLGGFLTIQGADNDAGMVMWDN RPESRAALDEMHAEYRETGAIAALERAAKIMLK PQPGQLTLFQSKNLHAIERCTSTRRTMGLFLIHTE DGWRMFD Micromonospora SEQID MDAMEVVGTIDHRDREEFRSRGFAILPQVASESE carbonacea- NO:14 VAWLRQAYDRLFVRRATPGAEDFYDIAGQRDRE ketoglutarate-dependent GPPLLPQIIKPEKYVPELLDSPHFARCRSIASAFLD dioxygenaseEvdo2 MAEEELEFYGHAILKPPRYGAPTPWHQDEAYMD PRWRRRGLSIWTTLDEATVESGCLHYLPGGHRG PVLPHHHIDNDDRIRGLMTDDVDPTSAVACPLAP GGAVVHDFRTPHYAGPNLTDQPRRAYVLVFMS APAEVADPEPRPWMDWG Mesorhizobiumjaponicum SEQID MTTRILGVVQLDQRRLTDDLAVLAKSNFSSEYSD Prolinecis-4-hydroxylase NO:15 FACGRWEFCMLRNQSGKQEEQRVVVHETPALA TPLGQSLPYLNELLDNHEDRDSIRYARIIRISENAC IIPHRDYLELEGKFIRVHLVLDTNEKCSNTEENNI FHMGRGEIWFLDASLPHSAGCFSPTPRLHLVVDI EGTRSLEEVAINVEQPSARNATVDTRKEWTDETL ESVLGFSEIISEANYREIVAILAKLHFFHKVHCVD MYGWLKEICRRRGEPALIEKANSLERFYLIDRAA GEVMTY Streptomyces SEQID MLTRPTAALSSPADITGDLVRTGFSMVPGSDMR aureochromogenes NO:16 VPAALQDSLKTLAASYDDLPADPYLPDGGNYRY polyoxinhydroxylase RRHTRYTWRPATGELLVADNPGYFQTVENNAFA GGQWRKYEELTDEVREGAFLTALIDENVGRLPLP EVEQWAVQVHCVRIVARDDAQGRPTPEGVHRD GCTYVSLHMVNRHNISGGRTSVYTPEHELITEKV FTDCLDSFFGDDPRVRHGVADVSVADPSLGEGT RDMLLMSYDPM

    [0114] In certain embodiments, the non-heme metalloenzyme is a non-heme metalloenzyme listed in TABLE 6 or a mutant thereof.

    TABLE-US-00002 TABLE 6 Enzyme Name Protein ID AaSOR uniprot P29082 AgAO P46881 AkbC uniprot Q6REQ5 AlkB P05050, pBLAST Sequence ID: WP_000884971.1 AoDHP uniprot Q9NAV7 ApPgb LQ uniprot Q9YFF4 ArCTD uniprot Q9F103 AroG uniprot 053512 AsqJ Q5AR53, pBLAST Sequence: XP_682496.1 AtLDOX uniprot Q96323 AviO1 uniprot Q93KW4 BaP4H Uniprot Q81LZ8 CglAlcOx E3QHV8 Cj LPMO uniprot B3PJ79 res 37- 216 CkoPE uniprot B1L4V6 CotA_NG uniprot P07788 CylC Uniprot K7S6E6 CYP2C9_T301G.sub. uniprot P11712 C435S CYP101_T252G-C358S Uniprot P00183 CYP119 uniprot Q55080 CYP119_T213G_C317S uniprot Q55080 CYP153A7_T259G- Uniprot Q5F4D9 C366S CytC3 Uniprot DOVX22, pBLAST Sequence ID: 3GJA_A DAD uniprot Q9REI7 DaP4H-NHis pBLAST Sequence ID: AIS76464.1 DaP4H_L139S pBLAST Sequence ID: ANH21194.1 EcMenD uniprot P17109 EfCBM33A uniprot Q838S1 EFE Uniprot Q549K5; pBLAST Sequence ID: WP_054082735.1 EgtB uniprot G7CFI3 EvdO1 uniprot A0A0M3KL03 EvdO2 A0A0M3KL01, pBLAST Sequence ID: 4XAB_A EvdO2-pET28a(+) uniprot A0A0M3KL01 GLO1 uniprot Q68RJ8 gloA uniprot P0AC81 GriE_pET28a A0A0E3URV8 GYG1 uniprot P13280 hepD_pET28a Q51W40 HMS_pET28a 052791 Hth cyt c uniprot P15452 HygX uniprot Q2MFS1 IPNS_pET28a P05326 Jd LPMO uniprot C7R410 res 32-173 LapB uniprot Q7WYF5 LdoA pBLAST Sequence ID: WP_012408787.1 LDOX Q96323, pBLAST Sequence ID: NP_001031700.1 M35_CStrep3 Unitpro POCS93 M35_CTwinStrep Unitpro POCS93 MaPgb C101S uniprot Q8TLY9 Mb VA uniprot P02185 MerB uniprot P77072 MIP4H-1 pBLAST Sequence ID: WP_010913924.1 mtaD uniprot Q9X034 MxPDO1b uniprot Q1D4C9 Ne NitroCyan uniprot Q820S6 NeSOR uniprot Q74MF3 Nmar1307 uniprot A9A2G4 Opd uniprot Q9NAV7 P411 CHA uniprot P14779 P450 BM3 Uniprot P14779 PaAzu DGA uniprot P00282 PaAzu DGE uniprot P00282 PaAzu DGQ uniprot P00282 PaAzu HGA uniprot P00282 PaAzu HGE uniprot P00282 PaAzu HGQ uniprot P00282 PaKae1 uniprot Q9UXT7 pckA uniprot A6VKV4 PcTE uniprot O50580 pddABC_AA uniprot Q59470 pduCDE uniprot A0A0H3H0N6; A0A0H3H347; A0A0H3H105 PH0974 uniprot 058691 PHHA Uniprot P30967 plu4264 uniprot Q7MZL9 PnpC uniprot C6FI44 PolL pBLAST Sequence ID: ABX24492.1 PpPDO2 uniprot A5VWI3 Psf4_pET-29b(+) uniprot Q9JN69 PsHPPD_pET28a uniprot Q53586 Rgl cyt c uniprot P00080 Rma cyt c uniprot B3FQS5 Rma cyt c TDE uniprot B3FQS5 Rma NOD Y32G uniprot D0MGT2 rocF uniprot P53608 RPA4178 uniprot Q6N272 Rusticyanin uniprot POC918 SadA_D157G pBLAST Sequence ID: WP_011660927.1, Uniprot Q0B2N4 SadA_D157G_pQTEV uniprot Q0B2N4 Sav HppD uniprot Q53586 Sfri_3296 uniprot Q07XY2 SlBesD WP_030791981.1 Sli LPMO uniprot D6EWM4 res 30 - 201 SmP4H-1 pBlast Sequence ID: WP_010970414.1 SpP4H type II pBLAST Sequence ID: O09345.1 StrP4H-II_pET28a uniprot O09345 SwHalB uniprot A0A1HOBKU7 swHppE uniprot Q56185 swHppE AA uniprot Q56185 swHPPE-pET-29b(+) Q56185 SyrB2_pET28a Q9RBY6 TaqFBP uniprot Q9RHA2 TC5S uniprot Q70AC7 TM0416 uniprot Q9WYP7 TM1602 uniprot Q9X1T8 TM_0820 uniprot Q9WZS7 TM_1162 uniprot Q9XOP5 TM_1287 uniprot Q9X113 TPH1 uniprot p70080 Tt Laccase uniprot Q72HW2 TtHCS uniprot 087198 UndA_pET22b Q4K8M0 vCPH Uniprot Q84406 vioC_pET28a Q6WZBO VmoLac uniprot FOQXN6, PDB: 4RE0 WelO5 A0A067YX61, pBLAST Sequence ID: 5J4R_A YjbI Y25I T45A Q49A uniprot 031607

