Substituted hydantoinamides as ADAMTS7 antagonists
12398120 · 2025-08-26
Assignee
Inventors
- Daniel Meibom (Wuppertal, DE)
- Yolanda Cancho Grande (Leverkusen, DE)
- Pierre WASNAIRE (Düsseldorf, DE)
- Sarah Anna Liesa JOHANNES (Hilden, DE)
- Kristin BEYER (Hilden, DE)
- Till Freudenberger (Velbert, DE)
- Damian Brockschnieder (Haan, DE)
- Dmitry Zubov (Remscheid, DE)
- Dzianis MENSHYKAU (Düsseldorf, DE)
- Tanja KRAINZ (Cambridge, MA, US)
- Bryan MACDONALD (Cambridge, MA, US)
- Yi XING (Cambridge, MA, US)
- Nadine ELOWE (Cambridge, MA, US)
- Guzman SANCHEZ (Murcia, ES)
Cpc classification
A61K31/427
HUMAN NECESSITIES
C07D233/76
CHEMISTRY; METALLURGY
A61K31/4178
HUMAN NECESSITIES
C07D413/04
CHEMISTRY; METALLURGY
A61K31/501
HUMAN NECESSITIES
A61K31/4166
HUMAN NECESSITIES
A61K31/4439
HUMAN NECESSITIES
C07D401/12
CHEMISTRY; METALLURGY
C07D405/04
CHEMISTRY; METALLURGY
C07D403/04
CHEMISTRY; METALLURGY
C07D233/02
CHEMISTRY; METALLURGY
C07D401/04
CHEMISTRY; METALLURGY
C07D417/04
CHEMISTRY; METALLURGY
International classification
A61K31/4166
HUMAN NECESSITIES
A61K31/4174
HUMAN NECESSITIES
A61K31/4178
HUMAN NECESSITIES
A61K31/427
HUMAN NECESSITIES
A61K31/4439
HUMAN NECESSITIES
A61K31/501
HUMAN NECESSITIES
C07D233/02
CHEMISTRY; METALLURGY
C07D401/12
CHEMISTRY; METALLURGY
C07D403/04
CHEMISTRY; METALLURGY
C07D405/04
CHEMISTRY; METALLURGY
C07D417/04
CHEMISTRY; METALLURGY
Abstract
The application relates to substituted hydantoinamides of formula (I) as ADAMTS7 antagonists, to processes for their preparation, their use alone or in combination for the treatment or prophylaxis of diseases, in particular of cardiovascular diseases, including atherosclerosis, coronary artery disease (CAD), peripheral vascular disease (PAD), arterial occlusive disease or restenosis after angioplasty. R.sup.1 is hydrogen, alkyl, cycloalkyl, heterocycloalkyl, heteroaryl or phenyl; R.sup.2 is hydrogen, cyano, halogen, alkylsulfonyl, alkyl, cycloalkyl or alkoxy; R.sup.3, R.sup.4, R.sup.5, R.sup.6, R.sup.7 and R.sup.8 are independently hydrogen, halogen, alkyl or alkoxy; most groups being optionally substituted; with the proviso that at least one of R.sup.2, R.sup.3, R.sup.4 is H; X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5 and X.sup.6 are independently N or C; with the proviso that in each ring maximal one X is N. ##STR00001##
Claims
1. A compound of formula (I): ##STR00724## wherein, R.sup.1 is selected from the group consisting of hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl, and phenyl, wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl,5- to 10-membered heteroaryl, or phenyl is optionally substituted with one or two groups independently selected from the group consisting of cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, or (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms; R.sup.2 is selected from the group consisting of hydrogen, cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy, wherein said (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, or (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms; R.sup.3 and R.sup.4are each independently selected from the group consisting of hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy, wherein each said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms, provided that at least one of R.sup.2, R.sup.3, and R.sup.4 represents H; X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, and X.sup.6 are each independently N or C, provided that in each ring system maximally one X stands for N; and R.sup.5, R.sup.6, R.sup.7 and R.sup.8 are each absent when the X atom to which they are attached is N, or R.sup.5, R.sup.6, R.sup.7 and R.sup.8 are each independently selected from the group consisting of hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy when the X atom to which they are attached is C, wherein each said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms present, or a pharmaceutically acceptable salt thereof, a solvate thereof, or a solvate of a pharmaceutically acceptable salt thereof.
2. The compound of claim 1, wherein R.sup.1 is selected from the group consisting of hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl, and phenyl, wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl, or phenyl is optionally substituted with one or two groups independently selected from from the group consisting of cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms; R.sup.2 is selected from the group consisting of hydrogen, cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-C.sub.4)-alkoxy, wherein said (C.sub.1-C.sub.4)-alkyl(C.sub.3-C.sub.6)-cycloalkyl or (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms; R.sup.3 and R.sup.4 are hydrogen; and R.sup.5, R.sup.6, R.sup.7 and R.sup.8, when present, are each independently selected from the group consisting of hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy, wherein each said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms, or a pharmaceutically acceptable salt thereof, a solvate thereof, or a solvate of a pharmaceutically acceptable salt thereof.
3. The compound of claim 1, wherein R.sup.1 is selected from the group consisting of hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl, and phenyl, wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl, or phenyl is optionally substituted with one or two groups independently selected from the group consist of cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms; R.sup.2 represents a group independently selected from hydrogen cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl(C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms, R.sup.3 and R.sup.4 are each independently selected from the group consisting of hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy, wherein each said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms, R.sup.5, R.sup.6, R.sup.7, and R.sup.8, when present, are each independently selected from the group consisting of hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy, wherein each said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms, and provided that at least two of R.sup.5, R.sup.6, R.sup.7 and R.sup.8 are hydrogen, or a pharmaceutically acceptable salt thereof, a solvate thereof, or a solvate of a pharmaceutically acceptable salt thereof.
4. The compound of claim 1, wherein the compound is of formula (Ia), (Ib), (Ic), (Id) or (Ie): ##STR00725## wherein R.sup.1 is selected from the group consisting of hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl, and phenyl, wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl, or phenyl is optionally substituted with one or two groups independently selected from the group consisting of cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms; R.sup.2 is selected from the group consisting of hydrogen, cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-C.sub.4)-alkoxy, wherein said (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, or (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms; R.sup.3 and R.sup.4 are independently selected from the group consisting of hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl, and (C.sub.1-C.sub.4)-alkoxy, wherein each said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms; R.sup.5, R.sup.6 R.sup.7, and R.sup.8, when present, are each independently selected from the group consisting of hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl, and (C.sub.1-C.sub.4)-alkoxy, wherein each said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy is optionally independently substituted with up to five fluorine atoms, provided that at least two of R.sup.5, R.sup.6, R.sup.7 and R.sup.8 are hydrogen, or a pharmaceutically acceptable salt thereof, a solvate thereof, or a solvate of a pharmaceutically acceptable salt thereof.
5. The compound of claim 1, wherein R.sup.2 is (C.sub.3-C.sub.6)-cycloalkyl substituted with a trifluoromethyl group.
6. The compound of claim 1, wherein the compound is selected from the group consisting of ent-6-fluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl] methyl}-4-(trifluoromethyl) [biphenyl]-2-carboxamide ##STR00726## ent-5,6-difluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl] methyl}-4-(trifluoromethyl) [biphenyl]-2-carboxamide ##STR00727## ent-4-chloro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl] methyl} [biphenyl]-2-carboxamide ##STR00728## ent-4-chloro-5-fluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl] methyl} [biphenyl]-2-carboxamide ##STR00729## ent-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl] methyl}-4-(trifluoromethyl) [biphenyl]-2-carboxamide ##STR00730## ent-4,5-difluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl] methyl}-4-(trifluoromethyl) [biphenyl]-2-carboxamide ##STR00731## ent-N-{[4-(4-methyl-1,2-oxazol-3-yl)-2,5-dioxoimidazolidin-4-yl] methyl}-4-(trifluoromethyl) [biphenyl]-2-carboxamide ##STR00732## or a pharmaceutically acceptable salt thereof, a solvate thereof, or a solvate of a pharmaceutically acceptable salt thereof.
7. A pharmaceutical composition comprising the compound of claim 1, a pharmaceutically acceptable salt thereof, a solvate thereof, or a solvate of a pharmaceutically acceptable salt thereof, and one or more pharmaceutically acceptable excipients.
8. The pharmaceutical composition of claim 7, further comprising one or more further active ingredients.
9. A method for the treatment of heart disease, vascular disease, cardiovascular disease, lung disease, inflammatory disease, fibrotic disease, metabolic disease or cardiometabolic disease, comprising administering to a mammal in need thereof a therapeutically effective amount of the compound of claim 1.
10. The method of claim 9, wherein the disease is atherosclerosis, coronary artery disease, peripheral vascular disease, arterial occlusive disease, or a post-surgery complication of any of the foregoing.
11. The method of claim 10, wherein the disease is restenosis after angioplasty.
12. The method of claim 9, wherein the mammal is a human.
13. The pharmaceutical composition of claim 7, further comprising one or more therapeutic agents selected from the group consisting of angiotensin-converting enzyme inhibitors, angiotensin-receptor blockers, mineralocorticoid-receptor antagonists, endothelin antagonists, renin inhibitors, calcium blockers, beta-receptor blockers, vasopeptidase inhibitors, sodium-glucose-transport-antagonists, metformin, pioglitazones and dipeptidyl-peptidase-IV inhibitors.
14. A method for the treatment of atherosclerosis or an atherosclerosis-related disease, comprising administering to a mammal in need thereof a therapeutically effective amount of the composition of claim 7.
15. The method of claim 14, wherein the treatment is for an atherosclerosis-related disease selected from the group consisting of coronary artery disease, peripheral vascular disease, arterial occlusive disease, and a post-surgery complication of any of the foregoing.
