Chimeric Antigen Receptor Molecule for Specifically Recognizing Baff-R and Application of Chimeric Antigen Receptor Molecule
20250268939 ยท 2025-08-28
Inventors
- Xinmin Zhang (Shanghai, CN)
- Weihong Nian (Shanghai, CN)
- Chuanying Xu (Shanghai, CN)
- Feng He (Shanghai, CN)
- Qing Zhou (Shanghai, CN)
- Jianbing Zhang (Guangzhou, CN)
Cpc classification
A61K40/4215
HUMAN NECESSITIES
A61P37/06
HUMAN NECESSITIES
A61K2239/38
HUMAN NECESSITIES
A61K40/11
HUMAN NECESSITIES
C07K16/2878
CHEMISTRY; METALLURGY
International classification
A61K35/17
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
A61K40/11
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
Abstract
The present application discloses a chimeric antigen receptor molecule for specifically recognizing BAFF-R, a nucleic acid encoding the receptor molecule, an engineered immune effector cell comprising the receptor molecule, a pharmaceutical composition, and a use thereof. The receptor molecule comprises a structural domain that specifically recognizes the BAFF-R and an activation stimulation structural domain, and can activate a downstream signal path after specifically recognizing and binding the BAFF-R, thereby causing, promoting or improving an immune response reaction for the BAFF-R, and finally achieving the purpose of treating or preventing diseases caused by B cell BAFF-BAFF-R signal path imbalance.
Claims
1. A chimeric antigen receptor molecule specifically recognizing BAFF-R, comprising a specific recognition domain and an activation stimulation domain, and a transmembrane domain located between the specific recognition domain and the activation stimulation domain, wherein, the specific recognition domain comprises a heavy chain variable region and a light chain variable region, wherein, the heavy chain variable region comprises three complementary determining regions CDR H1, CDR H2 and CDR H3, and CDR H1 comprises an amino acid sequence set forth in SEQ ID NO:6, CDR H2 comprises an amino acid sequence set forth in SEQ ID NO:7, and CDR H3 comprises an amino acid sequence set forth in SEQ ID NO: 8; the light chain variable region comprises CDR L1, CDR L2 and CDR L3, and the CDR L1 comprises an amino acid sequence set forth in SEQ ID NO: 10, CDR L2 comprises an amino acid sequence set forth in SEQ ID NO: 11, and CDR L3 comprises an amino acid sequence set forth in SEQ ID NO:12.
2. The chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 1, wherein the heavy chain variable region and the light chain variable region further comprise a human antibody framework region.
3. The chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 1, wherein the heavy chain variable region comprises an amino acid sequence set forth in SEQ ID NO: 5 or an amino acid sequence having about 70% or more sequence identity therewith; and the light chain variable region comprises an amino acid sequence set forth in SEQ ID NO: 9 or an amino acid sequence having about 70% or more sequence identity therewith.
4. (canceled)
5. The chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 1, wherein the activation stimulation domain comprises a signaling domain, and the signaling domain comprises an immune receptor tyrosine activation motif.
6. The chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 5, wherein the signaling domain comprises a signaling domain of an intracellular region of CD3, CD3, CD3, CD3, FcRI, FcR1, CD79, CD79, FcRIIa, DAP10 or DAP12 molecule, or the variants retaining a same function thereof.
7. (canceled)
8. The chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 5, wherein the activation stimulation domain further comprises one, two, three or more costimulatory domains.
9. The chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 8, wherein the costimulatory domain(s) derive from the intracellular region of one or more of the following molecules: CD27, CD28, 4-1BB, OX40, CD30, CD40, CD2, LFA-1, LIGHT, NKG2C, B7-H3, PD-1, ICOS, CDS, ICAM-1, GITR, BAFFR, LIGHTR, SLAMF7, CD7, NKp80(KLRF1), CD160, CD19, CD4, CD8, CD8, IL2R, IL2R, IL7R, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, TRANCE/RANKL, DNAM1, SLAMF4, CD84, CD96, CEACAM1, CRTAM, CD229, CD160, PSGL1, CD100, CD69, SLAMF6, SLAMF1, SLAMF8, CD162, LTBR, LAT, GADS, SLP-76, PAG/Cbp, NKp44, NKp30, NKp46, NKG2D, and ligands that specifically bind to CD83.
10. (canceled)
11. The chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 1, wherein the transmembrane domain comprises a transmembrane domain selected from the group consisting of: transmembrane domain of CD4, CD8, CD28 or CD3, or the variants retaining a same function thereof.
12. (canceled)
13. The chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 1, wherein the transmembrane domain and the specific recognition domain are linked by a hinge region, and the hinge region is selected from the group consisting of the hinge regions of IgG, IgD, or CD8/CD28.
14. The chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 13, wherein the hinge region comprises an amino acid sequence set forth in SEQ ID NO: 14 or an amino acid sequence having about 70% or more sequence identity therewith.
15. A nucleic acid molecule encoding a chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 1.
16. The nucleic acid molecule according to claim 15, comprising a polynucleotide sequence set forth in SEQ ID NO: 3 or a polynucleotide sequence having about 70% or more sequence identity therewith.
17. The nucleic acid molecule according to claim 15, further comprising a coding sequence of a membrane localization signal peptide molecule.
18. The nucleic acid molecule according to claim 17, wherein the coding sequence of the membrane localization signal peptide molecule comprises a polynucleotide sequence set forth in SEQ ID NO: 1 or a polynucleotide sequence having about 70% or more sequence identity therewith.
19. The nucleic acid molecule according to claim 18, which from the 5 end to the 3 end comprises the following polynucleotide sequences or polynucleotide sequences having about 70% or more sequence identity therewith: SEQ ID NO: 1. SEQ ID NO:3, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO:17 and SEQ ID NO:19.
20. An engineered immune effector cell comprising the chimeric antigen receptor molecule specifically recognizing BAFF-R according to claim 1 or a nucleic acid molecule encoding thereof.
21. The engineered immune effector cell according to claim 20, wherein the engineered immune effector cell is a CAR-T cell.
22. A pharmaceutical composition comprising a therapeutically effective amount of the engineered immune effector cell according to claim 20.
23. A method for treating or preventing a disease in a subject in need thereof, wherein the method comprising administering the pharmaceutical composition of claim 22 to the subject, wherein the disease is a disease caused by imbalances of B cell BAFF-BAFF-R signal pathway.
24. The method of claim 23, wherein the disease comprises: autoimmune disease, graft versus host disease, and tumor.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
DETAIL DESCRIPTION OF THE INVENTION
[0059] In order to further improve and enhance the therapeutic effect on B-cell malignancies, this application designs a new type of chimeric antigen receptor molecule recognizing BAFF-R protein that specifically and highly expressed on the surface of B cells, and provides a nucleic acid molecule encoding the receptor, the engineered immune effector cell comprising the receptors, the pharmaceutical composition, and the use thereof for the purpose of treating or preventing diseases caused by imbalances of the B cell BAFF-BAFF-R signaling pathway, such as B cell malignancies.
Definition
[0060] For the purpose of interpreting this specification, the following definitions will apply, and where appropriate, terms used in the singular will also include the plural and vice versa. In the event of any conflict between any definition set forth below and any document incorporated herein by reference, the definition set forth below shall control.
[0061] As used herein, receptor refers to a biomacromolecule capable of binding to hormones, neurotransmitters, drugs, or intracellular signaling molecules and causing changes in cell functions. According to the location of receptors in the cell, receptors can be divided into two categories: cell membrane receptors and intracellular receptors. A receptor itself contains at least two active sites: one is the active site that recognizes and binds to the ligand (referred to as the specific recognition domain in this application); and the other is the activation site that responsible for the production of response (referred to as the activation stimulation domain herein). The activation-stimulation domain can produce a response only after the receptor binds to the ligand to form a binary complex and is allosteric, thereby initiating a series of biochemical reactions, and finally causing the effector cell where the receptor is located to produce biological effects. As used herein, the activation stimulation domain comprises a signaling domain, or comprises one or more signaling domains and one or more costimulatory domains. Herein, unless otherwise specified, a signaling domain provides a primary signal for activating lymphocytes, such as activating T cells or NK cells, while a costimulatory domain provides a secondary signal for activating lymphocytes. In some embodiments, a transmembrane domain is further included between the antigen recognition region and the activation stimulation domain. In some embodiments, the antigen recognition region and the transmembrane domain are linked by a hinge region.
[0062] As used herein, intracellular domain and intracellular region may be used interchangeably, and may refer to a domain of a receptor molecule that is located in the cell and plays a role in signaling after the receptor binds to a ligand.