    [0115] As a practical matter, whether any particular nucleic acid molecule or polypeptide is at least, for example, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide or peptide sequence of the presence invention can be determined conventionally using known computer programs. A preferred method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also referred to as a global sequence alignment, can be determined using the FASTDB computer program based on the algorithm of Brutlag et al. (Comp. App. Biosci. (1990) 6:237-245.) In a sequence alignment the query and subject sequences are both DNA sequences. An RNA sequence can be compared by converting U's to T's. The result of said global sequence alignment is in percent identity. Preferred parameters used in a FASTDB alignment of DNA sequences to calculate percent identity are: Matrix=Unitary, k-tuple=4, Mismatch Penalty=1, Joining Penalty=30, Randomization Group Length=0, Cutoff Score=1, Gap Penalty=5, Gap Size Penalty 0.05, Window Size=500 or the length of the subject nucleotide sequence, whichever is shorter.

    [0116] In a further aspect, the present invention provides a composition that includes a non-heme metalloenzyme, an organic substrate comprising a CH bond, and one or more of a halogen source, a nucleophile source, and a radical precursor as detailed herein.

    [0117] The present invention further discloses targeted, guided, and directed evolution to develop and enhance enzyme-based catalysts for CH bond functionalization reactions not previously present in biology. In some cases, the non-heme metalloenzyme includes at least one mutation relative to a wild-type enzyme. In some cases, the mutation increases the hydrophobicity of the active site (e.g., replaces a protic amino acid residue with an aprotic amino acid residue). In some cases, the mutation increases volume of the active site.

    [0118] In some embodiments, the engineered non-heme iron proteins catalyze carbon-nitrogen, carbon-sulfur, carbon-carbon, and carbon-halogen bond formation with a total turnover number (TTN) over 10000 and enantiomeric excess (ee) up to 94%. Carbon-hydrogen bond functionalization (e.g., CH functionalization and/or C(sp.sup.3)-H functionalization) is a type of reaction in which a carbon-hydrogen bond is cleaved and replaced with a carbon-Y bond (where Y can be carbon, oxygen, sulfur, nitrogen, or a halogen). The term can imply that a transition metal is involved in the CH cleavage process. Halogens can include fluorine, chlorine, bromine, iodine, astatine, and/or tennessine.

    [0119] Further disclosed herein are new biocatalysts to perform a non-natural C(sp.sup.3)-H azidation reaction. Current synthetic approaches for this reaction are limited in turnovers and enantioselectivity, and often require an acidic azide source to complete the reaction. These limitations were overcome by leveraging the genetic tunability and high catalytic efficiency of multiple metalloenzymes, including a number of non-heme iron enzymes. As detailed further in the examples below, azidation of an N-fluoroamide substrate 1NF was achieved with a panel of nine functionally diverse non-heme iron enzymes under whole-cell conditions. Among the metalloenzymes that were tested, a (4-hydroxyphenyl)pyruvate dioxygenase from Streptomyces avermitilis (Sav HppD) provided the desired azidation product with a total turnovers (TTN) of greater than 100, an enantiomeric ratio (e.r.) of greater than 3:2, and a chemoselectivity of greater than 4:1 for azidation over fluorination product.

    [0120] Metalloenzymes are a broad group of enzymes that use a metal cation as a cofactor in the enzyme active site. The enzymes promote a diverse range of reactions including hydrolytic processes and oxidation/reductions. Metalloenzymes can include, but are not limited to, non-heme iron enzymes. Metalloenzymes can be reprogrammed and/or modified to select variants suitable for the methods disclosed herein. Suitable metalloenzyme variants can include enantioselective variants. Metalloenzymes suitable for use in the methods disclosed herein include SEQ ID NOS:1-16, metalloenzymes listed in TABLE 6, or mutants thereof.

    [0121] The method can include use of a reactive radical (X.Math.) to activate C(sp.sup.3)-H bond via hydrogen atom transfer (HAT) and the interception of the resulting carbon-centered radical by a redox-reactive metal complex. In some embodiments, a reactive radical (X.Math.) can be a nitrogen radical (N.Math.) and/or an oxygen radical (O.Math.).