16. The method of claim 15, wherein the atheroschlerosis-related disease is restenosis after angioplasty.
17. The method of claim 14, wherein the mammal is a human.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
BRIEF DESCRIPTION OF THE SEQUENCE IDS
(9) The sequence listing provided with the application via electronic filing is included herein in its entirety. Where the sequence information or listing apart from the amino acid sequence comprises modifications, fluorophores and/or quencher (i.e. within the feature data) these shall not be read restrictively but only in an exemplary way. The same holds true for non essential modifications such as tags such as FLAG tags or HIS tags.
(10) TABLE-US-00001 SEQ ID NO. VARIANT TYPE 1 rPro-hCD(Rat1-217/Human237-537)-TEV-2Strep-6His PRT MHRGLNLLLILCALAPHVLGPASGLPTEGRAGLDIVHPVRVDAGGSFLSYELWPRVLRKRDVSAAQASS AFYQLQYQGRELLFNLTTNPYLLAPGFVSEIRRRSNLSNVHIQTSVPTCHLLGDVQDPELEGGFAAISAC DGLRGVFQLSNEDYFIEPLDEVPAQPGHAQPHMVYKHKRSGQQDDSRTSGTCGVQGSPELKHQREHW EQRQQKRRQQRSVSKEKWVETLVVADAKMVEYHGQPQVESYVLTIMNMVAGLFHDPSIGNPIHITIVRL VLLEDEEEDLKITHHADNTLKSFCKWQKSINMKGDAHPLHHDTAILLTRKDLCAAMNRPCETLGLSHVAG MCQPHRSCSINEDTGLPLAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFIMSPQLLYDAAPLTWSRCSR QYITRFLDRGWGLCLDDPPAKDIIDFPSVPPGVLYDVSHQCRLQYGAYSAFCEDMDNVCHTLWCSVGTT CHSKLDAAVDGTRCGENKWCLSGECVPVGFRPEAVGSENLYFQSGWSHPQFEKGGGSGGGSGGGS WSHPQFEKHHHHHH 2 rPro-hCD-FM2(Rat1-217/Human237-537FM2(Q216K))-TEV-2Strep-6His PRT MHRGLNLLLILCALAPHVLGPASGLPTEGRAGLDIVHPVRVDAGGSFLSYELWPRVLRKRDVSAAQASS AFYQLQYQGRELLFNLTTNPYLLAPGFVSEIRRRSNLSNVHIQTSVPTCHLLGDVQDPELEGGFAAISAC DGLRGVFQLSNEDYFIEPLDEVPAQPGHAQPHMVYKHKRSGQQDDSRTSGTCGVQGSPELKHQREHW EQRQQKRRQKRSVSKEKWVETLVVADAKMVEYHGQPQVESYVLTIMNMVAGLFHDPSIGNPIHITIVRLV LLEDEEEDLKITHHADNTLKSFCKWQKSINMKGDAHPLHHDTAILLTRKDLCAAMNRPCETLGLSHVAGM CQPHRSCSINEDTGLPLAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFIMSPQLLYDAAPLTWSRCSRQ YITRFLDRGWGLCLDDPPAKDIIDFPSVPPGVLYDVSHQCRLQYGAYSAFCEDMDNVCHTLWCSVGTTC HSKLDAAVDGTRCGENKWCLSGECVPVGFRPEAVGSENLYFQSGWSHPQFEKGGGSGGGSGGGSW SHPQFEKHHHHHH 3 rADAMTS-7(Rat1-575)-Flag PRT MHRGLNLLLILCALAPHVLGPASGLPTEGRAGLDIVHPVRVDAGGSFLSYELWPRVLRKRDVSAAQASS AFYQLQYQGRELLFNLTTNPYLLAPGFVSEIRRRSNLSNVHIQTSVPTCHLLGDVQDPELEGGFAAISAC DGLRGVFQLSNEDYFIEPLDEVPAQPGHAQPHMVYKHKRSGQQDDSRTSGTCGVQGSPELKHQREHW EQRQQKRRQQRSISKEKWVETLVVADSKMVEYHGQPQVESYVLTIMNMVAGLYHDPSIGNPIHITVVRLI ILEDEEKDLKITHHADDTLKNFCRWQKNVNMKGDDHPQHHDTAILLTRKDLCATMNHPCETLGLSHVAG LCHPQLSCSVSEDTGLPLAFTVAHELGHSFGIQHDGTGNDCESIGKRPFIMSPQLLYDRGIPLTWSRCSR EYITRFLDRGWGLCLDDRPSKGVINFPSVLPGVLYDVNHQCRLQYGPSSAYCEDVDNVCYTLWCSVGT TCHSKMDAAVDGTSCGKNKWCLNGECVPEGFQPETVDGGWSGWSAWSVCSRSCGVGVRSSERQCT QPVPKNKGKYCVGERKRYRLCNLQACPENLYFQGDYKDDDDK 4 PeptideSubstrateforADAMTS-7/12 PRT (HiLyteFluor-488)-DELSSMVLELRGLRT-K(QXL520)-NH2 5 PeptideSubstrateforADAMTS-7/12 PRT (HiLyteFluor-488)-SSMVLELRGLRTIVT-K(QXL520)-NH2 6 PeptideSubstrateforADAMTS-7/12: PRT (HiLyteFluor-488)-KVTEENKELANELRR-K(QXL520)-NH2 7 PeptideSubstrateforADAMTS-7/12: PRT (HiLyteFluor-488)-EENKELANELRRPPL-K(QXL520)-NH2 8 PeptideSubstrateforADAMTS-7/12: PRT (HiLyteFluor-488)-SSMVLELRGLRT-K(QXL520)-NH2 9 PeptideSubstrateforADAMTS-7/12: PRT (Donor)GMQQSVRTGLPS(K-Quencher) 10 PeptideSubstrateforADAMTS-7/12: PRT (Donor)SPGFRCEACPPGYS(K-Quencher) 11 PeptideSubstrateforADAMTS-7andADAMTS-12: PRT (HiLyteFluor-488)-DELSSMVLELRGLRT-K(QXL520)-E-NH2 12 PeptideSubstrateforADAMTS-7/12: PRT (HiLyteFluor-488)-DELSSMVLELRGLRT-K(QXL520)-K-NH2 13 PeptideSubstrateforADAMTS-7/12: PRT (HiLyteFluor-488)-DELSSMVLELRGLRT-K(QXL520)-OH 14 PeptideSubstrateforADAMTS4andforADAMTS5: PRT Dabcyl-EEVKAKVQPY-Glu(Edans)-NH2 15 rPro-hCDforADAMTS-12 PRT MPCAQGNWMAKLSMVAQLLNFGAFCHGRQAQPWPVRFPDPKQEHFIKSLPEYHIVSPVQVDASGHFL SYGLHHPVTGSRKKRAAGGSGDQVYYRISHEEKNLFFNLTVNWEFLSNGYVVERRYGNLSHVKMAASS GQPCHLRGTVLQQGPTIRMGTAALSACQGLTGFFHLPHGDFFIEPVKKHPLTEEGYQPHVIYRRQSYRV PETKEPTCGLKDSLDNSVKQELQREKWERKNWPSRSLSRRSISKERWVETLVVADTKMIEYHGSENVE SYILTIMNMVTGLFHNPSIGNAIHIVWRLILLEEEEQGLKIVHHAEKTLSSFCKWQKSINPKSDLNPVHH DVAVLLTRKDICAGFNRPCETLGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKENDC EPVGRHPYIMSRQLQYDPTPLTWSKCSEEYITRFLDRGWGFCLDDIPKKKGLKSKVIAPGVIYDVHHQCQ LQYGPNATFCQEVENVCQTLWCSVKGFCRSKLDAAADGTQCGEKKWCMAGKCITVGKKPESIPGGGGSD YKDHDGDYKDHDIDYKDDDDK 16 ADAMTSCatalyticMotifConsensusSequence: PRT HEXXHXBG(/N/S)BXHD 17 PeptideSubstrateforMMP12 PRT Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap(Dnp)-NH2 18 PeptideSubstrateforMMP15 PRT MCA-Lys-Pro-Leu-Gly-Leu-DPA-Ala-Arg-NH2 19 PeptideSubstrateforMMP2 PRT MCA-Pro-Leu-Gly-Leu-DPA-Ala-Arg-NH2 20 PeptideSubstrateforADAM17 PRT Mca-Pro-Leu-Ala-Gln-Ala-Val-Dap(Dnp)-Arg-Ser-Ser-Ser-Arg-NH2 21 HumanADAMTS-7fromQ9UKP4 PRT MPGGPSPRSPAPLLRPLLLLLCALAPGAPGPAPGRATEGRAALDIVHPVRVDAGGSFLSY ELWPRALRKRDVSVRRDAPAFYELQYRGRELRFNLTANQHLLAPGFVSETRRRGGLGRAH IRAHTPACHLLGEVQDPELEGGLAAISACDGLKGVFQLSNEDYFIEPLDSAPARPGHAQP HVVYKRQAPERLAQRGDSSAPSTCGVQVYPELESRRERWEQRQQWRRPRLRRLHQRSVSK EKWVETLVVADAKMVEYHGQPQVESYVLTIMNMVAGLFHDPSIGNPIHITIVRLVLLEDE EEDLKITHHADNTLKSFCKWQKSINMKGDAHPLHHDTAILLTRKDLCAAMNRPCETLGLS HVAGMCQPHRSCSINEDTGLPLAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFIMSPQLL YDAAPLTWSRCSRQYITRFLDRGWGLCLDDPPAKDIIDFPSVPPGVLYDVSHQCRLQYGA YSAFCEDMDNVCHTLWCSVGTTCHSKLDAAVDGTRCGENKWCLSGECVPVGFRPEAVDGG WSGWSAWSICSRSCGMGVQSAERQCTQPTPKYKGRYCVGERKRFRLCNLQACPAGRPSFR HVQCSHFDAMLYKGQLHTWVPVVNDVNPCELHCRPANEYFAEKLRDAVVDGTPCYQVRAS RDLCINGICKNVGCDFEIDSGAMEDRCGVCHGNGSTCHTVSGTFEEAEGLGYVDVGLIPA GAREIRIQEVAEAANFLALRSEDPEKYFLNGGWTIQWNGDYQVAGTTFTYARRGNWENLT SPGPTKEPVWIQLLFQESNPGVHYEYTIHREAGGHDEVPPPVFSWHYGPWTKCTVTCGRG VQRQNVYCLERQAGPVDEEHCDPLGRPDDQQRKCSEQPCPARWWAGEWQLCSSSCGPGGL SRRAVLCIRSVGLDEQSALEPPACEHLPRPPTETPCNRHVPCPATWAVGNWSQCSVTCGE GTQRRNVLCTNDTGVPCDEAQQPASEVTCSLPLCRWPLGTLGPEGSGSGSSSHELFNEAD FIPHHLAPRPSPASSPKPGTMGNAIEEEAPELDLPGPVFVDDFYYDYNFINFHEDLSYGP SEEPDLDLAGTGDRTPPPHSHPAAPSTGSPVPATEPPAAKEEGVLGPWSPSPWPSQAGRS PPPPSEQTPGNPLINFLPEEDTPIGAPDLGLPSLSWPRVSTDGLQTPATPESQNDFPVGK DSQSQLPPPWRDRTNEVFKDDEEPKGRGAPHLPPRPSSTLPPLSPVGSTHSSPSPDVAEL WTGGTVAWEPALEGGLGPVDSELWPTVGVASLLPPPIAPLPEMKVRDSSLEPGTPSFPTP GPGSWDLQTVAVWGTFLPTTLTGLGHMPEPALNPGPKGQPESLSPEVPLSSRLLSTPAWD SPANSHRVPETQPLAPSLAEAGPPADPLVVRNAGWQAGNWSECSTTCGLGAVWRPVRCSS GRDEDCAPAGRPQPARRCHLRPCATWHSGNWSKCSRSCGGGSSVRDVQCVDTRDLRPLRP FHCQPGPAKPPAHRPCGAQPCLSWYTSSWRECSEACGGGEQQRLVTCPEPGLCEEALRPN TTRPCNTHPCTQWVVGPWGQCSGPCGGGVQRRLVKCVNTQTGLPEEDSDQCGHEAWPESS RPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGH QRVARR 22 RatADAMTS-7fromQ1EHB3 PRT MHRGLNLLLILCALAPHVLGPASGLPTEGRAGLDIVHPVRVDAGGSFLSYELWPRVLRKR DVSAAQASSAFYQLQYQGRELLFNLTTNPYLLAPGFVSEIRRRSNLSNVHIQTSVPTCHL LGDVQDPELEGGFAAISACDGLRGVFQLSNEDYFIEPLDEVPAQPGHAQPHMVYKHKRSG QQDDSRTSGTCGVQGSPELKHQREHWEQRQQKRRQQRSISKEKWVETLVVADSKMVEYHG QPQVESYVLTIMNMVAGLYHDPSIGNPIHITVVRLIILEDEEKDLKITHHADDTLKNFCR WQKNVNMKGDDHPQHHDTAILLTRKDLCATMNHPCETLGLSHVAGLCHPQLSCSVSEDTG LPLAFTVAHELGHSFGIQHDGTGNDCESIGKRPFIMSPQLLYDRGIPLTWSRCSREYITR FLDRGWGLCLDDRPSKGVINFPSVLPGVLYDVNHQCRLQYGPSSAYCEDVDNVCYTLWCS VGTTCHSKMDAAVDGTSCGKNKWCLNGECVPEGFQPETVDGGWSGWSAWSVCSRSCGVGV RSSERQCTQPVPKNKGKYCVGERKRYRLCNLQACPPDRPSFRHTQCSQFDSMLYKGKLHK WVPVLNDENPCELHCRPFNYSNREKLRDAVMDGTPCYQGRISRDICIDGICKKVGCDFEL DSGAEEDRCGVCRGDGSTCHTVSRTFKEAEGMGYVDVGLIPAGAREILIEEVAEAANFLA LRSEDPDKYFLNGGWTIQWNGDYQVAGTTFTYTRKGNWETLTSPGPTTEPVWIQLLFQER NPGVHYKYTIQRASHSEAQPPEFSWHYGPWSKCPVTCGTGVQRQSLYCMEKQAGIVDEGH CDHLSRPRDRKRKCNEEPCPARWWVGDWQPCSRSCGPGGFFRRAVFCTRSVGLDEQRALE PSACGHLPRPLAEIPCYHYVACPSSWGVGNWSQCSVTCGAGIRQRSVLCINNTGVPCDGA ERPITETFCFLQPCQYSTYIVDTGASGSGSSSPELFNEVDFDPHQPVPRPSPASSPKPVS ISNAIDEEDPELDPPGPVFVDDFYYDYNFINFHEDLSYGSFEESHSDLVDIGGQTVPPHI RPTEPPSDSPVPTAGAPGAEEEGIQGSWSPSPLLSEASHSPPVLLENTPVNPLANFLTEE ESPIGAPELGLPSVSWPPASVDGMVTSVAPGNPDELLVREDTQSQPSTPWSDRNKLSKDG NPLGPTSPALPKSPFPTQPSSPSNSTTQASLSPDAVEVSTGWNVALDPVLEADLKPVHAP TDPGLLDQIQTPHTEGTQSPGLLPRPAQETQTNSSKDPAVQPLQPSLVEDGAPTDLLPAK NASWQVGNWSQCSTTCGLGAIWRLVRCSSGNDEDCTLSSRPQPARHCHLRPCAAWRAGNW SKCSRNCGGGSATRDVQCVDTRDLRPLRPFHCQPGPTKPPTRQLCGTQPCLPWYTSSWRE CSEACGGGEQQRLVTCPEPGLCEESLRPNNTRPCNTHPCTQWVVGPWGQCSAPCGGGVQR RLVKCVNTQTGLAEEDSDLCSHEAWPESSRPCATEDCELVEPSRCERDRLPFNFCETLRL LGRCQLPTIRAQCCRSCPPLSRGVPSRGHQRVARR 23 MouseADAMTS-7fromQ68SA9 PRT MHRGPSLLLILCALASRVLGPASGLVTEGRAGLDIVHPVRVDAGGSFLSYELWPRVLRKR DVSTTQASSAFYQLQYQGRELLFNLTTNPYLMAPGFVSEIRRHSTLGHAHIQTSVPTCHL LGDVQDPELEGGFAAISACDGLRGVFQLSNEDYFIEPLDGVSAQPGHAQPHVVYKHQGSR KQAQQGDSRPSGTCGMQVPPDLEQQREHWEQQQQKRRQQRSVSKEKWVETLVVADSKMVE YHGQPQVESYVLTIMNMVAGLFHDPSIGNPIHISIVRLIILEDEEKDLKITHHAEETLKN FCRWQKNINIKGDDHPQHHDTAILLTRKDLCASMNQPCETLGLSHVSGLCHPQLSCSVSE DTGMPLAFTVAHELGHSFGIQHDGTGNDCESIGKRPFIMSPQLLYDRGIPLTWSRCSREY ITRFLDRGWGLCLDDRPSKDVIALPSVLPGVLYDVNHQCRLQYGSHSAYCEDMDDVCHTL WCSVGTTCHSKLDAAVDGTSCGKNKWCLKGECVPEGFQPEAVDGGWSGWSAWSDCSRSCG VGVRSSERQCTQPVPKNRGKYCVGERKRSQLCNLPACPPDRPSFRHTQCSQFDGMLYKGK LHKWVPVPNDDNPCELHCRPSNSSNTEKLRDAVVDGTPCYQSRISRDICLNGICKNVGCD FVIDSGAEEDRCGVCRGDGSTCQTVSRTFKETEGQGYVDIGLIPAGAREILIEEVAEAAN FLALRSEDPDKYFLNGGWTIQWNGDYRVAGTTFTYARKGNWENLTSPGPTSEPVWIQLLF QEKNPGVHYQYTIQRDSHDQVRPPEFSWHYGPWSKCTVTCGTGVQRQSLYCMERQAGVVA EEYCNTLNRPDERQRKCSEEPCPPRWWAGEWQPCSRSCGPEGLSRRAVFCIRSMGLDEQR ALELSACEHLPRPLAETPCNRHVICPSTWGVGNWSQCSVTCGAGIRQRSVLCINNTDVPC DEAERPITETFCFLQPCQYPMYIVDTGASGSGSSSPELFNEVDFIPNQLAPRPSPASSPK PVSISNAIDEEELDPPGPVFVDDFYYDYNFINFHEDLSYGSFEEPHPDLVDNGGWTAPPH IRPTESPSDTPVPTAGALGAEAEDIQGSWSPSPLLSEASYSPPGLEQTSINPLANFLTEE DTPMGAPELGFPSLPWPPASVDDMMTPVGPGNPDELLVKEDEQSPPSTPWSDRNKLSTDG NPLGHTSPALPQSPIPTQPSPPS1SPTQASPSPDVVEVSTGWNAAWDPVLEADLKPGHGE LPSTVEVASPPLLPMATVPGIWGRDSPLEPGTPTFSSPELSSQHLKTLTMPGTLLLTVPT DLRSPGPSGQPQTPNLEGTQSPGLLPTPARETQTNSSKDPEVQPLQPSLEEDGDPADPLP ARNASWQVGNWSQCSTTCGLGAIWRLVSCSSGNDEDCTLASRPQPARHCHLRPCAAWRTG NWSKCSRNCGGGSSTRDVQCVDTRDLRPLRPFHCQPGPTKPPNRQLCGTQPCLPWYTSSW RECSEACGGGEQQRLVTCPEPGLCEESLRPNNSRPCNTHPCTQWVVGPWGQCSAPCGGGV QRRLVRCVNTQTGLAEEDSDLCSHEAWPESSRPCATEDCELVEPPRCERDRLSFNFCETL RLLGRCQLPTIRAQCCRSCPPLSRGVPSRGHQRVARR 24 HumanADAMTS-12fromP58397 PRT MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRV DASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIME KRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVK KHPLVEGGYHPHIVYRRQKVPETKEPTCGLKDSVNISQKQELWREKWERHNLPSRSLSRR SISKERWVETLVVADTKMIEYHGSENVESYILTIMNMVTGLFHNPSIGNAIHIVVVRLIL LEEEEQGLKIVHHAEKTLSSFCKWQKSINPKSDLNPVHHDVAVLLTRKDICAGFNRPCET LGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKENDCEPVGRHPYIMS RQLQYDPTPLTWSKCSEEYITRFLDRGWGFCLDDIPKKKGLKSKVIAPGVIYDVHHQCQL QYGPNATFCQEVENVCQTLWCSVKGFCRSKLDAAADGTQCGEKKWCMAGKCITVGKKPES IPGGWGRWSPWSHCSRTCGAGVQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPCRSEA PTFRQMQCSEFDTVPYKNELYHWFPIFNPAHPCELYCRPIDGQFSEKMLDAVIDGTPCFE GGNSRNVCINGICKMVGCDYEIDSNATEDRCGVCLGDGSSCQTVRKMFKQKEGSGYVDIG LIPKGARDIRVMEIEGAGNFLAIRSEDPEKYYLNGGFIIQWNGNYKLAGTVFQYDRKGDL EKLMATGPTNESVWIQLLFQVTNPGIKYEYTIQKDGLDNDVEQQMYFWQYGHWTECSVTC GTGIRRQTAHCIKKGRGMVKATFCDPETQPNGRQKKCHEKACPPRWWAGEWEACSATCGP HGEKKRTVLCIQTMVSDEQALPPTDCQHLLKPKTLLSCNRDILCPSDWTVGNWSECSVSC GGGVRIRSVTCAKNHDEPCDVTRKPNSRALCGLQQCPSSRRVLKPNKGTISNGKNPPTLK PVPPPTSRPRMLTTPTGPESMSTSTPAISSPSPTTASKEGDLGGKQWQDSSTQPELSSRY LISTGSTSQPILTSQSLSIQPSEENVSSSDTGPTSEGGLVATTTSGSGLSSSRNPITWPV TPFYNTLTKGPEMEIHSGSGEEREQPEDKDESNPVIWTKIRVPGNDAPVESTEMPLAPPL TPDLSRESWWPPFSTVMEGLLPSQRPTTSETGTPRVEGMVTEKPANTLLPLGGDHQPEPS GKTANRNHLKLPNNMNQTKSSEPVLTEEDATSLITEGFLLNASNYKQLTNGHGSAHWIVG NWSECSTTCGLGAYWRRVECSTQMDSDCAAIQRPDPAKRCHLRPCAGWKVGNWSKCSRNC SGGFKIREIQCVDSRDHRNLRPFHCQFLAGIPPPLSMSCNPEPCEAWQVEPWSQCSRSCG GGVQERGVFCPGGLCDWTKRPTSTMSCNEHLCCHWATGNWDLCSTSCGGGFQKRTVQCVP SEGNKTEDQDQCLCDHKPRPPEFKKCNQQACKKSADLLCTKDKLSASFCQTLKAMKKCSV PTVRAECCFSCPQTHITHTQRQRRQRLLQKSKEL 25 RatADAMTS-12fromD3ZTJ3 PRT MPCAQGNWMAKLSMVAQLLNFGAFCHGRQAQPWPVRFPDPKQEHFIKSLPEYHIVSPVQV DASGHFLSYGLHHPVTGSRKKRAAGGSGDQVYYRISHEEKNLFFNLTVNWEFLSNGYVVE RRYGNLSHVKMAASSGQPCHLRGTVLQQGPTIRMGTAALSACQGLTGFFHLPHGDFFIEP VKKHPLTEEGYQPHVIYRRQSYRVPETKEPTCGLKDSLDNSVKQELQREKWERKNWPSRS LSRRSISKERWVETLVVADTKMVEYHGSENVESYILTIMNMVTGLFHNPSIGNAVHIVVV RLILLEEEEQGLKIVHHAEKTLSSFCKWQKSINPKSDLNPVHHDVAVLITRKDICAGVNR PCETLGLSQLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKENDCEPVGRHP YIMSQQIQYDPTPLTWSKCSKEYITRFLDRGRGFCLDDVPRKKGLKSNVIAPGVIYDVHH QCQLQYGPNATFCQEVENVCQTLWCSVKGFCRSKLDAAADGTRCGEKKWCMAGKCITVGK KPESIPGGWGRWSPWSHCSRTCGAGAQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPC RSDTPTFRQMQCSEFDTVPYKNQFYRWFPVFNPAHPCELYCRPIDEQFSERMLEAVIDGT PCFEGGNSRNVCINGICKRVGCDYEIDSNATEDRCGVCLGDGSACQTVKKVFRQKEGSGY IDIGLIPKGARDIRVMEIKAAGNFLAIRSEDPEKYYLNGGFIIQWNGNYKLAGTVFQYDR KGDLERLMAPGPTNESVWLQLLFQVTNPGIKYEYTVRKDGLDNDVEKLLYFWQFGRWTEC SVTCGTGIRRQTAHCVKKGHGIVKTTFCNPETQPSVRQKKCYEKDCPPRWWAGEWEACSM TCGPYGEKKRTVLCIQTMGSDEQALPATDCQHLLKPKTLVSCNRDILCPSDWTVGNWSEC SVSCGGGVRIRSVTCAKNLNEPCDKTRKPNSRALCGLQQCPFSRRVLKPNKDTVPSGKNP TTSEHDHFKPIPASTSRPTPLSTPTVPESVSTSTPTINSLGSTITSQEEPDGIGWQNNST QAEEDSHIPTSVGSTSQTPLTSWSWSMQPDDENVSSSAIGPTSESDFWATTSDSGLSSSN AMTWQVTPFYSTATTEPEVEIHSGSGEDSDQPLNKEENNSVLWNKIRVPERDAPMEMDAE IPLGPPPTSYVTEESSWPPFSTMMKSSLPAWSFKNETPRDEGMITEKSGNIPLPLGGDHQ TTSPEKLGNNDQLASANSTNPTQGSGPVLTEEDASTLIEEGFLLNASNYKHLMKDHSPAH WIVGNWSKCSTTCGLGAYWRSVECSTGMNADCAAIQRPDPAKKCHLRPCAGWRVGNWSKC SRNCSGGFKIREVQCMDGVDHHRSLRPFHCQFLAGVPPPLSMSCNLEPCEEWKVEPWSQC SRSCGGGVQERGVFCPGGLCDWTKRPASTVPCNRHLCCHWATGNWELCTTSCGGGSQKRT VHCIPSENSTTEDQDQCFCDHQARPPEFQNCNQQACRKSADLTCTKDRLSTSFCQTLKSM KKCSVPSVRVQCCLSCPQTQSIHTQRQRKQQMLQNHDTL 26 MouseADAMTS-12fromQ811B3 PRT MPCARGSWLAKLSIVAQLINFGAFCHGRQTQPWPVRFPDPRQEHFIKSLPEYHIVSPVQV DAGGHVLSYGLHHPVTSSRKKRAAGGSGDQLYYRISHEEKDLFFNLTVNWEFLSNGYVVE KRYGNLSHVKMVASSGQPCHLRGTVLQQGTTVGIGTAALSACQGLTGFFHLPHGDFFIEP VKKHPLTEEGSYPHVVYRRQSIRAPETKEPICGLKDSLDNSVKQELQREKWERKTLRSRS LSRRSISKERWVETLVVADTKTVEYHGSENVESYILTIMNMVTGLFHSPSIGNLVHIVVV RLILLEEEEQGLKIVHHAEKTLSSFCKWQKSINPKSDLNPVHHDVAVLITRKDICAGVNR PCETLGLSQLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKENDCEPVGRHP YIMSQQIQYDPTPLTWSKCSKEYITRFLDRGRGFCLDDIPSKKGLKSNVIAPGVIYDVHH QCQLQYGPNATFCQEVENVCQTLWCSVKGFCRSKLDAAADGTRCGEKKWCMAGKCITVGK KPESIPGGWGRWSPWSHCSRTCGAGAQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPC RSDTPTFRQMQCSEFDTVPYKNQFYRWFPVFNAAHPCELYCRPIDEQFSERMLEAVIDGT PCFEGGNSRNVCINGICKRVGCDYEIDSNATEDRCGVCLGDGSACQTVKKLFRQKEGSGY VDIGLIPKGARDIRVMEIKAAGNFLAIRSEDPEKYYLNGGFIIQWNGNYKLAGTVFQYDR KGDLEKLIAPGPTNESVWLQLLFQVTNPGIKYEYTVRKDGLDNDVEKLLYFWQFGRWTEC SVTCGTGIRRQAAHCVKKGHGIVKTTFCNPETQPSVRQKKCHEKDCPPRWWAGEWEACST TCGPYGEKKRTVLCIQTMGSDEQALPATDCQHLLKPKALVSCNRDILCPSDWTVGNWSEC SVSCGGGVRIRSVTCAKNLNEPCDKTRKPNSRALCGLQQCPFSRRVLKPNKDIAPSGKNQ STAEHDPFKPIPAPTSRPTPLSTPTVPESMSTSTPTINSLGSTIASQEDANGMGWQNNST QAEEGSHFPTSSGSTSQVPVTSWSLSIQPDDENVSSSAIGPTSEGDFWATTTSDSGLSSS DAMTWQVTPFYSTMTTDPEVEIHSGSGEDSDQPLNKDKSNSVIWNKIGVPEHDAPMETDA ELPLGPPPTSYMGEEPSWPPFSTKMEGSLPAWSFKNETPRDDGMIAEKSRKIPLPLAGDH HPATSEKLENHDKLALPNTTNPTQGFGPVLTEEDASNLIAEGFLLNASDYKHLMKDHSPA YWIVGNWSKCSTTCGLGAYWRSVECSSGVDADCTTIQRPDPAKKCHLRPCAGWRVGNWSK CSRNCSGGFKIREVQCMDSLDHHRSLRPFHCQFLAGAPPPLSMSCNLEPCGEWQVEPWSQ CSRSCGGGVQERGVSCPGGLCDWTKRPATTVPCNRHLCCHWATGNWELCNTSCGGGSQKR TIHCIPSENSTTEDQDQCLCDHQVKPPEFQTCNQQACRKSADLTCLKDRLSISFCQTLKS MRKCSVPSVRAQCCLSCPQAPSIHTQRQRKQQLLQNHDML
(11) According to a first aspect the present invention provides novel low-molecular-weight compounds which act as potent antagonists of the ADAMTS7 receptor and are thus suitable for treatment and/or prevention of lung diseases, heart diseases, inflammatory diseases, fibrotic diseases, metabolic diseases, cardiometabolic diseases, vascular diseases and/or cardiovascular diseases.