[0063] As used herein, chimeric antigen receptor (CAR) is a class of engineered cell surface receptors, generally expressed on immune cells, which mediates the killing of engineered immune cells against specific target tumor cells or other diseased cells. As a receptor, a CAR also comprises a specific recognition domain and an activation stimulation domain. The specific recognition domain of a CAR can specifically recognize an antigen, so it is also called the antigen recognition region. Usually, the antigen recognition region of a CAR is located outside the cell membrane. In some embodiments, the antigen recognition region is a single chain variable fragment (scFv) of an Ig. A scFv comprises a heavy chain variable region (VH) and a light chain variable region (VL) of an Ig. In some specific embodiments, the VL and VH regions are linked together by a peptide chain.
[0064] The terms heavy chain (CH), light chain (CL), light chain variable region (VL), heavy chain variable region (VH), and framework region (FR) refer to the domains in naturally occurring immunoglobulins and the corresponding domains of synthetic (e.g., recombinant) binding proteins (e.g., humanized antibodies). The basic structural unit of naturally occurring immunoglobulins, such as IgG, is a tetramer with two light chains and two heavy chains. The amino-terminal (N) portion of each chain comprises a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal (C portion) of each chain defines a constant region. A light chain has a single constant domain and a heavy chain typically has three constant domains and a hinge region. Thus, a naturally occurring light chain structure of an IgG molecule is N-VL-CL-C, and the structure of an IgG heavy chain is N-VH-CH1-H-CH2-CH3-C (where H is the hinge region). Among them, CH1, CH2 and CH3 are the components of the constant region of an antibody's heavy chain, the CH3 region is involved in the binding of a receptor on the cell membrane surface, CH2 is involved in the complement activation pathway and is the complement binding site, and CH1 has an Ig allotype genetic marker. The variable region of IgG consists of complementarity determining regions (CDRs) and non-CDR segments called framework regions. Among them, a CDR contains residues that contact an antigen, and a framework region is used to maintain the structure of the variable region and determine the position of the CDR loop. Thus, VL and VH domains have the following structure: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C.
[0065] In some embodiments, the specific recognition domain is a polypeptide or protein ligand other than scFv, for example, a modified interleukin-13 (IL-13) molecule can be used to prepare the specific recognition domain, thereby obtaining IL-13R2-specific CAR for the treatment of glioblastoma.
[0066] As used herein, the term single-chain variable fragment, single-chain antibody variable fragment or scFv antibody refers to a form of an antibody only comprising the variable regions of a heavy chain (CH) and a light chain (CL) ligated by a linker peptide. An scFv can be expressed as a single chain polypeptide. An scFv retains the specificity of the intact antibody from which it was derived. The light and heavy chains can be in any order, e.g., VH-linker-VL or VL-linker-VH, as long as the specificity of the scFv for the target antigen is preserved. In some special embodiments, linkers can also be omitted.
[0067] As used herein, the term linker refers to an oligopeptide or polypeptide region of about 1 to 100 amino acids in length that links together any of the domains/regions of the CAR of the invention. Linkers can be composed of flexible residues such as glycine and serine so that adjacent protein domains are free to move relative to each other. Longer linkers can be used when it is desired to ensure that two adjacent domains do not sterically interfere with each other. Alternative linkers are known to those skilled in the art and may be used in combination with alternative embodiments of the invention.
[0068] As used herein, the term antibody refers to an intact immunoglobulin or a monoclonal or polyclonal antigen-binding fragment having an Fc region (fragment crystallizable region) or the FcRn-binding fragment of an Fc (referred to herein as an Fc fragment or Fc domain). An antigen-binding fragment can be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of an intact antibody. Antigen binding fragments specifically include Fab, Fab, F(ab)2, Fv, dAb and complementarity determining region (CDR) fragments, single chain antibodies (scFv), single domain antibodies, chimeric antibodies, diabodies and such polypeptides comprising at least a portion of an immunoglobulin sufficient to confer specific antigen binding to the polypeptide. An Fc domain comprises CH2 and CH3 portions of two heavy chains, and can be produced by recombinant DNA techniques or by enzymatic (e.g., papain cleavage) or by chemical cleavage of intact antibodies. The term antibody fragment refers to a fragment of a protein that comprises only a portion of an intact antibody, usually including the antigen-binding site of the intact antibody, and thus retains the ability to bind the antigen. Examples of antibody fragments described herein include, but are not limited to: (i) Fab fragments having VL, CL, VH, and CH1 domains; (ii) Fab fragments, i.e., a Fab fragment having one or more cysteine residues at the C-terminal of the CH1 domain; (iii) Fd fragments having VH and CH1 domains; (iv) Fd fragments having VH and CH1 domains and one or more cysteine residues at the C-terminal of the CH1 domains; (v) Fv fragments having VL and VH domains of a single antibody arm; (vi) dAb fragments consisting of a VH domain (Ward et al., Nature 341, 544-546(1989)); (vii) isolated CDR regions; (viii) F(ab)2 fragments, bivalent fragments comprising two Fab fragments bridged by disulfide bonds at the hinge region; (ix) single chain antibody molecules (e.g., single chain Fv; scFv)(Bird et al., Science 242:423-426(1988); and Huston et al., PNAS (USA) 85:5879-5883(1988)); (x) diabodies having two antigen binding sites, which comprise a heavy chain variable domain (VH) linked to a light chain variable domain (VL) in the same polypeptide chain (see, e.g., EP404,097; WO93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448(1993)); (xi) linear antibody, which comprises a pair of tandem Fd segments (VH-CH1-VH-CH1), the Fd segments form a pair of antigen-binding regions together with the complementary light chain polypeptides (Zapata et al., Protein Eng. 8(10):1057-1062(1995); and U.S. Pat. No. 5,641,870).
[0069] As used herein, the term specifically bind means that an antibody binds to a specific antigen and does not bind to other antigens other than the specific antigen. The specific antigens may be one or more, and in some embodiments, the specific antigens contain the same or similar antigenic epitopes. In some embodiments, the specific binding has a binding affinity for the contact between the antibody and the antigen of at least 10.sup.6M. In certain embodiments, the antibody binds with an affinity of at least about 10.sup.7M, preferably 10.sup.8M, 10.sup.9M, 10.sup.0M, 10.sup.11M, or 10.sup.12M.
[0070] In this application, the terms polynucleotide, nucleic acid or nucleic acid molecule are used interchangeably, including but not limited to DNA, RNA, cDNA (complementary DNA), mRNA (messenger RNA), rRNA (ribosomal RNA), shRNA (small hairpin RNA), snRNA (small nuclear RNA), snoRNA (short nucleolar RNA), miRNA (microRNA), genomic DNA, synthetic DNA, synthetic RNA and/or tRNA.
[0071] As used herein, vector, cloning vector and expression vector refer to a vector that can introduce a polynucleotide sequence (such as a foreign gene) into a host cell to transform the host and facilitate the expression (such as transcription and translation) of the introduced sequence. The vectors include plasmids, phages, viruses and the like.
[0072] As used herein, the signaling domain generally comprises an immune-receptor tyrosine-based activation motif (ITAM), the basic composition of which is: YXXL/V. Wherein Y is tyrosine, L/V refers to leucine or valine, and X can be any amino acid. When the receptor binds to the corresponding ligand, the tyrosine in the ITAM linked to it can be phosphorylated under the action of a type of protein tyrosine kinase PTK linked to the cell membrane, thereby recruiting other free protein kinases or adapter proteins in the cell, transmitting activation signals into the cell. In some embodiments, the signaling domain is the intracellular signaling domain of TCR(CD3) or FcRI.
[0073] As used herein, the costimulatory domain, also known as costimulatory signal region, is mainly used to provide a costimulatory signal to enhance the ability of immune cells, including, for example, enhancing the proliferation, survival and/or development of memory cells. In some embodiments, the costimulatory domain is selected from CD28, 4-1BB(CD137), OX40(CD134) and the like.
[0074] As used herein, the transmembrane domain, also known as transmembrane region, refers to a thermodynamically stable protein structural region anchored in the cell membrane. Transmembrane domains can be obtained from natural proteins, such as those derived from T cell receptors (TCR). In some embodiments, the transmembrane domain is selected from the group consisting of transmembrane domains of CD4, CD8, CD28, and CD3.
[0075] As used herein, the hinge region is a peptide chain connecting the antigen recognition region and the transmembrane domain, and is usually elastic. In some embodiments, the hinge region is derived from the hinge of IgG or the extracellular region of CD8/CD28. The hinge of IgG refers to the region between the CH1 and CH2 functional regions of IgG, which usually comprises a large amount of proline.
[0076] As used herein, the anti-BAFF-R chimeric antigen receptor is one of the receptors specifically recognizing BAFF-R. It specifically refers to a chimeric antigen receptor containing an anti-BAFF-R antibody heavy chain variable region and light chain variable region in the antigen recognition region. The chimeric antigen receptor can specifically recognize BAFF-R, and activate the downstream pathway of the cell where the receptor is located through signaling. In some embodiments, the anti-BAFF-R chimeric antigen receptor is located on the surface of immune cells selected from NK cells, macrophages, neutrophils, T cells, etc. After specifically recognizing BAFF-R, it activates the immune effector cell to produce immune effects such as humoral immunity, cellular immunity, and/or cytotoxicity; or activates the immune cells to further proliferate, etc.