    [0122] In some embodiments, for example, a reprogrammed non-heme iron enzyme can mediate a radical relay process via an initial substrate activation at a Fe(II) center to generate a reactive amidyl radical for HAT and subsequent transfer of a Fe(III)-bound ligand to a carbon-centered radical ring.

    [0123] In some embodiments, the methods provided herein can include installation of chemically and/or medically relevant moieties such as, but not limited to, azide, chlorine, nitrile, thiocyanate, nitro, or trifluoromethyl.

    [0124] Accordingly, provided herein are also expanded biocatalysts for drug synthesis and discovery. The methods provided herein broaden the scope of biosynthesis and provide powerful biocatalytic toolbox for late-stage molecular editing of complicated bioactive molecules. For example, biocatalysts (e.g., reprogrammed metalloenzymes) can be used for a variety of industrial applications including drug discovery and synthesis, and sustainable chemical production.

    [0125] In the preceding description, specific details have been set forth in order to provide a thorough understanding of example implementations of the invention described in the disclosure. However, it will be apparent that various implementations may be practiced without these specific details. For example, circuits, systems, networks, processes, and other components may be shown as components in block diagram form in order not to obscure the example implementations in unnecessary detail. In other instances, well-known circuits, processes, algorithms, structures, and techniques may be shown without unnecessary detail in order to avoid obscuring the examples. The description of the example implementations will provide those skilled in the art with an enabling description for implementing an example of the invention, but it should be understood that various changes may be made in the function and arrangement of elements without departing from the spirit and scope of the invention. Accordingly, the present invention is intended to embrace all such alterations, modifications, and variations that fall within the scope of the appended claims.

    EXAMPLES

    [0126] The following examples are provided to further illustrate the embodiments of the present invention, but are not intended to limit the scope of the invention. While they are typical of those that might be used, other procedures, methodologies, or techniques known to those skilled in the art may alternatively be used.

    Example 1

    Experimental Methods

    Reagents

    [0127] Unless otherwise noted, all chemicals and reagents were obtained from commercial suppliers (Sigma-Aldrich, Alfa Aesar, Acros, AA Blocks, Combi-Blocks) and used without further purification. Silica gel chromatography was carried out using SiliaFlash Irregular Silica Gels F60, 40-63 m. 60 . .sup.1H and .sup.13C NMR were recorded on either a Bruker Avance 300, 400 or III HD 400 MHz spectrometer. Chemical shifts () are reported in ppm downfield from tetramethylsilane, using the solvent resonance as the internal standard (.sup.1H NMR: =7.26, .sup.13C NMR: =77.4 for CDCl.sup.3). Sonication was performed using a Fisherbrand Model 120 Sonic Dismembrator. Chemical reactions were monitored using thin layer chromatography (Merck 60 gel plates) using a UV-lamp for visualization. Gas chromatography-mass spectrometry (GC-MS) analyses were carried out using an Agilent 5977B GC/MSD system and HP-5MS UI column (30.0 m0.25 mm) with the following oven temperature setting (helium flow 1 ml/min): Initial: 110 C. (hold 0 min); Ramp 1: 110-160 C. (20 C./min, hold 0 min); Ramp 2: 160-225 C. (15 C./min, hold 0 min); Ramp 3: 225-270 C. (30 C./min, hold 4 min). Analytical chiral normal-phase HPLC analyses were performed using an Agilent 1260 series instrument with i-PrOH and hexanes as the mobile phase. Reverse-phase high-performance liquid chromatography-mass spectrometry (LC-MS) analysis was carried out using Agilent 1260 series instruments and Agilent 1260 LC/MSD iQ series instruments. Semi-preparative HPLC was performed using an Agilent XDB-C18 column (9.4250 mm). Column chromatography was performed on a Biotage Isolera One system using Sfar Silica HC-High Capacity 20 m columns. Plasmid pET22b(+) was used as a cloning vector, and cloning was performed using Gibson assembly (27). Cells were grown using Luria-Bertani (LB) medium or terrific broth (TB) medium (RPI Research). T5 exonuclease, Phusion polymerase, and Taq ligase were purchased from New England Biolabs (NEB, Ipswich, MA). Potassium phosphate buffer (pH 7.4) was used as a buffering system for whole cells, lysates, and purified proteins, unless otherwise specified.

    Generation of Enzyme Variants

    [0128] All protein variants described in this paper were cloned and expressed using the pET-22b(+) vector or pET-28a(+) vector. The genes encoding non-heme iron proteins used in this work were obtained as a single gBlock (Twist Bioscience), codon-optimized for E. coli, and cloned using Gibson assembly into pET-22b(+) between restriction sites NdeI and XhoI in frame with a C-terminal 6His-tag or into pET-28a(+) between restriction sites NdeI and BamHI in frame with an N-terminal 6His-tag. This plasmid was transformed into E. cloni EXPRESS BL21(DE3) cells (Lucigen).

    Enzyme Expression

    [0129] 200 mL TB.sub.amp in a 1 L flask was inoculated with an overnight culture (2 mL in LB.sub.amp) of recombinant E. cloni EXPRESS BL21(DE3) cells containing a pET-22b(+) plasmid encoding the non-heme iron enzyme variant. The culture was shaken at 37 C. and 240 rpm until the OD.sub.600 was 0.7 (approximately 2 hours). The culture was placed on ice for 20 minutes, and isopropyl -D-1-thiogalactopyranoside (IPTG) was added to final concentrations of 1 mM. The incubator temperature was reduced to 20.5 C., and the culture was allowed to shake for 24 hours at 180 rpm. Cells were harvested by centrifugation (4 C., 15 min, 4,000g) and the cell pellet was resuspended in potassium phosphate buffer (pH 7.4).