(12) Further embodiments relate to the identification of ADAMTS7 antagonists that are suitable for treatment and/or prevention of atherosclerosis, athersderosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplasty.
(13) Further embodiments relate to the identification of selective ADAMTS7 antagonists in respect to ADAMTS4 antagonistic effect.
(14) WO 2014/06651 discloses substituted hydantoinamides as ADAMTS4 and 5 inhibitors for use in the treatment of arthritis in particular osteoarthritis.
(15) WO 2004/024721 and WO2004024715 describe hydantoin derivatives and their use as TACE (ADAMT17) inhibitors.
(16) WO2004/108086 and WO2002/096426 disclose Hydantoin derivatives as TACE inhibitors.
(17) WO 2017/211666 and WO2017/211667 disclose Hydantoin derivatives as ADAMTS4 and 5 inhibitors for the treatment of inflammatory diseases preferably osteoarthritis.
(18) WO01/44200 generically discloses a broad range of compounds as selective neurokinin antagonists.
(19) WO2018/069532 discloses inhibitors of alpha-amino-beta carboxymuconic acid semialdehyde decarboxylase.
(20) 9 distinct compounds with the following CAS numbers 2224459-87-2, 2224418-23-7, 2224397-97-9, 2224363-23-7, 2224363-22-6, 2224237-51-6, 2224237-28-7, 2224196-43-2 and 2224145-02-0 have been published without further information with regard to any pharmaceutical use.
(21) It has now been found that compounds of the present invention have surprising and advantageous properties.
(22) Compounds of the present invention are ADAMTS7, and ADAMTS12 antagonists but are selective against MMP12.
(23) In particular, it has been found that compounds of the present invention are ADAMTS7 antagonists. Moreover, many of the compounds of the invention are selective with respect to ADAMTS4preferably 10 times, or even 50 times more selective against ADAMTS7 relative to ADAMTS4.
(24) The present invention provides compounds of general formula (I):
(25) ##STR00002##
in which R.sup.1 represents a group selected from hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl (such as 5- to 6-membered heteroaryl), and phenyl wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl, and phenyl are optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms R.sup.2 represents a group independently selected from hydrogen, cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-04)-alkoxy each is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms R.sup.3, R.sup.4, R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent a group independently selected from hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy each is optionally independently substituted with up to five fluorine atoms, with the proviso that at least one of R.sup.2, R.sup.3, R.sup.4 represents H, X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6, represent N or C with the provisio that in each ring system maximal one X stands for N and R.sup.5, R.sup.6, R.sup.7 and R.sup.8 are present provided that the designated atom's normal valency under the existing circumstances is not exceeded,
and pharmaceutically acceptable salts thereof, solvates thereof and the solvates of the salts thereof.
(26) The term substituted means that one or more hydrogen atoms on the designated atom or group are replaced with a selection from the indicated group, provided that the designated atom's normal valency under the existing circumstances is not exceeded. Combinations of substituents and/or variables are permissible.
(27) The term optionally substituted means that the number of non-hydrogen substituents can be equal to or different from zero. Unless otherwise indicated, optionally substituted groups may be substituted with as many optional substituents as can be accommodated by replacing a hydrogen atom with a non-hydrogen substituent on any available carbon atom or heteroatom.
(28) When groups in the compounds according to the invention are substituted, said groups may be mono-substituted or poly-substituted with substituent(s), unless otherwise specified. Within the scope of the present invention, the meanings of all groups which occur repeatedly are independent from one another. Groups in the compounds according to the invention may, for example, be substituted with one, two or three identical or different substituents.
(29) As used herein, an oxo substituent represents an oxygen atom, which is bound to a carbon atom or to a sulfur atom via a double bond.
(30) As used herein allyl is a substituent with the structural formula H.sub.2CCHCH.sub.2*, where * is the connection to the rest of the molecule. It consists of a methylene bridge (CH.sub.2) attached to a vinyl group (CHCH.sub.2).
(31) The term ring substituent means a non-hydrogen substituent attached to an aromatic or nonaromatic ring which replaces an available hydrogen atom on the ring.
(32) The term comprising when used in the specification includes consisting of.
(33) If within the present text any item is referred to as as mentioned herein, it means that it may be mentioned anywhere in the present text.
(34) The terms as mentioned in the present text have the following meanings:
(35) The term halogen or halogen atom means a fluorine, chlorine, bromine or iodine atom, preferably a fluorine, chlorine or bromine atom, even more preferably fluorine or chlorine most preferred fluorine.
(36) The term C.sub.1-C.sub.3-alkyl, C.sub.1-C.sub.4-alkyl and C.sub.1-C.sub.6-alkyl means a linear or branched, saturated, monovalent hydrocarbon group having 1, 2 or 3, 1, 2, 3, or 4 carbon atoms, and 1, 2, 3, 4, 5 or 6 carbon atoms, e.g. a methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, isobutyl, tert-butyl, pentyl, isopentyl, 2-methylbutyl, 1-methylbutyl, 1-ethylpropyl, 1,2-dimethylpropyl, neo-pentyl, 1,1-dimethylpropyl, hexyl, 1-methylpentyl, 2-methylpentyl, 3-methylpentyl, 4-methylpentyl, 1-ethylbutyl, 2-ethylbutyl, 1,1-dimethylbutyl, 2,2-dimethylbutyl, 3,3-dimethylbutyl, 2,3-dimethylbutyl, 1,2-dimethylbutyl or 1,3-dimethylbutyl group, or an isomer thereof. Preferably, said group has 1, 2, 3 or 4 carbon atoms (C.sub.1-C.sub.4-alkyl), e.g., a methyl, ethyl, propyl, isopropyl, butyl, sec-butyl isobutyl, or tert-butyl group, more preferably 1, 2 or 3 carbon atoms (C.sub.1-C.sub.3-alkyl), e.g., a methyl, ethyl, n-propyl or isopropyl group.
(37) The terms C.sub.1-C.sub.4-alkoxy means a linear or branched, saturated, monovalent group of formula (C.sub.1-C.sub.4-alkyl)-O, in which the term C.sub.1-C.sub.4-alkyl is as defined supra, e.g., a methoxy, ethoxy, n-propoxy, isopropoxy, butoxy or an isomer thereof, preferably a methoxy-group or ethoxy-group.
(38) The term C.sub.3-C.sub.6-cycloalkyl means a saturated, monovalent, mono- or bicyclic hydrocarbon ring which contains 3, 4, 5 or 6 carbon atoms, respectively. Said C.sub.3-C.sub.6-cycloalkyl group may be for example, a monocyclic hydrocarbon ring, e.g., a cyclopropyl, cyclobutyl, cyclopentyl or cyclohexyl group, or a bicyclic hydrocarbon ring. The term 3- to 6-membered cycloalkyl is equivalent to a C.sub.3-C.sub.6-cycloalkyl. Thus a 4-membered cycloalkyl group has the same meaning as a C.sub.4-cycloalkyl group, and a C.sub.3-cycloalkyl is a cyclopropyl-group.
(39) The term 5- to 6-membered heterocycloalkyl means a monocyclic, saturated heterocycloalkyl with 5 or 6 ring atoms in total, respectively, which contains one or two identical or different ring heteroatoms from the series N, S or O. The heterocycloalkyl group may be attached to the rest of the molecule via any one of the carbon or nitrogen atoms. A heterocycloalkyl group which contains at least one ring nitrogen atom may be referred to as aza-heterocycloalkyl, and a heterocycloalkyl group which contains at least one ring oxygen atom may be referred to as oxa-heterocycloalkyl. Preferably, an aza-heterocycloalkyl group contains only nitrogen and carbon atoms in the ring, and an oxa-heterocycloalkyl group contains only ring oxygen and carbon atoms in the ring.
(40) Said heterocycloalkyl without being limited thereto, can be a 5-membered ring, such as tetrahydrofuranyl, 1,3-dioxolanyl, thiolanyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, 1,1-dioxidothiolanyl, 1,2-oxazolidinyl, 1,3-oxazolidinyl or 1,3-thiazolidinyl, for example; or a 6-membered ring, such as tetrahydropyranyl, tetrahydrothiopyranyl, piperidinyl, morpholinyl, dithianyl, thiomorpholinyl, piperazinyl, 1,3-dioxanyl, 1,4-dioxanyl or 1,2-oxazinanyl, for example.
(41) The term 5- to 10-membered heteroaryl, 5-membered heteroaryl, 6-membered heteroaryl, 7-membered heteroaryl, 8-membered heteroaryl, 9-membered heteroaryl, and 10-membered heteroaryl means a mono- or optionally bicyclic aromatic ring with 5 to 10, 5, 6, 7, 8, 9, or 10 ring atoms in total, respectively, which contains at least one ring heteroatom and optionally one, two or three further ring heteroatoms from the series: N, O and/or S, and which is attached to the rest of the molecule via a ring carbon atom or optionally via a ring nitrogen atom (if allowed by valency).
(42) The following representative heteroaryls may be mentioned by way of example: furyl, pyrrolyl, thienyl, pyrazolyl, imidazolyl, thiazolyl, oxazolyl, isoxazolyl, isothiazolyl, triazolyl, oxadiazolyl, thiadiazolyl, pyridyl, pyrimidinyl, pyridazinyl, pyrazinyl, triazinyl, benzofuranyl, benzothienyl, benzimidazolyl, benzoxazolyl, benzothiazolyl, benzotriazolyl, benzopyrazolyl, indolyl, indazolyl, quinolinyl, isoquinolinyl, naphthyridinyl, quinazolinyl, quinoxalinyl, phthalazinyl, and pyrazolo[3,4-b]pyridinyl,1,2,4-oxadiazolyl and 1,3,4-oxadiazolyl.