[0077] As used herein, an immune effector cell refers to a cell (such as T cells and natural killer (NK) cells) capable of achieving immune effects and immune responses (such as immune killing effects and immune response effects) against a target antigen or a target cell.
[0078] As used herein, a CAR-T is a chimeric antigen receptor T cell, which is a T cell expressing a chimeric antigen receptor molecule on the cell surface, and can recognize a target antigen on a cell surface. A CAR-T has been developed to the fourth generation. Among them, a CAR-T of the first-generation has a CAR molecule formed by fusing the signaling domain of a CD3 chain or FcRI and the antigen recognition region, and comprising no costimulatory domains. The first-generation CAR-T has limited proliferation ability in vivo and is prone to apoptosis. The second-generation CAR is added with a costimulatory domain, such as CD28 or 4-1BB(CD137). CD28 has strong anti-tumor activity, and the advantage of 4-1BB is that it can prolong the survival time of T lymphocytes and maintain its anti-tumor effects. The second-generation CAR has stronger proliferation ability than the first-generation CAR, and can secrete more cytokines and anti-apoptotic proteins. The third-generation CAR-T can not only express two costimulatory signal molecules at the same time, but also secrete more IFN-, and has stronger anti-tumor cytotoxicity. The fourth-generation CAR-T can further secrete specific cytokines (such as IL-12) in tumors, thereby changing the tumor microenvironment, and influencing and activating other immune cells to generate an immune response.
[0079] As used herein, the signal peptide refers to a short peptide chain that guides the transfer of newly synthesized proteins to the secretory pathway, usually 5-30 amino acids in length. In some embodiments, the signal peptide is a membrane localization signal peptide, i.e., an amino acid sequence used to direct transmembrane transfer (localization) of a protein. In most embodiments, the signal peptide is located at the N-terminal of the amino acid sequence. In mRNA, the coding sequence of the signal peptide is usually located after the initiation codon, which is an RNA region encoding a hydrophobic amino acid sequence. After the signal peptide guides the protein to complete its positioning, it is usually excised under the action of signal peptidase.
[0080] As used herein, a variant of the protein or nucleic acid refers to a protein or nucleic acid that has the same function but has one or more mutations in its sequence as compared with a specific protein or nucleic acid. For example, a variant of a certain protein refers to a protein having the same function and at least 70% sequence identity with the certain protein, obtained by artificial or natural mutations which lead to mutations such as insertions, deletions, and substations of one or more amino acids in the amino acid sequence of the certain protein.
[0081] Identity of sequences as used herein refers to the degree of similarity between amino acid sequences or between nucleotide sequences as determined by sequence alignment software, such as BLAST.
[0082] Those skilled in the art should know that the imbalance of BAFF-BAFF-R signaling pathway can cause various diseases, including autoimmune diseases, graft-versus-host diseases and tumors. The neoplasms include all B-cell malignancies except plasma cell lesions (multiple myeloma), such as mantle cell lymphoma, follicular lymphoma, diffuse large B-cell lymphoma, marginal zone lymphoma, Burkitt's Lymphoma, lymphoblastic leukemia, chronic lymphocytic leukemia, hairy cell leukemia, etc. The autoimmune diseases include, for example, rheumatoid arthritis, systemic lupus erythematosus, multiple sclerosis, glomerular nephritis, Sjgren's syndrome, or autoimmune hemolytic anemia.
[0083] As used herein, the term effective amount or therapeutically effective amount refers to the amount of a pharmaceutical composition comprising one or more peptides, proteins, nucleic acids or mutants, variants, analogs or derivatives thereof disclosed in the present application, and the patient or subject receiving the effective amount or therapeutically effective amount of the pharmaceutical composition can obtain a reasonable benefit/risk ratio of medical treatment, thereby alleviating or preventing at least one or more of symptoms of a disease or a condition and achieving the desired therapeutic or preventive effect.
[0084] As used herein, the term about refers to the usual error range for the respective value readily known to those skilled in the art. Reference to about a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se. As used herein, the term about when preceding a numerical value means within 10% above or below the numerical value. For example, about 100 encompasses 90 and 110.
[0085] As used herein, the singular forms a, an and the include plural forms unless stated otherwise.
[0086] Unless otherwise defined herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
Chimeric Antigen Receptor
[0087] The present application provides a receptor specifically recognizing BAFF-R. In some embodiments, the receptor specifically recognizing BAFF-R is a chimeric antigen receptor (CAR).
[0088] When the receptor specifically recognizing BAFF-R is a chimeric antigen receptor (CAR), it comprises a specific recognition domain and an activation stimulation domain, and a transmembrane domain located between the specific recognition domain and activation stimulation domain, wherein, the specific recognition domain refers to the part of the CAR that specifically binds the target antigen on a target cell. In some embodiments, the specific recognition domain comprises an antibody or a functional equivalent thereof or a fragment or derivative thereof, for example may comprise a full-length heavy chain, a Fab fragment, a single chain Fv (scFv) fragment, a bivalent single-chain antibody or a diabody, each specific for a target antigen. However, many alternatives also exist, such as cytokines (which recognize cells bearing cytokine receptors), affibodies, ligand binding domains from naturally occurring receptors, soluble protein/peptide ligands for receptors (for example, on tumor cells), etc., each of which can be used in various embodiments of the present invention. Those skilled in the art shall understand that virtually any molecule or domain that binds the target antigen with high affinity can be used as a specific recognition domain. In some embodiments, the specific recognition domain comprises a T cell receptor (TCR) or an antigen recognition portion thereof, such as a single chain TCR (scTCR). Methods for making such TCRs are known in the art. For example, an scTCR can be engineered to comprise the V1 and V genes from a T cell clone linked by a linker (e.g., a flexible peptide).
[0089] In some embodiments, the specific recognition domain comprises an amino acid sequence selected from the group consisting of: SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO: 12 or an amino acid sequence having about 70% or more sequence identity therewith, for example an amino acid sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith. In some embodiments, the specific recognition domain comprises: [0090] a heavy chain variable region, the heavy chain variable region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:8 or an amino acid sequence having about 70% or more sequence identity therewith, for example, an amino acid sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith; and [0091] a light chain variable region, comprising an amino acid sequence selected from the group consisting of: SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12 or an amino acid sequence having about 70% or more sequence identity therewith, for example, an amino acid sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
[0092] In some embodiments, the heavy chain variable region comprises three complementarity determining regions, respectively CDR H1, CDR H2 and CDR H3, and the CDR H1, CDR H2 and CDR H3 respectively comprise amino acid sequence SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 8 or the amino acid sequences having about 70% or more sequence identity therewith, for example, amino acid sequences having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith; and the light chain variable region also comprises three complementarity determining regions, respectively CDR L1, CDR L2 and CDR L3, and the CDR L1, CDR L2 and CDR L3 respectively comprise amino acid sequence SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12 or the amino acid sequences having about 70% or more sequence identity therewith, for example the amino acid sequences having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
[0093] In some embodiments, the heavy chain variable region and the light chain variable region further comprise a framework region, preferably a human antibody framework region.
[0094] In some embodiments, the heavy chain variable region comprises an amino acid sequence set forth in SEQ ID NO: 5 or an amino acid sequence having about 70% or more sequence identity therewith, for example an amino acid sequence having about 75%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith; and the light chain variable region comprises an amino acid sequence set forth in SEQ ID NO: 9 or an amino acid sequence having about 70% sequence identity therewith, for example, an amino acid sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
[0095] In some embodiments, the heavy chain variable region and the light chain variable region are linked by a linker to form an scFv, and the scFv comprises an amino acid sequence set forth in SEQ ID NO: 4 or an amino acid sequence having about or more than 70% sequence identity therewith, for example, an amino acid sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
[0096] A CAR usually comprises a specific recognition domain, an activation stimulation domain, and a transmembrane domain between them. There are three conventional CAR structures, the difference mainly lies in the difference in the activation stimulation domain, including: [0097] the first-generation CARs whose activation stimulation domain comprises an intracellular signaling domain but lacks the costimulatory domain; [0098] the second-generation CARs, whose activation stimulation domain comprises an intracellular signaling domain and one costimulatory domain; [0099] the third-generation CARs, whose activation stimulation domain comprises an intracellular signaling domain and two costimulatory domains.