    Library Construction

    [0130] Site-saturation mutagenesis libraries were generated using a modified QuikChange mutagenesis protocol using Phusion High-Fidelity DNA Polymerase (New England Biolabs). The PCR products were digested with DpnI, gel purified, and the gaps were repaired using Gibson Mix (27). Without further purification, 1 L of the Gibson product was used to transform 50 L of electrocompetent Escherichia coli BL21 E. cloni (Lucigen) cells. Random mutagenesis was achieved with error-prone PCR using Taq polymerase (New England Biolabs) with a MnCl.sub.2 concentration of 300 M.

    Library Screening

    [0131] Single colonies were picked with toothpicks off of LB.sub.amp agar plates and grown in deep-well (2 mL) 96-well plates containing LB.sub.amp (400 L) at 37 C., 240 rpm shaking. After 16 hours, 50 L aliquots of these overnight cultures were transferred to deep-well 96-well plates containing TB.sub.amp (1 mL) using a 12-channel Eppendorf Xplorer plus electronic pipettor. Glycerol stocks of the libraries were prepared by mixing cells in LB.sub.amp (100 L) with 50% v/v glycerol (100 L). Glycerol stocks were stored at 80 C. in 96-well microplates. Growth plates were allowed to shake for 3 hours at 37 C., 240 rpm shaking. The plates were then placed on ice for 30 min. Cultures were induced by adding 10 L of a solution containing 100 mM isopropyl -D-1-thiogalactopyranoside (IPTG). The incubator temperature was reduced to 20.5 C., and the induced cultures were allowed to shake for 24 hours (230 rpm). Cells were pelleted (4,500g, 5 min, 4 C.), resuspended in 400 L potassium phosphate buffer (pH 7.4), and the plates containing the cell suspensions were transferred to an anaerobic chamber. To deep-well plates of cell suspensions were added sodium azide (10 L per well, 1.0 M in water), ferrous ammonium sulfate (10 L per well, 100 mM in water), and the N-fluoroamide model substrate (10 L per well, 400 mM in dimethoxyethane (DME)). The plates were sealed with aluminum sealing tape and shaken at 680 rpm overnight in the chamber. The plates were then removed from the chamber and analyzed via the high-throughput (HTS) screening assay described in section (E). Hits from library screening were confirmed by small-scale biocatalytic reactions, as described in section (H).

    High-Throughput (HTS) Fluorescent Detection of Azidation Product in 96-Well Plate

    [0132] Following an azidation reaction, 400 L of N,N-dimethylformamide (DMF) was added to each well and the plate was incubated for 1 hour. The plate was then centrifuged to remove the insolubles. From each well, 5 L of the supernatant was transferred to a 96-well black fluorescence plate (Caplugs Evergreen) containing 195 L of 25% aqueous solution of DMF with 77 M CuSO.sub.4, 154 M BTTAA ligand (Click Chemistry Tools), 5.1 mM ascorbic acid, 25.6 mM KP.sub.i (pH 7.4), and 103 M of fluorogenic alkyne probe 4-ethynyl-N-ethyl-1,8-naphthalimide (28). The fluorescence plate was incubated and the formation of the fluorescent triazole product was monitored by a TECAN Spark plate reader outfitted with a plate stacker (excitation wavelength, 357 nm: emission wavelength 462 nm; bandwidth, 20 nm). Validation of hit wells was further investigated by GC-MS. Hits from library screening were confirmed by small-scale biocatalytic reactions, as described in section (H).

    Cell Lysate Preparation

    [0133] Cell lysates were prepared as follows: E. coli cells expressing non-heme iron enzyme variants were pelleted (4,000g, 5 min, 4 C.), resuspended in potassium phosphate buffer and adjusted to the appropriate OD.sub.600. Cells were lysed by sonication (5 minutes, 5 seconds on, 5 seconds off, 40% duty cycle) for two times, aliquotd into 2 mL microcentrifuge tubes, and the cell debris was removed by centrifugation for 10 min (14,000g, 4 C.). The supernatant was sterile filtered through a 0.45 m cellulose acetate filter, and the concentration of protein lysate was determined using the described in section (G). Using this protocol, the protein concentrations we typically observed for OD.sub.600=10 lysates are in the 5-10 M range for sav HppD and its variants.

    Protein Concentration Determination in Cell Lysates

    [0134] The quantity of His-tagged non-heme iron enzymes in cell lysates was determined using the His-tag protein ELISA kit according to the manufacturer's instructions (AKR-130 Cell Biolabs, San Diego, CA). Using this protocol, the protein concentrations we typically observed for OD.sub.600=10 lysates were in the 5-10 M range for wild-type Sav HppD and its variants.

    Small-Scale Biotransformations Using Whole E. coli Cells

    [0135] In a typical experiment, ferrous ammonium sulfate (20 L, 100 mM in water), sodium azide (20 L, 1 M in water), and N-fluoroamide substrate (20 L, 1.5 M in DME) were added to E. coli harboring non-heme iron enzyme variant (400 L, adjusted to the appropriate OD.sub.600) in a 2 mL screw top GC vial in an anaerobic chamber. The vial was capped and shaken at 680 rpm at room temperature for 24 hours. At the end of the reaction, the vial was opened and the reaction was quenched with 6 mL of a hexanes/ethylacetate solution (4:6 v/v) of internal standard 1,2,3-trimethoxybenzene (0.5 mM final concentration). The reaction mixture was transferred to a 15 mL centrifuge tube, vortexed (10 seconds, 3 times), then centrifuged (10,500g, 5 min) to completely separate the organic and aqueous layers. An aliquot (200-300 L) of the organic layer was used for product quantification via GCMS and enantioselectivity via chiral HPLC or chiral GC. The total turnover numbers (TTNs) reported are calculated with respect to non-heme iron enzymes expressed in E. coli and represent the total number of turnovers obtained from the catalyst under the stated reaction conditions.