(43) 6-membered heteroaryl groups, such as, for example, pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl or triazinyl; or a tricyclic heteroaryl group, such as, for example, carbazolyl, acridinyl or phenazinyl.
(44) mono-(C.sub.1-C.sub.4)-alkylamino in the context of the invention means an amino group with one straight-chain or branched alkyl substituent which contains 1, 2, 3 or 4 carbon atoms, such as: methylamino, ethylamino, n-propylamino, isopropylamino, n-butylamino, and tert-butylamino, for example.
(45) di-(C.sub.1-C.sub.4)-alkylamino in the context of the invention means an amino group with two identical or different straight-chain or branched alkyl substituents which each contain 1, 2, 3 or 4 carbon atoms, such as: N,N-dimethylamino, N,N-diethylamino, N-ethyl-N-methylamino, N-methyl-N-n-propylamino, N-isopropyl-N-methylamino, N-isopropyl-N-n-propylamino, N,N-diisopropylamino, N-n-butyl-N-methylamino, and N-tert-butyl-N-methylamino, for example.
(46) (C.sub.1-C.sub.4)-Alkylcarbonyl in the context of the invention means a straight-chain or branched alkyl group having 1, 2, 3 or 4 carbon atoms which is bound to the rest of the molecule via a carbonyl group [C(O)], such as: acetyl, propionyl, n-butyryl, isobutyryl, n-pentanoyl, and pivaloyl, for example.
(47) (C.sub.1-C.sub.4)-alkylsulfonyl in the context of the invention means a group which is bound to the rest of the molecule via a sulfonyl group [S(O).sub.2] and which has one straight-chain or branched alkyl substituent having 1, 2, 3 or 4 carbon atoms, such as: methylsulfonyl, ethylsulfonyl, n-propylsulfonyl, isopropylsulfonyl, n-butylsulfonyl, and tert-butylsulfonyl, for example.
(48) An oxo substituent in the context of the invention means an oxygen atom which is bound to a carbon atom via a double bond.
(49) In general, and unless otherwise mentioned, the heteroaryl or heteroarylene groups include all possible isomeric forms thereof, e.g.: tautomers and positional isomers with respect to the point of linkage to the rest of the molecule. Thus, for some illustrative non-restricting examples, the term pyridinyl includes pyridin-2-yl, pyridin-3-yl and pyridin-4-yl; or the term thienyl includes thien-2-yl and thien-3-yl.
(50) The term C.sub.1-C.sub.4, as used in the present text, e.g., in the context of the definition of C.sub.1-C.sub.4-alkyl, C.sub.1-C.sub.4-alkoxy, or C.sub.1-C.sub.4-alkylsulfanyl, means an alkyl group having 1 to 4 carbon atoms, i.e., 1, 2, 3, or 4 carbon atoms.
(51) The term C.sub.1-C.sub.6, as used in the present text, e.g., in the context of the definition of C.sub.1-C.sub.6-alkyl, means an alkyl group having 1 to 6 carbon atoms, i.e., 1, 2, 3, 4, 5 or 6 carbon atoms.
(52) Further, as used herein, the term C.sub.3-C.sub.6, as used in the present text, e.g., in the context of the definition of C.sub.3-C.sub.6-cycloalkyl, means a cycloalkyl group having 3 to 6 carbon atoms, i.e., 3, 4, 5 or 6 carbon atoms.
(53) When a range of values is given, said range encompasses each value and sub-range within said range.
(54) For example:
(55) C.sub.1-C.sub.4 encompasses C.sub.1, C.sub.2, C.sub.3, C.sub.4, C.sub.1-C.sub.4, C.sub.1-C.sub.3, C.sub.1-C.sub.2, C.sub.2-C.sub.4, C.sub.2-C.sub.3, and C.sub.3-C.sub.4;
(56) C.sub.1-C.sub.3 encompasses C.sub.1, C.sub.2, C.sub.3, C.sub.1-C.sub.3, C.sub.1-C.sub.2, and C.sub.2-C.sub.3;
(57) C.sub.2-C.sub.4 encompasses C.sub.2, C.sub.3, C.sub.4, C.sub.2-C.sub.4, C.sub.2-C.sub.3, and C.sub.3-C.sub.4;
(58) C.sub.3-C.sub.6 encompasses C.sub.3, C.sub.4, C.sub.5, C.sub.6, C.sub.3-C.sub.6, C.sub.3-C.sub.5, C.sub.3-C.sub.4, C.sub.4-C.sub.6, C.sub.4-C.sub.5, and C.sub.5-C.sub.6;
(59) As used herein, the term leaving group means an atom or a group of atoms that is displaced in a chemical reaction as stable species taking with it the bonding electrons. Preferred such leaving groups include halide (e.g., fluoride, chloride, bromide or iodide), and sulfonate (e.g., (methylsulfonyl)oxy (mesyl(ate), Ms), [(trifluoromethyl)sulfonyl]oxy (triflyl/(ate), Tf), [(nonafluoro-butyl)sulfonyl]oxy (nonaflate, Nf), (phenylsulfonyl)oxy, [(4-methylphenyl)sulfonyl]oxy, [(4-bromo-phenyl)sulfonyl]oxy, [(4-nitrophenyl)sulfonyl]oxy, [(2-nitrophenyl)sulfonyl]oxy, [(4-isopropyl-phenyl)sulfonyl]oxy, [(2,4,6-triisopropylphenyl)sulfonyl]oxy, [(2,4,6-trimethylphenyl)sulfonyl]oxy, [(4-tert-butylphenyl)sulfonyl]oxy and [(4-methoxyphenyl)sulfonyl]oxy).
(60) It is possible for the compounds of general formula (I) to exist as isotopic variants. The invention therefore includes one or more isotopic variant(s) of the compounds of general formula (I), particularly deuterium-containing compounds of general formula (I).
(61) The term Isotopic variant of a compound or a reagent is defined as a compound exhibiting an unnatural proportion of one or more of the isotopes of the atoms that constitute such a compound.
(62) The term Isotopic variant of the compound of general formula (I) is defined as a compound of general formula (I) exhibiting an unnatural proportion of one or more of the isotopes of the atoms that constitute such a compound.
(63) The expression unnatural proportion means a proportion of such isotope which is higher than its natural abundance. The natural abundances of isotopes to be applied in this context are described in Isotopic Compositions of the Elements 1997, Pure Appl. Chem., 70(1), 217-235, 1998.
(64) Examples of such isotopes include stable and radioactive isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine, chlorine, bromine and iodine, such as .sup.2H (deuterium), .sup.3H (tritium), .sup.11C, .sup.13C, .sup.14C, .sup.15N, .sup.17O, .sup.18O, .sup.32P, .sup.33P, .sup.33S, .sup.34S, .sup.35S, .sup.36S, .sup.18F, .sup.36Cl, .sup.82Br, .sup.123I, .sup.124I, .sup.125I, .sup.129I and .sup.131I, respectively.
(65) With respect to the treatment and/or prophylaxis of the disorders specified herein, isotopic variant(s) of the compounds of general formula (I) preferably contain elevated levels of deuterium (deuterium-containing compounds of general formula (I)). Isotopic variants of the compounds of general formula (I) in which one or more radioactive isotopes, such as .sup.3H or .sup.14C, are incorporated are useful, e.g., in drug and/or substrate tissue distribution studies. These isotopes are particularly preferred for the ease of their incorporation and detectability. Positron-emitting isotopes such as .sup.18F or .sup.11C may be incorporated into a compound of general formula (I). These isotopic variants of the compounds of general formula (I) are useful for in vivo imaging applications. Deuterium-containing and .sup.13C-containing compounds of general formula (I) can be used in mass spectrometry analyses in the context of preclinical or clinical studies.
(66) Isotopic variants of the compounds of general formula (I) can generally be prepared by methods known to a person skilled in the art, such as those described in the schemes and/or examples herein, e.g., by substituting a reagent for an isotopic variant of said reagent, preferably for a deuterium-containing reagent. Depending on the desired sites of deuteration, in some cases deuterium from D.sub.2O can be incorporated either directly into the compounds or into reagents that are useful for synthesizing such compounds (Esaki et al., Tetrahedron, 2006, 62, 10954; Esaki et al., Chem. Eur. J., 2007, 13, 4052). Deuterium gas is also a useful reagent for incorporating deuterium into molecules. Catalytic deuteration of olefinic bonds (H. J. Leis et al., Curr. Org. Chem., 1998, 2, 131; J. R. Morandi et al., J. Org. Chem., 1969, 34 (6), 1889) and acetylenic bonds (N. H. Khan, J. Am. Chem. Soc., 1952, 74 (12), 3018; S. Chandrasekhar et al., Tetrahedron Letters, 2011, 52, 3865) is a rapid route for incorporation of deuterium. Metal catalysts (e.g., Pd, Pt, and Rh) in the presence of deuterium gas can be used to directly exchange deuterium for hydrogen in functional groups containing hydrocarbons (J. G. Atkinson et al., U.S. Pat. No. 3,966,781). A variety of deuterated reagents and synthetic building blocks are commercially available from companies such as for example C/D/N Isotopes, Quebec, Canada; Cambridge Isotope Laboratories Inc., Andover, MA, USA; and CombiPhos Catalysts, Inc., Princeton, NJ, USA. Further information on the state of the art with respect to deuterium-hydrogen exchange is given for example in Hanzlik et al., J. Org. Chem. 55, 3992-3997, 1990; R. P. Hanzlik et al., Biochem. Biophys. Res. Commun. 160,844,1989; P. J. Reideretal., J. Org. Chem. 52, 3326-3334, 1987; M. Jarman et al., Carcinogenesis 16 (4), 683-688, 1995; J. Atzrodt et al., Angew. Chem., Int. Ed. 2007, 46, 7744; K. Matoishi et al., Chem. Commun. 2000, 1519-1520; K. Kassahun et al., WO2012/112363.