[0100] Accordingly, in some embodiments of the present application, the CAR is a first-generation CAR in which the signaling domain can be cytoplasmic and can transduce effector function signals and direct the cell to perform its specialized functions. Examples of such signaling domains include, but are not limited to, the (chain of a T cell receptor or any homologues thereof (e.g., chain, FcR1, chain, MB1(Ig) chain, B29(Ig) chain, etc.), CD3 polypeptides (, , and ), syk family tyrosine kinases (Syk, ZAP70, etc.), src family tyrosine kinases (Lck, Fyn, Lyn, etc.) and other molecules involved in T cell transduction, such as CD2, CD5 and CD28. Specifically, the intracellular signaling domain can be a human CD3 chain, FcRIII, FcRI, the cytoplasmic tail of an Fc receptor, a cytoplasmic receptor with an immunoreceptor tyrosine activation motif (ITAM), or a combination thereof. Other intracellular signaling domains will be apparent to those skilled in the art and may be used in combination with alternative embodiments of the invention. In some embodiments, the signaling domain comprised by the activation stimulation domain is a signaling domain comprising an immunoreceptor tyrosine activation motif. In some embodiments, the intracellular signaling domain comprises a signaling domain of one or more selected from the group consisting of: intracellular regions of CD3, CD3, CD3, CD3, FcRI, FcR1, CD79, CD79, FcRIIa, DAP10 and DAP12 molecules, or variants retaining the same function thereof. In some preferred embodiments, the intracellular signaling domain comprises the intracellular region of CD3 or FcRI, or the variants retaining the same function thereof. In some preferred embodiments, the intracellular signaling domain is derived from the intracellular region of CD3. In some embodiments, the intracellular signaling domain comprises an amino acid sequence set forth in SEQ ID NO: 20 or an amino acid sequence having about 70% or more sequence identity therewith, for example having an amino acid sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
[0101] In some embodiments of the present application, the CAR is a second-generation CAR, wherein the signaling domain is the above-mentioned signaling domain, and the costimulatory domain further comprised is any one of the intracellular regions of the following molecules: CD27, CD28, 4-1BB, OX40, CD30, CD40, CD2, LFA-1, LIGHT, NKG2C, B7-H3, PD-1, ICOS, CDS, ICAM-1, GITR, BAFFR, LIGHTR, SLAMF7, CD7, NKp80(KLRF1), CD160, CD19, CD4, CD8, CD8, IL2R, IL2R, IL7R, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11 d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, TRANCE/RANKL, DNAM1, SLAMF4, CD84, CD96, CEACAM1, CRTAM, CD229, CD160, PSGL1, CD100, CD69, SLAMF6, SLAMF1, SLAMF8, CD162, LTBR, LAT, GADS, SLP-76, PAG/Cbp, NKp44, NKp30, NKp46, NKG2D and ligands specifically binding CD83, or variants retaining the same function thereof.
[0102] In some embodiments of the present application, the CAR is a third-generation CAR, wherein the signaling domain is the above-mentioned signaling domain, and the costimulatory domain further included is any two, three, or more of the intracellular regions of the following molecules: CD27, CD28, 4-1BB, OX40, CD30, CD40, CD2, LFA-1, LIGHT, NKG2C, B7-H3, PD-1, ICOS, CDS, ICAM-1, GITR, BAFFR, LIGHTR, SLAMF7, CD7, NKp80(KLRF1), CD160, CD19, CD4, CD8, CD8, IL2R, IL2R, IL7R, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11 d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, TRANCE/RANKL, DNAM1, SLAMF4, CD84, CD96, CEACAM1, CRTAM, CD229, CD160, PSGL1, CD100, CD69, SLAMF6, SLAMF1, SLAMF8, CD162, LTBR, LAT, GADS, SLP-76, PAG/Cbp, NKp44, NKp30, NKp46, NKG2D, and ligands specifically binding CD83, or variants retaining the same functions thereof.
[0103] In some preferred embodiments, the costimulatory domain is preferably the 4-1BB intracellular region, the CD28 intracellular region, the OX40 intracellular region, or variants retaining the same functions thereof. In some specific embodiments, the costimulatory domain comprises an intracellular region derived from 4-1BB. In some specific embodiments, the costimulatory domain comprises an amino acid sequence set forth in SEQ ID NO: 18 or an amino acid sequence having about 70% or more sequence identity therewith, such as an amino acid sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
[0104] Those skilled in the art shall know that through the combination of the signaling domain and the costimulatory domain in an appropriate manner, the effector cells where the CAR is located can get appropriate activation signal when the CAR binds to the ligand.
[0105] In some embodiments, the transmembrane domain between the specific recognition domain and the activation stimulation domain can be derived from any transmembrane sequence of any proteins with a transmembrane domain (including any of type I, type II or type III transmembrane proteins). In addition, the transmembrane domain of the CAR of the present invention may also contain artificial hydrophobic sequences. In some embodiments, the transmembrane domain comprises the transmembrane domain of a molecule selected from the group consisting of: TCR, TCR, TCR, CD3, CD3, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD28, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, KIRDS2, OX40, CD2, CD27, LFA-1, ICOS(CD278), 4-1BB, CTLA-4, GITR, CD40, BAFFR, LIGHTR, SLAMF7, NKp80, CD160, CD19, IL2R, IL2R, IL7R, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11 d, ITGAE, CD103, ITGAL, CD11a, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, ITGB7, TNFR2, CD226, SLAMF4, CD84, CD96, CEACAM1, CRT AM, CD229, CD160, PSGL1, CDIOO, SLAMF6, SLAMF1, SLAMF8, CD162, LTBR, PAG/Cbp, NKp44, NKp30, NKp46, NKG2D, or NKG2C; preferably the transmembrane domain of CD4, CD8, CD28, CD3, PD1, or 4-1BB or a variant with the same function thereof.
[0106] In some embodiments, the transmembrane domain may comprise one or more additional amino acids adjacent to a transmembrane domain, for example, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 to 15 amino acids of the extracellular region) amino acids associated with the extracellular region of the protein from which the transmembrane domain is derived and/or with the one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 to 15 amino acids of an intracellular region) additional amino acids associated with the intracellular region of the protein from which the transmembrane domain is derived. In one aspect, the transmembrane domain is derived from the same protein as the signaling domain, costimulatory domain or hinge domain is derived from. In another aspect, the transmembrane domain is not derived from the same protein as any other domain of the CAR is derived from. In some preferred embodiments of the present application, the transmembrane domain comprises the transmembrane domain of CD8. In some embodiments, the transmembrane domain comprises an amino acid sequence set forth in SEQ ID NO: 16 or an amino acid sequence having about 70% or more sequence identity therewith, such as an amino acid sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or more sequence identity therewith.
[0107] In some embodiments, the transmembrane domain is directly linked to the specific recognition domain. In some embodiments, the transmembrane domain and the specific recognition domain are linked by a hinge region. In some embodiments, the hinge region comprises an amino acid sequence selected from the group consisting of: an Fc fragment of human CD8 or an antibody or a functional equivalent, fragment or derivative thereof, a hinge region of human CD8 or an antibody or a functional equivalent, fragment or derivative thereof, CH2 region of an antibody, CH3 region of an antibody, artificial spacer sequence and a combination thereof, preferably the hinge region amino acid sequence of IgG, IgD, CD8 or CD28. In some exemplary embodiments, the hinge region comprises any one or more of: (i) an IgG4 hinge region, a CH2 region, and a CH3 region, (ii) an IgG4 hinge region, (iii) an IgG4 hinge region and a CH2 region, (iv) a CD8 hinge region, (v) an IgG1 hinge region, a CH2 region and a CH3 region, (vi) an IgG1 hinge region, (vi) an IgG1 hinge region and a CH2 region, or (vii) a combination thereof. In some specific embodiments, the hinge region is the hinge region of a human CD8. In some specific embodiments, the hinge region comprises an amino acid sequence set forth in SEQ ID NO: 14 or an amino acid sequence having about 70% or more sequence identity therewith, such as an amino acid sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% or more sequence identity therewith.
[0108] In some embodiments, the CAR further comprises a signal peptide. Usually the signal peptide (SP) is located at the N-terminal of the protein and carries information of protein secretion, which participates in determining the secretion pathway and distribution of the protein. Those skilled in the art should know that proteins located in the nucleus, mitochondria, and cytoplasm, as well as free proteins in the cytoplasm and proteins secreted or finally anchored on the cell membrane usually have different signal peptides. Those skilled in the art can select a signal peptide sequence suitable for a certain protein to function through software prediction and signal peptide database. Therefore, in some embodiments of the present application, the signal peptide is selected from signal peptide sequences of any secreted protein or cell membrane protein, or variants retaining the same functions thereof. In some embodiments, the signal peptide sequence is the signal peptide of CD8. In some embodiments, the signal peptide sequence comprises an amino acid sequence such as SEQ ID NO: 2 or an amino acid sequence having about 70% or more sequence identity therewith, for example having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
Engineered T Cell Receptor
[0109] In one aspect, the present application further provides an engineered T cell receptor (TCR) specifically recognizing BAFF-R. Specific receptors on the surface of T cells responsible for recognizing antigens presented by the major histocompatibility complex (MHC). T cell receptors are heterodimers composed of two distinct subunits. Normally, 95% of T cell receptors are composed of and subunits, and the other 5% of receptors are composed of and subunits. Each subunit contains two extracellular domains: a variable region and a constant region. The variable region of each subunit (such as the variable region of the subunit V, the variable region of the subunit V, the variable region of the subunit V, and the variable region of the delta subunit V) comprises at least three highly variable regions. The complementarity determining regions: CDR1, CDR2 and CDR3. Among them, CDR3 is responsible for directly binding to the polypeptide presented by MHC, CDR1 of the subunit and subunit act on the N-terminal and C-terminal of the polypeptide respectively, and CDR2 is involved in recognizing MHC.