    Protein Purification

    [0136] Protein expression was conducted following the protocols detailed in section (B). E. coli cells expressing non-heme iron enzyme variants were pelleted (4,000g, 5 min, 4 C.) and stored at 20 C. for at least 24 hours. The cell pallet was then resuspended in 50 mM KPi buffer containing 100 mM NaCl and 20 mM imidazole (pH 7.5 at 25 C.) (10 mL buffer per gram of cell pellet). Cells were lysed by sonication (5 minutes, 5 seconds on, 5 seconds off, 40% duty cycle) for two times and the cell debris was removed by centrifugation for 10 min (10,300g, 4 C.). The supernatant was sterile filtered through a 0.45 m cellulose acetate filter and purified using a 5 mL Ni-NTA column (HisTrap HP, Cytiva) using an KTA start protein purification system (Cytiva). The proteins were eluted from the column by running a gradient from 20 to 500 mM imidazole over 10 column volumes. Fractions containing purified proteins were detected by SDS-PAGE, pooled and concentrated using Millipore centrifugal filter. The protein solution was dialyzed first against 1 L of buffer with 10 mM EDTA in 50 mM KPi (pH 7.5 at 25 C.), and then two times against 1 L of 50 mM KPi. Final concentration was measured by absorbance at 280 nm using a NanoDrop spectrophotometer. The theoretical extinction coefficients (M.sup.1 cm.sup.1) used for Say HppD and its variants were calculated using ExPASy Bioinformatics Resources Portal.

    Determination of Enantioselectivity

    [0137] All enantiomeric ratio (e.r.) values of enzymatically synthesized azidation products were determined using normal phase chiral HPLC. The absolute configuration of enzymatically synthesized azidation product 1N was determined to be S via X-ray crystallography. The absolute configurations of all other azidation products were inferred by analogy, assuming the facial selectivity of the CN.sub.3 bond forming step remains the same as that of 1N. Each chiral determination of the enzymatic product was performed along with the chiral HPLC analysis of the corresponding racemic standard to confirm the retention time of both enantiomers.

    Preparation of Whole-Cell Suspensions for Azidation Reactions

    [0138] Two hundred milliliter TB.sub.amp in a one-liter flask was inoculated with an overnight culture (2 mL in LB.sub.amp) of recombinant E. cloni EXPRESS BL21(DE3) cells containing a pET22b(+) plasmid encoding the non-heme iron enzyme variant. The culture was shaken at 37 C. and 250 rpm until the OD.sub.600 was 0.7 (approximately 2 hours). The culture was placed on ice for 30 minutes, and isopropyl -D-1-thiogalactopyranoside (IPTG) was added to final concentrations of 1 mM. The incubator temperature was reduced to 20.5 C., and the culture was allowed to shake for 24 hours at 180 rpm. Cells were harvested by centrifugation (4 C., 15 min, 4,000g) and resuspended in KPi buffer (pH 7.4) and adjusted to OD.sub.600=20. The whole-cell suspension was placed on ice and bubbled with Ar for 15 min.

    Anaerobic Techniques

    [0139] Unless otherwise stated, spectroscopic samples were prepared in an MBraun UNIlab glovebox circulated under a positive pressure of N2(g). Sav HppD Az1 was rendered anoxic by vacuuming and sparging the protein (7 cycles) with Ar(g) in a round bottom flask connected to a Shlenk line. All buffers and compounds were prepared within the glovebox to render a uniform anaerobic environment.

    Example 2

    Non-Native Azidation by Multiple Non-Heme Metalloenzymes

    [0140] This example covers the reprogramming of multiple non-heme iron enzymes to catalyze abiological C(sp.sup.3)-H azidation reactions via iron-catalyzed radical relay. These biocatalytic transformations use amidyl radicals as hydrogen atom abstractors and Fe(III)N.sub.3 intermediates as radical trapping agents. A high-throughput screening platform based on click chemistry was established for rapid optimization of the catalytic performance of enzymes identified. The final optimized variants function in whole Escherichia coli cells and deliver a range of azidation products with up to 10600 total turnovers and 93% enantiomeric excess. Given the high prevalence of radical relay reactions in organic synthesis and the large diversity of non-heme iron enzymes, we envision that this discovery will stimulate future development of metalloenzyme catalysts for synthetically useful transformations unexplored by natural evolution.

    [0141] Azidation of the N-fluoroamide substrate N-(tert-butyl)-2-ethyl-N-fluorobenzamide (1NF):

    ##STR00012##

    was tested using a panel of nine functionally diverse non-heme iron enzymes under whole-cell conditions. The reactions primarily produced the benzylic azidation product 1N, as well as small amounts of intramolecular fluorine transfer product 1F and dehalogenation product 1A:

    ##STR00013##

    [0142] The reactions were performed by adding ferrous ammonium sulfate (10 L, 100 mM in water), sodium azide (10 L, 1 M in water), and N-fluoroamide substrate 1NF (10 L, 400 mM in DME) to E. coli harboring non-heme iron enzymes (400 L, adjusted to OD.sub.600=40) in a 2 mL screw top GC vial. The vial was capped and shaken at 680 rpm at room temperature for 24 hours. At the end of the reaction, the vial was opened and the reaction was quenched with 0.8 mL of a hexanes/ethylacetate solution (4:6 v/v) of internal standard 1,2,3-trimethoxybenzene (0.5 mM final concentration). The reaction mixture was transferred to a 2 mL microcentrifuge tube, vortexed (10 seconds, 3 times), then centrifuged (14,000g, 5 min) to completely separate the organic and aqueous layers. An aliquot (200-300 L) of the organic layer was used for product quantification via GCMS and enantioselectivity via chiral HPLC or chiral GC. The results of these analyses are summarized in TABLE 2.