(67) The term deuterium-containing compound of general formula (I) is defined as a compound of general formula (I), in which one or more hydrogen atom(s) is/are replaced by one or more deuterium atom(s) and in which the abundance of deuterium at each deuterated position of the compound of general formula (I) is higher than the natural abundance of deuterium, which is about 0.015%. Particularly, in a deuterium-containing compound of general formula (I) the abundance of deuterium at each deuterated position of the compound of general formula (I) is higher than 10%, 20%, 30%, 40%, 50%, 60%, 70% or 80%, preferably higher than 90%, 95%, 96% or 97%, even more preferably higher than 98% or 99% at said position(s). It is understood that the abundance of deuterium at each deuterated position is independent of the abundance of deuterium at other deuterated position(s).
(68) The selective incorporation of one or more deuterium atom(s) into a compound of general formula (I) may alter the physicochemical properties (such as for example acidity [C. L. Perrin, et al., J. Am. Chem. Soc., 2007, 129, 4490; A. Streitwieser et al., J. Am. Chem. Soc., 1963, 85, 2759;], basicity [C. L. Perrin et al., J. Am. Chem. Soc., 2005, 127, 9641; C. L. Perrin, et al., J. Am. Chem. Soc., 2003, 125, 15008; C. L. Perrin in Advances in Physical Organic Chemistry, 44, 144], lipophilicity [B. Testa et al., Int. J. Pharm., 1984, 19(3), 271]) and/or the metabolic profile of the molecule and may result in changes in the ratio of parent compound to metabolites or in the amounts of metabolites formed. Such changes may result in certain therapeutic advantages and hence may be preferred in some circumstances. Reduced rates of metabolism and metabolic switching, where the ratio of metabolites is changed, have been reported (A. E. Mutlib et al., Toxicol. Appl. Pharmacol., 2000, 169, 102; D. J. Kushner et al., Can. J. Physiol. Pharmacol., 1999, 77, 79). These changes in the exposure to parent drug and metabolites can have important consequences with respect to the pharmacodynamics, tolerability and efficacy of a deuterium-containing compound of general formula (I). In some cases deuterium substitution reduces or eliminates the formation of an undesired or toxic metabolite and/or enhances the formation of a desired metabolite (e.g., Nevirapine: A. M. Sharma et al., Chem. Res. Toxicol., 2013, 26, 410; Efavirenz: A. E. Mutlib et al., Toxicol. Appl. Pharmacol., 2000, 169, 102). In other cases the major effect of deuteration is to reduce the rate of systemic clearance. As a result, the biological half-life of the compound is increased. The potential clinical benefits would include the ability to maintain similar systemic exposure with decreased peak levels and increased trough levels, i.e., reduced peak-trough variation. This could result in lowerside effects and/or enhanced efficacy, depending on the particular compound's pharmacokinetic/pharmacodynamic relationship. ML-337 (C. J. Wenthur et al., J. Med. Chem., 2013, 56, 5208) and Odanacatib (K. Kassahun et al., WO2012/112363) are examples of this deuterium effect. Still other cases have been reported in which reduced rates of metabolism result in an increase in exposure of the drug without changing the rate of systemic clearance (e.g., Rofecoxib: F. Schneider et al., Arzneim. Forsch./Drug. Res., 2006, 56, 295; Telaprevir: F. Maltais et al., J. Med. Chem., 2009, 52, 7993). Deuterated drugs showing this effect may have reduced dosing requirements (e.g., lower number of doses or lower dosage to achieve the desired effect) and/or may produce lower metabolite loads.
(69) A compound of general formula (I) may have multiple potential sites of attack for metabolism. To optimize the above-described effects on physicochemical properties and metabolic profile, deuterium-containing compounds of general formula (I) having a certain pattern of one or more deuterium-hydrogen exchange(s) can be selected. Particularly, the deuterium atom(s) of deuterium-containing compound(s) of general formula (I) is/are attached to a carbon atom and/or is/are located at those positions of the compound of general formula (I) which are sites of attack for metabolizing enzymes such as, e.g., cytochrome P.sub.450.
(70) In certain embodiments, the present invention concerns a deuterium-containing compound of general formula (I) having 1, 2, 3 or 4 deuterium atoms (i.e., 1, 2, 3, or 4 sites where the isotopic balance of hydrogen is enriched for deuterium), preferably with 1, 2 or 3 deuterium atoms.
(71) Where the plural form of the word compounds, salts, polymorphs, hydrates, solvates and the like, is used herein, this is taken to include also a single compound, salt, polymorph, isomer, hydrate, solvate or the like.
(72) By stable compound or stable structure is meant a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and is capable of being subjected to further chemical transformation or, preferably, formulation into an efficacious therapeutic agent.
(73) The compounds of the present invention optionally contain one or more asymmetric centres, depending upon the location and nature of the various substituents desired. It is possible that one or more asymmetric carbon atoms are present in the (R) or (S) configuration, which can result in racemic mixtures in the case of a single asymmetric centre, and in diastereomeric mixtures in the case of multiple asymmetric centres. In certain instances, it is possible that asymmetry also be present due to restricted rotation about a given bond, for example, the central bond adjoining two substituted aromatic rings of the specified compounds (i.e., atropisomers).
(74) Preferred compounds are those which produce the more desirable biological activity. Separated, pure or partially purified isomers and stereoisomers or racemic or diastereomeric mixtures of the compounds of the present invention are also included within the scope of the present invention. The purification and the separation of such materials can be accomplished by standard techniques known in the art.
(75) Separated optical isomers can be obtained by resolution of the racemic mixtures according to conventional processes, for example, by the formation of diastereoisomeric salts using an optically active acid or base or formation of covalent diastereomers. Examples of appropriate acids are tartaric, diacetyltartaric, ditoluoyltartaric and camphorsulfonic acid. Mixtures of diastereoisomers can be separated into their individual diastereomers on the basis of their physical and/or chemical differences by methods known in the art, for example, by chromatography or fractional crystallisation. The optically active bases or acids are then liberated from the separated diastereomeric salts. A different process for separation of optical isomers involves the use of chiral chromatography (e.g., HPLC columns using a chiral phase), with or without conventional derivatisation, optimally chosen to maximise the separation of the enantiomers. Suitable HPLC columns using a chiral phase are commercially available, such as those manufactured by Daicel, e.g., Chiracel OD and Chiracel OJ, for example, among many others, which are all routinely selectable. Enzymatic separations, with or without derivatisation, are also useful. The optically active compounds of the present invention can likewise be obtained by chiral syntheses utilizing optically active starting materials or optically active catalysts. +
(76) In order to distinguish different types of isomers from each other, reference is made to IUPAC Rules Section E (Pure Appl Chem 45, 11-30, 1976).
(77) The present invention includes all possible stereoisomers of the compounds of the present invention as single stereoisomers, or as any mixture of said stereoisomers, e.g., (R)- or (S)-isomers, in any ratio. Isolation of a single stereoisomer, e.g., a single enantiomer or a single diastereomer, of a compound of the present invention is achieved by any suitable state of the art method, such as chromatography, especially chiral chromatography, for example.
(78) Further, it is possible for the compounds of the present invention to exist as tautomers. For example, a compound of the present invention which contains an imidazopyridine moiety as a heteroaryl group for example can exist as a 1H tautomer, or a3H tautomer, or even a mixture in any amount of the two tautomers, namely:
(79) ##STR00003##
(80) Moreover, in the course of the synthesis of a 1H-pyrazole group, the 1H-pyrazol-3-yl tautomer as well as the 1H-pyrazol-5-yl tautomer are formed.
(81) ##STR00004##
(82) The present invention includes all possible tautomers of the compounds of the present invention as single tautomers, or as any mixture of said tautomers, in any ratio.
(83) The present invention also covers useful forms of the compounds of the present invention, such as metabolites, hydrates, solvates, prodrugs, salts, in particular pharmaceutically acceptable salts, and/or co-precipitates.
(84) The compounds of the present invention can exist as a hydrate, or as a solvate, wherein the compounds of the present invention contain polar solvents, preferably water, methanol or ethanol, for example, as a structural element of the crystal lattice of the compounds. It is possible for the amount of polar solvents, in particular water, to exist in a stoichiometric or non-stoichiometric ratio. In the case of stoichiometric solvates, e.g., a hydrate, hemi-, (semi-), mono-, sesqui-, di-, tri-, tetra-, penta- etc. solvates or hydrates, respectively, are possible. The present invention includes all such hydrates or solvates.
(85) Further, it is possible for the compounds of the present invention to exist in free form, e.g., as a free base, or as a free acid, or as a zwitterion, or to exist in the form of a salt, preferably as a free acid. Said salt may be any salt, either an organic or inorganic addition salt, particularly any pharmaceutically acceptable organic or inorganic addition salt, which is customarily used in pharmacy, or which is used, for example, for isolating or purifying the compounds of the present invention.
(86) The term pharmaceutically acceptable salt refers to an inorganic or organic acid addition salt of a compound of the present invention. For example, see S. M. Berge, et al. Pharmaceutical Salts, J. Pharm. Sci. 1977, 66, 1-19.
(87) A suitable pharmaceutically acceptable salt of the compounds of the present invention may be, for example, an acid-addition salt of a compound of the present invention bearing a nitrogen atom, in a chain or in a ring, for example, which is sufficiently basic, such as an acid-addition salt with an inorganic acid, or mineral acid, such as hydrochloric, hydrobromic, hydroiodic, sulfuric, sulfamic, bisulfuric, phosphoric, or nitric acid, for example, or with an organic acid, such as formic, acetic, acetoacetic, pyruvic, trifluoroacetic, propionic, butyric, hexanoic, heptanoic, undecanoic, lauric, benzoic, salicylic, 2-(4-hydroxybenzoyl)-benzoic, camphoric, cinnamic, cyclopentanepropionic, digluconic, 3-hydroxy-2-naphthoic, nicotinic, pamoic, pectinic, 3-phenylpropionic, pivalic, 2-hydroxyethanesulfonic, itaconic, trifluoromethanesulfonic, dodecylsulfuric, ethanesulfonic, benzenesulfonic, para- toluenesulfonic, methanesulfonic, 2-naphthalenesulfonic, naphthalinedisulfonic, camphorsulfonic acid, citric, tartaric, stearic, lactic, oxalic, malonic, succinic, malic, adipic, alginic, maleic, fumaric, D-gluconic, mandelic, ascorbic, glucoheptanoic, glycerophosphoric, aspartic, sulfosalicylic, or thio cyanic acid, for example.