[0110] In some embodiments, the engineered T cell receptor comprises: [0111] V, which comprises an amino acid sequence selected from the group consisting of: SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:8, or an amino acid sequence having about 70% or more sequence identity therewith; and V, which comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, or an amino acid sequence having about 70% or more sequence identity therewith; or [0112] V, which comprises an amino acid sequence selected from the group consisting of: SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:8, or an amino acid sequence having about 70% or more sequence identity therewith; and V, which comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, or an amino acid sequence having about 70% or more sequence identity therewith.
[0113] In other embodiments, the engineered T cell receptor comprises: [0114] V, which comprises an amino acid sequence selected from the group consisting of: SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:8, or an amino acid sequence having about 70% or more sequence identity therewith; and V, which comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, or an amino acid sequence having about 70% or more sequence identity therewith; or [0115] V, which comprises an amino acid sequence selected from the group consisting of: SEQ ID NO:6, SEQ ID NO:7, and SEQ ID NO:8, or an amino acid sequence having about 70% or more sequence identity therewith; and V, which comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, or an amino acid sequence having about 70% or more sequence identity therewith.
[0116] The engineered TCR can specifically recognize BAFF-R presented by MHC, and bind to CD3/ dimer, CD3/ dimer and CD247/ or / dimer responsible for signaling, as well as in some embodiments, co-activating downstream signaling pathways with co-receptors.
Nucleic Acid Molecule
[0117] The present application also provides a nucleic acid molecule encoding a receptor specifically recognizing BAFF-R or a fragment thereof. In some embodiments, the receptor specifically recognizing BAFF-R is the aforementioned chimeric antigen receptor; in some embodiments, the receptor specifically recognizing BAFF-R is the aforementioned engineered T cell receptor. The nucleic acid molecule comprises a polynucleotide sequence encoding the aforementioned chimeric antigen receptor or engineered T cell receptor or a fragment thereof. The nucleic acid molecule can be DNA or RNA. In some embodiments, the nucleic acid molecule is linear, and in some embodiments, the nucleic acid molecule is circular. In some embodiments, the nucleic acid molecule is double stranded. In some embodiments, the nucleic acid molecule is single stranded. In some embodiments, the nucleic acid molecule is chemically synthesized. In some embodiments, the nucleic acid molecule comprises chemical modifications to render it more stable in the cell or in the animal body. In some embodiments, the nucleic acid molecule is synthesized by bacterial, fungal, or animal cells. In some embodiments, the nucleic acid molecule is a plasmid, viral vector, or oligonucleotide.
[0118] In some embodiments, the polynucleotide sequence comprises a specific recognition domain encoding the receptor specifically recognizing BAFF-R. In some embodiments, the specific recognition domain is a scFv. In some embodiments, the polynucleotide sequence comprises a DNA sequence set forth in SEQ ID NO: 3 and/or a DNA complementary thereto, or an RNA sequence corresponding or complementary thereto, or a polynucleotide sequence having about 70% or more sequence identity to the DNA or RNA sequence described in this paragraph, for example a polynucleotide sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith. As used herein, the complementary of nucleic acids means that two polynucleotides can hybridize under stringent conditions, and stringent hybridization means that when the two polynucleotides hybridize, each base or each nucleotide are all paired in accordance with the Watson-Crick base pairing principle, that is, A is paired with T or U, and C is paired with G or I. As used herein, the RNA corresponding to a DNA sequence refers to a ribonucleotide (RNA) sequence that is consistent with the sequence of bases in the DNA sequence and in which all T bases are replaced by U bases.
[0119] In some embodiments, the nucleic acid molecule comprises a coding sequence of a membrane localization signal peptide molecule. In some embodiments, the membrane localization signal peptide is a membrane localization signal peptide of a CD8. In some embodiments, the coding sequence of the membrane localization signal peptide molecule comprises the DNA sequence set forth in SEQ ID NO: 1 and/or the DNA complementary thereto, or the RNA sequence corresponding or complementary thereto, or a polynucleotide sequence having about 70% or more sequence identity with the DNA or RNA sequence described in this paragraph, for example a polynucleotide sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
[0120] In some embodiments, the nucleic acid molecule comprises a sequence encoding a hinge region. In some embodiments, the hinge region being encoded is the hinge region of a CD8. In some embodiments, the sequence encoding the hinge region comprises a DNA sequence set forth in SEQ ID NO: 13 and/or DNA complementary thereto, or an RNA sequence corresponding or complementary thereto, or a polynucleotide sequence having about 70% or more sequence identity to a DNA or RNA sequence as described in this paragraph, for example a polynucleotide sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
[0121] In some embodiments, the nucleic acid molecule comprises a sequence encoding a signaling domain. In some embodiments, the signaling domain is the signaling domain of a CD3. In some embodiments, the sequence encoding the signaling domain comprises a DNA sequence set forth in SEQ ID NO: 19 and/or a DNA complementary thereto, or an RNA sequence corresponding or complementary thereto, or a polynucleotide sequence having about 70% or more sequence identity to a DNA or RNA sequence as described in this paragraph, for example a polynucleotide sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
[0122] In some embodiments, the nucleic acid molecule comprises a sequence encoding a costimulatory domain. In some embodiments, the costimulatory domain is the signaling domain of a 4-1BB. In some embodiments, the sequence encoding the signaling domain comprises a DNA sequence set forth in SEQ ID NO: 17 and/or a DNA complementary thereto, or an RNA sequence corresponding or complementary thereto, or a polynucleotide sequence having about 70% or more sequence identity to a DNA or RNA sequence as described in this paragraph, for example a polynucleotide sequence having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith.
[0123] In some embodiments, the nucleic acid molecule comprises the aforementioned sequence encoding the costimulatory domain, the aforementioned sequence encoding the signaling domain, the aforementioned sequence encoding the hinge region, the aforementioned sequence encoding the membrane localization signal peptide molecule, and the aforementioned sequence encoding the specific recognition domain. How to arrange the sequence comprised in the aforementioned nucleic acid molecule to make the nucleic acid molecule, and which related components to regulate expression to be added, so that after the nucleic acid molecule is introduced into the cell, and a complete receptor that specifically recognizes BAFF-R can be successfully synthesized is obvious to those skilled in the art. In some specific embodiments, the nucleic acid molecule sequentially comprises the polynucleotide sequences described below from the 5 end to the 3 end or polynucleotide sequences having about 70% or more sequence identity therewith, for example polynucleotide sequences having about 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% or more sequence identity therewith: SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17 and SEQ ID NO: 19, wherein other sequences may be comprised between the polynucleotide sequences.
[0124] The present application also provides a mixture comprising multiple nucleic acid molecules. The multiple nucleic acid molecules respectively comprise one or more of the following: the aforementioned sequence encoding the costimulatory domain, the aforementioned sequence encoding the signaling domain, the aforementioned sequence encoding the hinge region, the aforementioned sequence encoding the membrane localization signal peptide molecule, the aforementioned sequence encoding the specific recognition domain. The mixture is co-introduced into a cell, and then a complete receptor specifically recognizing BAFF-R can be synthesized.
Engineered Immune Effector Cells
[0125] An engineered immune effector cell, comprising the aforementioned receptor specifically recognizing BAFF-R or the aforementioned nucleic acid molecule.
[0126] In some embodiments, the receptor specifically recognizing BAFF-R is the aforementioned chimeric antigen receptor, and the engineered immune effector cell is a CAR-T or CAR-NK cell.
[0127] In some embodiments, the receptor specifically recognizing BAFF-R is the aforementioned engineered T cell receptor, and the engineered immune effector cell is a TCR-T cell. In some embodiments, the receptor specifically recognizing BAFF-R is the aforementioned engineered T cell receptor, and the engineered immune effector cell is a TCR-NK cell.
Virus Particle, Liposome, Lipid Nanoparticle, and Pharmaceutical Composition
[0128] The present application also provides a viral plasmid, wherein the packaged viral vector comprises the aforementioned chimeric antigen receptor or engineered T cell receptor and/or encodes the chimeric antigen receptor or engineered T cell receptor polynucleotide sequence. The present application also provides a liposome or a lipid nanoparticle, wherein the liposome or lipid nanoparticle comprises the aforementioned receptor specifically recognizing BAFF-R a or a fragment thereof or a nucleic acid molecule encoding the receptor or the fragment thereof.