    TABLE-US-00003 TABLE 2 1F 1A Entry Enzyme Organism Uniprot No. 1N % e.r..sup.d % % 1 4-hydroxyphenylpyruvate Streptomyces Q53586 33.0 2.0 63:37 3.7 10.0 dioxygenase (HppD).sup.a avermitilis 2 Proline cis-4-hydroxylase Mesorhizobium Q989T9 0.5 n.d. 0.4 5.0 (P4H).sup.b japonicum 3 Iron/2-oxoglutarate- Hapalosiphon A0A067YX61 0.1 n.d. 0.3 2.5 dependent halogenase welwitschii WelO5.sup.b 4 polyoxin hydroxylase PolL.sup.c Streptomyces J7FW05 0.6 n.d. 0.4 8.6 aureochromogenes 5 Prolyl 4-hydroxylase.sup.c Bacillus A0A4Y1WAP5 n.d. n.d. n.d. n.d. anthracis 6 Prolyl 4-hydroxylase.sup.bc Paramecium Q84406 0.2 n.d. 0.7 6.7 bursaria Chlorella virus 7 Iron/2-oxoglutarate- Emericella Q5AR53 0.1 n.d. 0.5 5.0 dependent halogenase AsqJ.sup.c nidulans 8 Isopenicillin N synthase Emericella P05326 4.0 0.1 44:56 1.5 8.0 (IPNS).sup.b nidulans 9 (S)-2- Pseudomonas Q9JN69 0.1 n.d. 0.3 3.3 hydroxypropylphosphonic syringae acid epoxidase Psf4.sup.b 10 KPi buffer without whole-cell catalyst 0.1 n.d. 0.3 0.5 11 Sav HppD H187A H270A as the catalyst 0.2 n.d. 0.2 7.5 12 wt Sav HppD, no azide addition n.d. n.d. 2.2 6.5 .sup.a1N %, 1F %, and 1A % refer to the yield of 1N, 1F, and 1A, respectively. e.r. denotes product enantiomeric ratio. .sup.bpET-22b(+) was used as the cloning vector. .sup.cpET-28a(+) was used as the cloning vector. .sup.dnot determined (n.d.)

    [0143] While numerous metalloenzymes performed the azidation reaction, a (4-hydroxyphenyl)pyruvate dioxygenase from Streptomyces avermitilis (Sav HppD) provided the highest yield of 1N, including a total turnovers (TTN) of 250, an enantiomeric ratio (e.r.) of 63:37, and a chemoselectivity of 9:1 for azidation over fluorination product. Only trace amount of azidation product was obtained in a reaction lacking Sav HppD. Moreover, mutating the two iron-coordinating histidines to alanines abolished the enzyme activity while retaining the fold of wt Sav HppD, supporting the proposal that reaction occurs at the 2-His-1-carboxylate iron center. The unazidated amide product was also detected in trace amount, but was likely formed via an unidentified non-enzymatic process, as the double alanine mutant afforded this product in a yield comparable to that of the wild-type enzyme.

    Example 3

    Directed Evolution of a Non-Heme Metalloenzyme

    [0144] This example covers the improvement of Sav HppD performance via directed evolution. Computational modeling was performed on the wild-type enzyme with both azide and 1NF substrate bound. Fifteen active site residuesH187, V189, N191, L228, S230, P243, N245, Q255, Q269, H270, F336, E349, F364, L367, and F368were selected for optimization. These residues mainly reside o-helix, s barrel of the C-terminal domain, a-helix, barrel of the C-terminal domain, and loops surrounding the active site.

    [0145] A high-throughput screening (HTS) platform based on copper-catalyzed azide-alkyne cycloaddition (CuAAC) was utilized for Sav HppD variants, and provided reliable quantification of enzymatic azidation products with a coefficient of variation of 9% and a detection limit of 4 M. With this HTS platform, more than 5,000 clones generated through error-prone PCR or site-saturation mutagenesis were evaluated. Results of 1NF azidation with select variants are summarized in TABLE 3.

    TABLE-US-00004 TABLE 3 Entry Acronym Mutations from wt Sav HppD TTN e.r. 1N/1F 1N/1A 1 wt Say HppD None 250 10 63:37 9.0 3.0 2 HppD AQ V189A N245Q 320 20 76:24 18.8 7.8 3 HppD AQI V189A N245Q L367I 410 10 79:21 27.6 9.8 4 HppD AQAI V189A N245Q Q255A L367I 760 20 87:13 35.5 9.3 5 HppD Az1 V189A F216A N245Q Q255A 1340 40 86:14 53.8 15.5 P243A L367I 6 HppD ALGFPI V189A S230L P243G N245F 430 30 94:6 33.2 13.4 Q255P L367I 7 HppD Az2 V189A N191A S230L P243G 490 20 96:4 30.6 19.3 N245F Q255P L367I TTN denotes total turnover; e.r. denotes enantiomer ratio; 1N/1F denotes the ratio of 1N to 1F among products. 1N/1A denotes the ratio of 1N to 1A among products

    [0146] A sextuple mutant Sav HppD V189A F216A P243A N245Q Q255A L367I (denoted as Sav HppD Az1) furnished the product with 1340 TTN and 87:13 e.r. This evolution campaign, did not identify an enzyme variant with an e.r. higher than 87:13. This result indicates that mutations that were beneficial for improving activity might not necessarily lead to an increase in enantioselectivity, which might be due to the differences in substrate positioning and geometric requirement for the rate-determining N-F activation step and the enantio-determining azide rebound step as revealed by molecular dynamics simulation. Some of the libraries were then reevaluated with chiral HPLC and additional rounds of evolution aided by computational modelling. A septuple mutant Sav HppD V189A N191A S230L P243G N245F Q255P L367I (denoted as Sav HppD Az2) showed an enantioselectivity of 96:4 e.r. and 490 TTN.

    [0147] Kinetic analyses for wild-type Sav HppD, Az1, and Az2 mediated 1NF azidation were performed in an anaerobic chamber. Ferrous ammonium sulfate (10 L, 100 mM in water) and sodium azide (10 L, 1 M in water) were added to a buffer solution containing purified Sav HppD protein variant (20 M, 2.4 mL) and the solution was shaken at 600 rpm for 5 minutes. A 1,2-dimethoxyethane solution of N-fluoroamide substrate 1NF was added to the solution (final concentration ranging from 0.25 mM to 15 mM in reaction solution). An aliquot of 100 L of the reaction mixture was removed at 3, 6, 9, 12, and 15 minutes and quenched by vortexing with 300 L 6:4 EtOAc/hexanes solution containing 0.5 mM (final concentration) internal standard 1,2,3-trimethoxybenzene. After centrifugation at 12,000 rpm for 10 mins, an aliquot (200 L) of the organic layer was taken for GCMS analysis for product quantification. Experiments were performed in triplicates, and are summarized in FIG. 10. The Az1 variant exhibited a 4.1-fold increase in k.sub.cat and a 1.7-fold increase in K.sub.M over the wild-type enzyme (29.4 min.sup.1 (Az1) vs 7.20 min1 (wt) for k.sub.cat and 790 M (Az1) vs 470 M (wt) for K.sub.M), whereas the more enantioselective Az2 variant displayed a 9-fold decrease in k.sub.cat (3.39 min.sup.1) and a 6.6-fold decrease in K.sub.M (120 M). Overall, both variants showed around 2-fold improvement in catalytic efficiency (k.sub.cat/K.sub.M) compared to that of the wild-type enzyme.

    Example 4

    Azidation Reaction Condition Optimization

    [0148] This example covers optimization of reaction conditions and analysis of multiple N-fluoroamide substrates with the sextuple and septuple Sav HppD variants Az1 and Az2 from Example 2. A scheme for this reaction is shown in FIG. 3A.

    [0149] Reaction condition optimization was performed in an anaerobic chamber. Ferrous ammonium sulfate (10 L, 100 mM in water), sodium azide (10 L, 1 M in water), and N-fluoroamide substrate 1NF (10 L, 400 mM in DME) were added to E. coli harboring non-heme iron enzymes (400 L, adjusted to OD.sub.600=10) in a 2 mL screw top GC vial. The vial was capped and shaken at 680 rpm at room temperature for 24 hours. At the end of the reaction, the vial was opened and the reaction was quenched with 0.8 mL of a hexanes/ethylacetate solution (4:6 v/v) of internal standard 1,2,3-trimethoxybenzene (0.5 mM final concentration). The reaction mixture was transferred to a 2 mL microcentrifuge tube, vortexed (10 seconds, 3 times), then centrifuged (14,000g, 5 min) to completely separate the organic and aqueous layers. An aliquot (200-300 L) of the organic layer was used for product quantification via GCMS and enantioselectivity via chiral HPLC or chiral GC. Protein concentrations in whole cell solutions were determined using cell lysis and protein concentration measurement. Exemplary condition optimization results with Sav HppD Az1 are shown in TABLE 4.

    TABLE-US-00005 TABLE 4 Variations from initial conditions TTN e.r. 1/1F 1/1A Az1 variant 1340 40 87:13 54.0 15.5 NaN.sub.3 (20 L, 1M), Az1 variant 1550 40 87:13 52.0 14.0 OD.sub.600 = 10, Az1 variant 1940 20 87:13 48.0 16.4 1NF (10 L, 800 mM), OD.sub.600 = 10, Az1 variant 2480 30 87:13 52.0 18.0 1NF (10 L, 1.5M), Fe.sup.2+ (20 L, 100 mM) 3100 60 87:13 47.0 19.5 NaN.sub.3 (40 L, 1M), OD.sub.600 = 10, Az1 variant INF (20 L, 1.5M), Fe.sup.2+ (20 L, 100 mM) 4290 50 87:13 55.0 20.0 NaN.sub.3 (40 L, 1M), OD.sub.600 = 10, Az1 variant 1NF (20 L, 1.5M), Fe.sup.2+ (20 L, 100 mM) 260 30 96:4 18.0 7.0 NaN.sub.3 (40 L, 1M), OD.sub.600 = 10, Az2 variant 1NF (10 L, 400 mM), Fe.sup.2+ (10 L, 100 mM) 490 20 96:4 30.6 19.3 NaN.sub.3 (10 L, 1M), OD.sub.600 = 10, Az2 variant 1NF (20 L, 1.5M), Fe.sup.2+ (20 L, 100 mM) 1820 50 96:4 34.0 21.0 NaN.sub.3 (40 L, 1M), OD.sub.600 = 40, Az2 variant TTN denotes total turnover; e.r. denotes enantiomer ratio; 1N/1F denotes the ratio of 1N to 1F among products. 1N/1A denotes the ratio of 1N to 1A among products

    [0150] Across the substrates and conditions tested, Sav HppD Az1 generally exhibited higher activity but lower enantioselectivity than Sav HppD Az2. The enzymatic reaction tolerates a range of aromatic substitution patterns with total turnovers up to 10060 and enantiomeric ratio up to 96.5:3.5 (product 5N, FIG. 3B). Substrates with an extended alkyl chain at the benzylic position were well tolerated, providing products in moderate-to-good TTNs and enantioselectivity (products 8N-10N, FIG. 3B). The amide nitrogen substituent also impacts enzyme performance, as evidenced by a decrease in activity when a larger N-tert-amyl group is substituted for the N-tert-butyl group (1N and 6N, 15N and 17N, FIG. 3B).

    [0151] We also tried to extend the scope of N-radical precursors and replace azide with other halide or pseudohalide anions, the results of which analyses are summarized in TABLE 5. For these analyses. ferrous ammonium sulfate (10 L, 100 mM in water), sodium halide or pseudohalide solution (10 L, 1 M in water), and N-fluoroamide substrate 1NF (10 L, 400 mM in DME) were added to a 2 mL vial containing Sav HppD Az1 cell lysate (400 L, obtained from OD.sub.600=20 cell suspension) in an anerobic chamber. The vial was capped and shaken at 680 rpm at room temperature for 24 hours. At the end of the reaction, the vial was opened and the reaction was quenched with 0.8 mL of a hexanes/ethylacetate solution (4:6 v/v) of internal standard 1,2,3-trimethoxybenzene (0.5 mM final concentration). The reaction mixture was transferred to a 2 mL microcentrifuge tube, vortexed (10 seconds, 3 times), then centrifuged (14,000g, 5 min) to completely separate the organic and aqueous layers. An aliquot (200-300 L) of the organic layer was used for product quantification via GCMS. 1X/internal refers to the ratio of peak area of 1X over that of the internal standard as determined by GCMS total ion chromatogram. 1F/internal and 1A/internal were defined and calculated accordingly.