[0129] The present application further provides a pharmaceutical composition, which comprises a therapeutically effective amount of one or more selected from the group consisting of: the aforementioned chimeric antigen receptor, the aforementioned T cell receptor, the aforementioned nucleic acid molecule, the aforementioned engineered immune effector cell, the aforementioned viral particle, liposome, and lipid nanoparticle. In some embodiments, the pharmaceutical composition further comprises a suitable excipient, a carrier, and/or a stabilizer. The acceptable carrier, excipient or stabilizer is nontoxic to recipients at the dosages and concentrations employed, and comprises, for example, a buffer such as phosphate, citrate or acetate, usually at a pH of 5.0 to 8.0, optionally 6.0 to 7.0; a salt to achieve isotonicity, such as a sodium chloride, potassium chloride, etc.; an antioxidant; a preservative; a low molecular weight polypeptide; a proteins; a hydrophilic polymer, such as a polysorbate 80; an amino acid, such as a glycine; a carbohydrate; a chelating agent; a sugar; and other standard ingredients known to those skilled in the art (Remington: The Science and Practice of Pharmacy, 22nd Ed., Loyd V. Allen et al. eds. Pharmaceutical Press (2012)).
Therapy
[0130] The present application further discloses a method for treating or preventing a disease or symptom of a subject in need, the method comprising administering to the subject an effective amount of the aforementioned pharmaceutical composition, and the disease being selected from diseases caused by imbalances of the cellular BAFF-BAFF-R signaling pathway. Optionally, the method further comprises administering to the subject a second therapeutic agent, such as a monoclonal antibody capable of binding to the antigen CD20, a monoclonal antibody capable of binding to CD19, a monoclonal antibody capable of binding to an immune checkpoint, such as PD-1/PD-L1, or an engineered immune effector cell capable of targeting CD20, CD19, or PD-L1, etc. In some embodiments, the disease is any one selected from the group consisting of: autoimmune diseases, graft versus host diseases, or tumors.
[0131] In some embodiments, the disease is a cancer. Optionally, the cancer is a lymphoma, leukemia or myeloma. Optionally, the cancer is a lymphoma. Optionally, the lymphoma is a mantle cell lymphoma, follicular lymphoma, diffuse large B-cell lymphoma, marginal zone lymphoma, or Burkitt's lymphoma. Optionally, the cancer is a leukemia. Optionally, the leukemia is a lymphoblastic leukemia, chronic lymphocytic leukemia or hairy cell leukemia. Optionally, the cancer is a myeloma. Optionally, the myeloma is a multiple myeloma.
[0132] In some embodiments, the disease is an autoimmune disease. Optionally, the autoimmune disease is a rheumatoid arthritis, systemic lupus erythematosus, multiple sclerosis, glomerulonephritis, Sjgren's syndrome, or autoimmune hemolytic anemia.
[0133] In another aspect, the present application also provides a method for inhibiting cell proliferation. The method comprises contacting the cells with a pharmaceutical composition as provided herein, thereby forming contacted cells. The anti-BAFF-R receptor or its functional fragments are combined with the BAFF-R protein on the cells to inhibit cell proliferation. Optionally, the cells are lymphocytes. Optionally, the cells are B cells or cancer cells. Optionally, the cells are lymphoma cells.
[0134] As used herein, treating or preventing a disease or condition refers to methods of obtaining beneficial or desired results, including clinical results. Beneficial or desired clinical results may include, but are not limited to: alleviation or amelioration of one or more symptoms or conditions; lessening the extent of a condition, disorder or disease; stabilizing the state of a condition, disorder or disease; preventing the development of a condition, disorder or disease; preventing the spread of a condition, disorder or disease; delaying or slowing the progression of a condition, disorder or disease; delaying or slowing the onset of a condition, disorder or disease; ameliorating or palliating of a condition, disorder or disease state; or turning better. Treating can also mean prolonging the survival of a subject beyond expected survival in the absence of treatment. Treating can also mean inhibiting the progression of a condition, disorder or disease, temporarily slowing the progression of a condition, disorder or disease, but in some cases involving permanently stopping the progression of a condition, disorder or disease.
[0135] The preferred embodiments of the present invention have been described in detail above, however, the present invention is not limited thereto. Within the scope of the technical concept of the present invention, various simple modifications can be made to the technical solutions of the present invention, including combinations of various technical features in any other suitable manner, and these simple modifications and combinations should also be regarded as the disclosed content of the present invention and all of which belong to the protection scope of the present invention.
[0136] It should be understood that the description above and the following examples are intended to illustrate rather than limit the scope of the invention. Other aspects, advantages and modifications within the scope of the invention will be apparent to those skilled in the art to which the invention belongs to.
EXAMPLE
Example 1. Design of Chimeric Antigen Receptors Targeting BAFF-R
[0137] The present invention constructs an anti-BAFF-R chimeric antigen receptor (H90-11 CAR, which comprises the heavy chain variable region and light chain variable region of the H90-11 mAb monoclonal antibody shown by the disclosure of the US application: US 2021/0261676A1, the content of the disclosure of the US application US 2021/0261676A1 is incorporated herein by reference), as shown in the schematic diagram of the structure in
TABLE-US-00001 TABLE1 Specificsequence(5endto3 SEQIDNO. end/N-terminaltoC-terminal) SEQIDNO:1 ATGGCCCTCCCTGTCACCGCCCTGCTGCTT TCCGCTGGCTCTCTGCTCCACGCCGCTCGG CCC SEQIDNO:2 MALPVTALLLPLALLLHAARP SEQIDNO:3 GACATCCAGATGACACAGAGCCCTGATAGC CTGGCCGTGTCTCTGGGAGAGAGAGCCACC ATCAACTGCAAGAGCAGCCAGAGCGTGCTG TACTCCAGCAACAACAAGAACTACCTGGCC TGGTATCAGCAGAAGCCCGGCCAGCCTCCT AAGCTGCTGATCTACTGGGCCAGCATCAGA GAAAGCGGCGTGCCCGATAGATTTTCCGGC TCTGGCAGCGGCACCGACTTCACCCTGACC ATATCTAGCCTGCAGCCTGAGGACTTCGCC ACCTACTACTGCCAGCAGAGCTACAGCACC CCTTGGACATTTGGCCAGGGCACCAAGCTG GAAATCAAGGGAGGCGGAGGTTCTGGCGGC GGAGGAAGTGGTGGCGGAGGCTCTGAGGTT CAGCTGCAAGAGTCTGGCCCTGGCCTGGTC AAGCCTAGCCAAACACTGAGCCTGACCTGT ACCGTGTCCGGCGATAGCATCACAAGCGGC TACTGGAACTGGATCAGACAGCACCCTGGC AAGGGCCTCGAGTACATCGGCTACATCAGC TACAGCGGCAGCACCTACTACAACCCCAGC CTGAAGTCCAGAGTGACCATCAGCAGAGAC ACCAGCAAGAACCAGTACTCCCTGAAGCTG AGCAGCGTGACAGCCGCCGATACAGCCGTG TACTACTGCGCCTCTCCTAACTACCCCTTC TACGCCATGGACTACTGGGGCCAGGGAACC CTGGTTACCGTTAGCTCT SEQIDNO:4 DIQMTQSPDSLAVSLGERATINCKSSQSVL YSSNNKNYLAWYQQKPGQPPKLLIYWASIR ESGVPDRFSGSGSGTDFTLTISSLQPEDFA TYYCQQSYSTPWTFGQGTKLEIKGGGGSGG GGSGGGGSEVQLQESGPGLVKPSQTLSLTC TVSGDSITSGYWNWIRQHPGKGLEYIGYIS YSGSTYYNPSLKSRVTISRDTSKNQYSLKL SSVTAADTAVYYCASPNYPFYAMDYWGQGT LVTVSS SEQIDNO:5 EVQLQESGPGLVKPSQTLSLTCTVSGDSIT SGYWNWIRQHPGKGLEYIGYISYSGSTYYN PSLKSRVTISRDTSKNQYSLKLSSVTAADT AVYYCASPNYPFYAMDYWGQGTLVTVSS SEQIDNO:6 SGYWN SEQIDNO:7 YISYSGSTYYNPSLKS SEQIDNO:8 PNYPFYAMDY SEQIDNO:9 DIQMTQSPDSLAVSLGERATINCKSSQSVL YSSNNKNYLAWYQQKPGQPPKLLIYWASIR ESGVPDRFSGSGSGTDFTLTISSLQPEDFA TYYCQQSYSTPWTFGQGTKLEIK SEQIDNO:10 KSSQSVLYSSNNKNYLA SEQIDNO:11 WASIRES SEQIDNO:12 QQSYSTPWT SEQIDNO:13 ACCACGACGCCAGCGCCGCGACCACCAACA CCGGCGCCCACCATCGCGTCGCAGCCCCTG TCCCTGCGCCCAGAAGCGTGCCGGCCAGCG GCGGGGGGCGCAGTGCACACGAGGGGGCTG GACTTCGCCTGTGAT SEQIDNO:14 TTTPAPRPPTPAPTIASQPLSLRPEACRPA AGGAVHTRGLDFACD SEQIDNO:15 ATCTACATTTGGGCCCCTCTGGCTGGTACT TGCGGGGTCCTGCTGCTTTCACTCGTGATC ACTCTTTACTGT SEQIDNO:16 IYIWAPLAGTCGVLLLSLVITLYC SEQIDNO:17 AAGCGCGGTCGGAAGAAGCTGCTGTACATC TTTAAGCAACCCTTCATGAGGCCTGTGCAG ACTACTCAAGAGGAGGACGGCTGTTCATGC CGGTTCCCAGAGGAGGAGGAAGGCGGCTGC GAACTG SEQIDNO:18 KRGRKKLLYIFKQPFMRPVQTTQEEDGCSC RFPEEEEGGCEL SEQIDNO:19 CGCGTGAAATTCAGCCGCAGCGCAGATGCT CCAGCCTACAAGCAGGGGCAGAACCAGCTC TACAACGAACTCAATCTTGGTCGGAGAGAG GAGTACGACGTGCTGGACAAGCGGAGAGGA CGGGACCCAGAAATGGGCGGGAAGCCGCGC AGAAAGAATCCCCAAGAGGGCCTGTACAAC GAGCTCCAAAAGGATAAGATGGCAGAAGCC TATAGCGAGATTGGTATGAAAGGGGAACGC AGAAGAGGCAAAGGCCACGACGGACTGTAC CAGGGACTCAGCACCGCCACCAAGGACACC TATGACGCTCTTCACATGCAGGCCCTGCCG CCTCGG SEQIDNO:20 RVKFSRSADAPAYKQGQNQLYNELNLGRRE EYDVLDKRRGRDPEMGGKPRRKNPQEGLYN ELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR
Example 2 Construction of Chimeric Antigen Receptor Expression Vector
[0144] The anti-BAFF-R H90-11 CAR lentiviral expression vector pCDH-EF1a-H90-11CAR-4-1BB-EGFRt and the control EGFRt CAR lentiviral expression vector pCDH-EF1a-EGFRt-AT-Free (delete T2A) were both synthesized and constructed by Nanjing GenScript Company, the specific experimental steps were as follows:
[0145] The anti-BAFF-R scFv gene sequence was synthesized by Nanjing GenScript Company, and the synthesized scFv gene sequence was inserted into the pCDH-EF1a-4-1BB-EGFRt vector (Nanjing GenScript, order number: C046EEE310), the anti-BAFF-R chimeric antigen receptor lentiviral expression vector pCDH-EF1a-H90-11CAR-4-1BB-EGFRt (Nanjing GenScript, order number: C9401FG210) was obtained, and the carrier map is shown in
[0146] For pCDH-EF1a-T2A-EGFRt (provided by iCarTab) lentiviral expression vector, as there is an ATG start codon in the T2A linker, EGFRt cannot be expressed normally due to a frameshift mutation. According to the instruction manual of the commercial company of the In-Fusion Snap assembly seamless cloning reagent, T2A in the pCDH-EF1a-T2A-EGFRt vector was deleted to obtain the control EGFRt CAR lentiviral expression vector pCDH-EF1a-EGFRt-AT-Free (delete T2A)(constructed by Nanjing GenScript), vector map see
Example 3: Lentivirus Packaging and Titer Determination
Lentivirus Packaging
[0147] Preparing a 15 cm culture dish, inoculating 110.sup.7 293T cells, adding DMEM (Gibco, Cat. No.: 41965-062) complete medium containing 10% FBS (Gibco, Cat. No.: 10099-141), placing the dish at 37 C., 5% CO.sub.2 incubator and culturing overnight. Taking 2 mL of PBS (Gibco, Cat. No.: 14190-250) to one well of a 6-well plate, and adding 20 g of lentiviral expression plasmid (pCDH-EF1a-H90-11 CAR-4-1BB-EGFRt or pCDH-EF1a-EGFRt-AT-Free (delete T2A)), 30 L lentivirus packaging plasmid Mix (iCarTab, Cat. No.: LVP2MIX), pipetting up and down to mix well, adding 150 L LVTransm transfection reagent (iCarTab, Cat. No.: LVTran100), immediately pipetting the Mix up and down, and placing it at room temperature for 10 minutes. Adding the aforementioned DNA/PEI complex dropwise into a 15 cm culture dish, shaking the culture dish gently, and mixing well. Placing the culture dish in a 37 C., 5% CO2 incubator, and after culturing for 6-8 hours, discarding the medium containing the transfection reagent and replacing it with fresh complete medium. After continuous cultivation for 48 hours, collecting the medium supernatant containing the virus in the culture dish, filtering it with a 0.45 m filter membrane, and transferring it to a centrifuge tube, and centrifuging at 20,000 g at 4 C. for 2 hours. After centrifugation, discarding the liquid in the centrifuge tube in a biological safety cabinet, adding 500 L of PBS buffer to resuspend the virus pellet, and storing the virus in a 80 C. refrigerator after aliquoting.
Virus Titer Determination
[0148] Thrawing 293T cells and adjusting the cell state to the logarithmic growth phase. Taking a new 6-well plate, inoculating 293T cells at 810.sup.5 cells per well, supplementing the medium to a final volume of 2 mL, placing the 6-well plate in a 37 C., 5% CO.sub.2 incubator, and culturing overnight. Adding the concentrated lentivirus to the aforementioned 6-well plate in an amount of 50 L, and polybrene (Sigma, Cat. No.: 107689-10G) at a final concentration of 6 g/mL at the same time, and returning the 6-well plate to a 37 C., 5% CO.sub.2 incubator, and continually culturing for 48 hours.
[0149] After the culture, washing the cells in each well with PBS, and then extracting the genomic DNA using the MiniBEST Universal Genomic DNA Extraction Kit (Takara, Cat. No.: 9765), and determining the concentration of the extracted genomic DNA using NanoDrop2000. According to the PCR reaction system shown in Table 2 below, preparing the fluorescent quantitative PCR reaction premix.
TABLE-US-00002 TABLE 2 Reagent name Volume (20 L reaction system) 2 PCR Mix 10 Probe Mix(LTR probe, ALB probe) 0.4 Primer mix(LTR F&R, ALB F&R) 0.4 PCR grade water 4.2
[0150] The sequences and fluorophores of the primers used are shown in Table 3 below.
TABLE-US-00003 TABLE3 Primer Sequencemessage Probe name (5-3) fluorophore LTRF TGACAGCCGCCTAGCATTTC (SEQIDNO:21) LTRR GCTCGATATCAGCAGTTCTT GAAG (SEQIDNO:22) LTRProbe CACGTGGCCCGAGAGCTGCA 5-FAM-BHQ1-3 TC (SEQIDNO:23) ALBF GCTGTCATCTCTTGTGGGCT GT (SEQIDNO:24) ALBR ACTCATGGGAGCTGCTGGTT C (SEQIDNO:25) ALBProbe CCTGTCATGCCCACACAAAT 5-FAM-BHQ1-3 CTCTCC (SEQIDNO:26)
[0151] Taking the pUC-LTR (purchased from: iCarTab) and pUC-ALB plasmids (purchased from: iCarTab) out of the refrigerator, and diluting them by 10 times gradient dilution respectively for a total of 6 points to prepare the standard curve samples required for fluorescent quantitative PCR. Take a new 96-well PCR reaction plate, add 5 L of genome samples or standard curve samples to each well, then add 15 L of the PCR reaction master mix prepared above to each well, seal with a sealing film, and centrifuge briefly for 1 minute. PCR reactions were performed according to the PCR program in Table 4 below.
TABLE-US-00004 TABLE 4 Temperature( C.) Time(sec) denaturation 95 30 40 cycles for Step1, Step 2 Step 1 95 5 Step 2 60 30
[0152] After the PCR reaction, using the supporting software of Roche 480 to obtain the Ct value of the standard curve and the Ct value of the sample; taking the Ct value as the ordinate, and taking the Log value of the copy number as the abscissa to make a standard curve; calculating the copy number according to the standard curve. And calculating the titer of the virus according to the following formula:
[0153] The results of the lentivirus titer calculated according to the formula (1) are shown in Table 5 below.
TABLE-US-00005 TABLE 5 Activity Virus name titer(TU/mL) pCDH-EFIa-H90-11CAR-4-1BB-EGFRt Lentivirus 1.77 10.sup.8 pCDH-EF1a-EGFRt-AT-Free(delete T2A) Lentivirus 1.6 10.sup.8
[0154] It can be seen from Table 5 that a high-titer lentivirus was packaged, which can be used to subsequently infect T cells to prepare CAR-T cells.