    TABLE-US-00006 TABLE 5 Nucleophile Source IF/internal IA/internal NaF 0.04 2.5 NaBr 0.04 2.4 NaOCN 0.03 2.1 NaSCN 0.05 2.7 NaNO.sub.2 0.03 1.9 NaCl 0.04 2.3 NaCN 0.04 2.4

    [0152] As suggested by Mssbauer studies, the inability of our method to incorporate other anionic ligands might be due to a much weaker binding of these anions to the Fe(II) center of the enzymes. In a larger scale reaction, Sav HppD Az1 furnished 1N in 65% isolated yield at 120 mg scale with undiminished enantioselectivity (FIG. 3B). Single crystals of 1N were analyzed to assign its absolute configuration as S by X-ray crystallography. The primary organic azide 11N was also produced at preparative scale and subsequently converted it into an estrone derivative 18 via a CuAAC reaction (FIG. 3C). This chemoenzymatic two-step synthesis yielded the triazole product 19 in 55% isolated yield, demonstrating the potential of this platform to produce highly functionalized molecules when used in tandem with biocompatible reactions.

    Example 5

    Mechanistic Studies of Non-Heme Metalloenzyme Mediated Azidation

    [0153] Mechanistic studies were performed on Sav HppD to determine its azidation mechanism. Addition of N.sub.3.sup. to Sav HppD Az1.Math.Fe(III) complex induced the formation of two quadrupole doublets in Mssbauer spectrum with isomer shifts () of 1.20 and 1.17 mm/s and quadrupole splittings (E.sub.Q) of 2.29 and 2.97 mm/s, respectively. The observation of two quadrupole doublets may reflect different azide binding configurations to the Fe(II) center. Electron paramagnetic resonance (EPR) measurements were then performed on nitric oxide (NO)-bound Sav HppD Az1.Math.Fe(II) complex whose prominent g4 EPR resonance was used to monitor the interactions between the substrate and the non-heme iron center. Adding azide to Sav HppD Az1.Math.Fe(II).Math.NO complex increased the rhombicity (E/D) of the g4 signal from 0.014 to 0.017, the further addition of 1NF continued increasing the signal rhombicity (E/D=0.023).

    [0154] These observations suggest that both N.sub.3 and 1NF interact with the Fe(II) center of Sav HppD Az1. To demonstrate an Fe(III)N.sub.3 species is involved in the reaction, Sav HppD Az1.Math.Fe(II)N.sub.3 was incubated with an N-fluoroamide 18NF that lacked the reactive benzylic CH bonds. A slow accumulation of a red species was observed with an optical absorption centered at 505 nm, which likely originated from the Fe(III)N.sub.3 ligand-to-metal charge transfer band (20-22). The EPR signal of this red species was located at g4.3, further confirming its oxidation state was high spin (S=5/2) Fe(III) (see section X of the SI). In this study, the formation of a minor stable organic radical centered at g=2 was also observed. Although further studies are needed to characterize this radical species, it was speculated to be a secondary radical formed via the quench of the initial amidyl radical, as this g=2 signal was not observed when incubating Sav HppD Az1.Math.Fe(II).Math.N.sub.3 with the model N-fluoraoamide 1NF.

    Example 6

    Computational Modeling of Azidation within a Non-Heme Metalloenzyme Active Site

    [0155] Computational modelling was performed on wild-type and variant Sav HppD to understand the molecular basis of the azidation reaction, and to identify mutations which can enhance efficiency, turnover, enantioselectivity, and chemoselectivity for this reaction. Focusing on enantioselective variant Sav HppD Az2, MD simulations showed that V189A and P243G generated more space to accommodate iron-bound azide in the active site, indicating that increasing active site volume can promote azidation. In wt Sav HppD, N191, N245 and S230 participated in a hydrogen bonding network with Q269 for native substrate positioning. Introducing the mutations N191A, S230L, and P243G disrupted this network. These mutations together with N245F and L367I created a hydrophobic environment to accommodate N-fluoroamide substrates for N-F activation and position the ethyl group of the substrate closer to the iron-bound azide in a restricted and preorganized conformation for the subsequent reaction steps.

    Example 7

    Azidation Enantioselectivity of Multiple Non-Heme Metalloenzyme Variants

    [0156] This example covers CH bond functionalization of a benzylic carbon by a non-heme metalloenzyme. The reaction utilized the organic substrate 1,2,3,4-tetrahydronaphthalene, the radical precursor N-(tert-butyl)-N-fluorobenzamide, and the nucleophile source NaN.sub.3 as overviewed in SCHEME 5. Multiple Sav HppD variants were tested, and exhibited enantioselectivity of between 27% and 68%. The results of these analyses are summarized in FIG. 7.

    ##STR00014##

    Example 8

    Non-Heme Metalloenzyme-Mediated Benzylic Addition

    [0157] This example covers CH bond functionalization of a benzylic carbon by a non-heme metalloenzyme. The reaction utilized the organic substrate 1,2,3,4-tetrahydronaphthalene, the radical precursor (tert-butyl)-hydroperoxide, and the nucleophile source NaN.sub.3 as overviewed in SCHEME 6. Multiple Sav HppD variants were tested, and exhibited enantioselectivity of between 9% and 81%. The results of these analyses are summarized in FIG. 11.

    ##STR00015##

    [0158] Although the invention has been described with reference to the above examples, it will be understood that modifications and variations are encompassed within the spirit and scope of the invention. Accordingly, the invention is limited only by the following claims.