Example 4 Preparation of CAR-T Cells
Isolation of T Cells from Peripheral Blood PBMC
[0155] Transferring 10 mL of anticoagulated peripheral blood sample to a 15 mL sterile centrifuge tube, centrifuging at 800 g for 20 minutes, removing the upper light yellow serum layer, then adding an equal volume of PBS to the lower peripheral blood cell layer, and gently inverting up and down to mix. Taking out the lymphocyte separation medium (Haoyang Biotechnology, Cat. No.: 1077), and inverting it up and down down several times to mix well. Taking another 15 mL centrifuge tube, adding 5 mL lymphocyte separation medium, slowly adding the diluted blood sample to the upper layer of the lymphocyte separation medium along the tube wall to avoid mixing the separation medium and blood sample, and centrifuging at 800 g for 20 minutes. After centrifugation, gently taking out the centrifuge tube, pipetting the white mononuclear cell layer in the middle into a new sterile centrifuge tube, adding an equal volume of normal saline and mixing gently, centrifuging at 800 g for 5 minutes, after centrifugation, removing the supernatant, washing the PBMCs again, adjusting the cell density to 510.sup.7 cells/mL, and transferring 1 mL/tube to a 2 mL cell cryopreservation tube.
[0156] Washing Dynabeads Human T-Expander CD3/CD28 (Thermo, Cat. No.: 11141D) twice with PBS, adding an appropriate amount of Dynabeads human T-Expander CD3/CD28 to the PBMC in a 2 mL cell cryopreservation tube, mixing gently, and incubating at room temperature for 20 minutes. Inserting the 2 mL cell cryopreservation tube into the magnetic pole, letting it stand at room temperature for 1 minute, inverting it gently, and pouring out the liquid in the tube. Taking the cryopreservation tube out of the magnetic pole, adding appropriate amount of X-Vivo 15 medium (containing 200 IU/mL IL-2 (Beijing Yuance Pharmaceutical Co., Ltd., Cat. No.: 20150713B), 10 ng/mL IL-7 (PrimeGene, Cat. No.: 101-07), 5 ng/mL IL-15 (PrimeGene, Cat. No.:101-15), resuspending and counting. Adjusting the cell concentration to 0.5110.sup.6 cells/ml, transferring them to 6 well plates, and placing them at 37 C., 5% CO2 incubator and continuously culturing for 48 hours.
Lentivirus Infection of T Cells
[0157] Adjusting the density of the cultured T cells to 110.sup.6/mL, taking the lentivirus out from the 80 C. ultra-low temperature refrigerator, and quickly thawing them in a 37 C. water bath. Adding polybrene (Sigma, Cat. No.: 107689-10G) to the prepared T cells to a final concentration of 6 g/mL, adding an appropriate volume of virus (MOI=25), gently pipetting and mixing it, sealing the culture dish with a parafilm, and centrifuging at 800 g for 1 hour at room temperature. After the centrifugation, continuing to culture for 24 hours, changing the medium, and then continuing to culture in a 37 C., 5% CO.sub.2 incubator.
Massive Expansion of T Cells
[0158] Gently pipetting the Dynabeads/cell clusters in the culture system every day until they are completely separated and then counting. When the cell density is greater than 110.sup.6 cells/mL, adding X-Vivo 15 medium (containing 200 IU/mL IL-2, 10 ng/mL IL-7, 5 ng/mL IL-15) to adjust the cell density to 0.510.sup.5 cells/mL, and continuing to culture. After expansion and culture to the 10th day, collecting and storing the cells in a cell cryopreservation solution.
CAR-T Positive Rate Detection
[0159] By using FITC-Anti-EGFR antibody (iCARTAB, Cat. No.: IAB006A)(final concentration 10 g/mL) to incubate with H90-11 CAR-T (T cells infected with pCDH-EF1a-H90-11CAR-4-1BB-EGFRt lentivirus) and EGFRt CAR-T cells (T cells infected with pCDH-EF1a-EGFRt-AT-Free (delete T2A) lentivirus) for 30 minutes at room temperature in the dark, and detecting the expression of EGFRt with flow cytometry. The result is shown in
Example 5 Evaluation of Tumor Cell Killing of Chimeric Antigen Receptor T Cells Targeting BAFF-R In Vitro
Lysis of Target Cells by CAR-T Cells
[0160] Nalm6-luciferase cells are acute lymphoblastic leukemia cells highly expressing human BAFF-R, which are cells overexpressing Luciferase (luciferase) obtained by lentiviral infection of Nalm6 cells (purchased from Genio Biotech). The cytotoxicity experiment of H90-11 CAR-T cells to Nalm6-luciferase target cells was detected with Luciferase detection kit (Promega, Cat. No.: E2610), and EGFRt CAR-T cells were used as a control. The specific steps are as follows:
[0161] Resuspending Nalm6-luciferase target cells in complete medium (RPMI1640+10% FBS), inoculating target cells into 96-well plates at 210.sup.4 cells/well, placing them in a 37 C., 5% CO.sub.2 incubator, and culturing overnight. Collecting the prepared CAR-T cells by centrifugation and resuspending them in 1640 medium with 10% FBS. Taking the 96-well plates out of the incubator, removing the medium in the wells, and washing the cells gently once with sterile PBS. Adding CAR-T cells with an effect-to-target ratio of 0.5:1, 1:1, 2.5:1, 5:1, and 10:1, setting up duplicate wells and making the final volume to 200 L/well. Inoculating the Maxi lysis wells and Mini lysis wells with a same number of target cells, but without CAR-T cells. Placing the 96-well plate in a 37 C., 5% CO2 incubator and incubating it for 18 hours. After the culture was completed, according to the instructions of the Luciferase Detection Kit (Promega, Cat. No.: E2610), detecting the luciferase activity which reflects the ability of the recombinant CAR-T cells in lysing the target cells.
[0162] Calculation formula for target cell lysis percentage:
[0163] The results are shown in
Detection of CAR-T Cytokine Secretion Level
[0164] The expression levels of IL-2 and IFN-7 in the co-culture supernatant of Nalm6-luciferase of target cells and prepared CAR-T cells were detected by ELISA method, and the specific experimental steps were as follows:
[0165] Resuspending Nalm6-luciferase target cells in complete medium, seeding them into 96-well plates at 210.sup.4/well, and culturing them overnight in a 37 C., 5% CO.sub.2 incubator. Using recombinant H90-11 CAR-T cells and EGFRt CAR-T cells as effector cells respectively to establish co-culture systems of effector cells and target cells, and the effect-to-target ratios were 0.5:1, 1:1, 2.5:1, 5:1 and 10:1, setting up duplicated holes. Placing the plate in a 37 C., 5% CO.sub.2 incubator and incubating for 18 hours. After the incubation, taking the plate out of the incubator, centrifuging the 96-well plate at room temperature at 1200 g for 5 minutes, gently taking out the plate, transferring the supernatant and detecting the expression level of IL-2 and IFN-7 in the supernatant with IL-2 (Fomex Bio, Cat. No.: FMS-ELH003) and IFN-(Fomex Bio, Cat. No.: FMS-ELH035) detection kits (see the ELISA detection kit manual for specific steps).
[0166] Results are shown in
Example 6 Evaluation Tumor Cell Killing of Chimeric Antigen Receptor T Cells Targeting BAFF-R In Vivo in Mice
[0167] The acute lymphoblastic leukemia Nalm6-luciferase cell line was xenografted into an NSG mouse model to evaluate the in vivo activity of H90-11 CAR-T.
[0168] 20 NSG mice aged 6-8 weeks (purchased from Beijing Biocytogen Biotechnology Co., Ltd.)(body weight 18-22 g) were taken, and after one week of adaptation, Nalm6-luciferase was inoculated via the tail veins, and each mouse was inoculated with 110.sup.6 tumor cells. 5 days after inoculation of tumor cells in the tail vein, the first in vivo imaging was performed, and the imaging effect was not satisfactory. 8 days after inoculation, mice with unsuccessful modeling were excluded from subsequent experimental groups. Mice were grouped according to the in vivo imaging results, and the mice were randomly divided into two groups, with 8 mice in each group, and 2.2510.sup.6 H90-11 CAR-T cells or EGFRt CAR-T cells were infused through the tail vein, and the mice were injected intraperitoneally with D-luciferin (Shanghai Lechen, Cat. No.: BC219-10) every 7 days and the mice were anesthetized using a gas anesthesia machine at the same time. Tumor live imaging data were collected, and the body weight changes of the mice were recorded and the survival curve of the mice was drawn.
[0169] On the 8th, 15th, and 22nd days after the modeling, the small animal in vivo imaging equipment was used to conduct in vivo imaging observations. The imaging results are shown in