(88) Further, another suitably pharmaceutically acceptable salt of a compound of the present invention which is sufficiently acidic, is an alkali metal salt, for example a sodium or potassium salt, an alkaline earth metal salt, for example a calcium, magnesium or strontium salt, or an aluminium or a zinc salt, or an ammonium salt derived from ammonia or from an organic primary, secondary or tertiary amine having 1 to 20 carbon atoms, such as ethylamine, diethylamine, triethylamine, ethyldiisopropylamine, monoethanolamine, diethanolamine, triethanolamine, dicyclohexylamine, dimethylaminoethanol, diethylaminoethanol, tris(hydroxymethyl)aminomethane, procaine, dibenzylamine, N-methylmorpholine, arginine, lysine, 1,2-ethylenediamine, N-methylpiperidine, N-methyl-glucamine, N,N-dimethyl-glucamine, N-ethyl-glucamine, 1,6-hexanediamine, glucosamine, sarcosine, serinol, 2-amino-1,3-propanediol, 3-amino-1,2-propanediol, 4-amino-1,2,3-butanetriol, or a salt with a quaternary ammonium ion having 1 to 20 carbon atoms, such as tetramethylammonium, tetraethylammonium, tetra(n-propyl)ammonium, tetra(n-butyl)ammonium, N-benzyl-N,N,N-trimethylammonium, choline or benzalkonium.
(89) In accordance with preferred embodiments of the first aspect, the present invention covers a pharmaceutically acceptable salt of compounds of general formula (I), supra, which is an alkali metal salt, in particular a sodium or potassium salt, or an ammonium salt derived from an organic tertiary amine, in particular choline.
(90) Those skilled in the art will further recognise that it is possible for acid addition salts of the claimed compounds to be prepared by reaction of the compounds with the appropriate inorganic or organic acid via any of a number of known methods. Alternatively, alkali and alkaline earth metal salts of acidic compounds of the present invention are prepared by reacting the compounds of the present invention with the appropriate base via a variety of known methods.
(91) The present invention includes all possible salts of the compounds of the present invention as single salts, or as any mixture of said salts, in any ratio.
(92) In the present text, in particular in the Experimental Section, for the synthesis of intermediates and of examples of the present invention, when a compound is mentioned as a salt form with the corresponding base or acid, the exact stoichiometric composition of said salt form, as obtained by the respective preparation and/or purification process, is, in most cases, unknown.
(93) Unless specified otherwise, suffixes to chemical names or structural formulae relating to salts, such as hydrochloride, trifluoroacetate, sodium salt, or x HCl, x CF.sub.3COOH, x Na, for example, mean a salt form, the stoichiometry of which salt form not being specified.
(94) This applies analogously to cases in which synthesis intermediates or example compounds or salts thereof have been obtained, by the preparation and/or purification processes described, as solvates, such as hydrates, with (if defined) unknown stoichiometric composition.
(95) As used herein, the term in vivo hydrolysable ester means an in vivo hydrolysable ester of a compound of the present invention containing a carboxy or hydroxy group, for example, a pharmaceutically acceptable ester which is hydrolysed in the human or animal body to produce the parent acid or alcohol. Suitable pharmaceutically acceptable esters for carboxy include for example alkyl, cycloalkyl and optionally substituted phenylalkyl, in particular benzyl esters, C.sub.1-C.sub.6 alkoxymethyl esters, e.g., methoxymethyl, C.sub.1-C.sub.6 alkanoyloxymethyl esters, e.g., pivaloyloxymethyl, phthalidyl esters, C.sub.3-C.sub.8 cycloalkoxy-carbonyloxy-C.sub.1-C.sub.6 alkyl esters, e.g. 1-cyclohexylcarbonyloxyethyl; 1,3-dioxolen-2-onylmethyl esters, e.g., 5-methyl-1,3-dioxolen-2-onylmethyl; and C.sub.1-C.sub.6-alkoxycarbonyloxyethyl esters, e.g., 1-methoxycarbonyloxyethyl, it being possible for said esters to be formed at any carboxy group in the compounds of the present invention.
(96) An in vivo hydrolysable ester of a compound of the present invention containing a hydroxy group includes inorganic esters such as phosphate esters and [alpha]-acyloxyalkyl ethers and related compounds which as a result of the in vivo hydrolysis of the ester breakdown to give the parent hydroxy group. Examples of [alpha]-acyloxyalkyl ethers include acetoxymethoxy and 2,2-dimethylpropionyloxymethoxy. A selection of in vivo hydrolysable ester forming groups for hydroxy include alkanoyl, benzoyl, phenylacetyl and substituted benzoyl and phenylacetyl, alkoxycarbonyl (to give alkyl carbonate esters), dialkylcarbamoyl and N-(dialkylaminoethyl)-N-alkylcarbamoyl (to give carbamates), dialkylaminoacetyl and carboxyacetyl. The present invention covers all such esters.
(97) Furthermore, the present invention includes all possible crystalline forms, or polymorphs, of the compounds of the present invention, either as single polymorph, or as a mixture of more than one polymorph, in any ratio.
(98) Moreover, the present invention also includes prodrugs of the compounds according to the invention. The term prodrugs here designates compounds which themselves can be biologically active or inactive, but are converted (for example metabolically or hydrolytically) into compounds according to the invention during their residence time in the body. Typical examples of prodrugs would be e.g. esters.
(99) Preference is given to compounds of formula (I) in which R.sup.1 represents a group selected from hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl and phenyl wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, and 5- to 10-membered heteroaryl, and phenyl are optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms R.sup.2 represents a group independently selected from hydrogen cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl(C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-04)-alkoxy each is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms. R.sup.3 and R.sup.4 represent hydrogen and R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent a group independently selected from hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy each is optionally independently substituted with up to five fluorine atoms, X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6, represent N or C with the provisio that in each ring system maximal one X stands for N and R.sup.5, R.sup.6, R.sup.7 and R.sup.8 are present provided that the designated atom's normal valency under the existing circumstances is not exceeded
and pharmaceutically acceptable salts thereof, solvates thereof and the solvates of the salts thereof.
(100) In certain such embodiments, R.sup.1 is a 5- to 6-membered heteroaryl, optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms.
(101) Preference is further given to compounds of the formula (I) in which R.sup.1 represents a group selected from hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl and phenyl wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, and 5- to 10-membered heteroaryl, and phenyl are optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms R.sup.2 represents a group independently selected from hydrogen cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl(C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-04)-alkoxy each is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms. R.sup.3, R.sup.4, R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent a group independently selected from hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy each is optionally independently substituted with up to five fluorine atoms, with the provision that at least two from R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent hydrogen, X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6, represent N or C with the provisio that in each ring system maximal one X stands for N and R.sup.5, R.sup.6, R.sup.7 and R.sup.8 are present provided that the designated atom's normal valency under the existing circumstances is not exceeded.
(102) and pharmaceutically acceptable salts thereof, solvates thereof and the solvates of the salts thereof.
(103) In certain such embodiments, R.sup.1 is a 5- to 6-membered heteroaryl, optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms.
(104) Preference is given to compounds of the formula (Ia), (Ib), (Ic), (Id) and (Ie)
(105) ##STR00005##
(106) In which R.sup.1 represents a group selected from hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl and phenyl wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, and 5- to 10-membered heteroaryl, phenyl are optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms R.sup.2 represents a group independently selected from hydrogen cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl(C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-04)-alkoxy each is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms. R.sup.3, R.sup.4, R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent a group independently selected from hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy each is optionally independently substituted with up to five fluorine atoms, with the provision that at least two from R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent hydrogen,
and pharmaceutically acceptable salts thereof, solvates thereof and the solvates of the salts thereof.
(107) In certain such embodiments, R.sup.1 is a 5- to 6-membered heteroaryl, optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms.
(108) Preference is given to compounds of the formula (I) selected from the group consisting of ent-6-fluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(109) ##STR00006## ent-5,6-difluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(110) ##STR00007## ent-4-chloro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}[biphenyl]-2-carboxamide
(111) ##STR00008## ent-4-chloro-5-fluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}[biphenyl]-2-carboxamide
(112) ##STR00009## ent-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(113) ##STR00010## ent-4,5-difluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(114) ##STR00011## ent-N-{[4-(4-methyl-1,2-oxazol-3-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(115) ##STR00012## Preference is also given to compounds of formula (I) in which R.sup.1 represents cyclopropyl, cyclobutyl, isopropyl, t-butyl, cyclopentyl or methylimidazole, methylpyrazole, oxazole, oxadiazole, trifluorethylpyrazole, difluormethylpyrazole, isoxazole, thiazole. Particular preference is also given to compounds of formula (I) in which R.sup.1 represents methylpyrazole, cyclopropyl. Preference is also given to compounds of formula (1) in which R.sup.2 represents methyl, trifluormethyl, trifluormethoxy, cyclopropyl, cyclobutyl, difluorethyl, difluorcyclopropyl, difluormethyl, difluorcyclopropyl, methylsulfonyl, cyanopropanyl, cyano, chloro, t-butyl and ethyl. Particular preference is also given to compounds of formula (I) in which R.sup.2 represents trifluormethyl, difluorcyclopropyl. Preference is also given to compounds of formula (I) in which only X.sup.1 represents N and X.sup.2, X.sup.3, X.sup.4, X.sup.5 and X.sup.6 represent C. Preference is also given to compounds of formula (I) in which only X.sup.2 represents N and X.sup.1, X.sup.3, X.sup.4, X.sup.5 and X.sup.6 represent C. Preference is also given to compounds of formula (I) in which only X.sup.3 represents N and X.sup.2, X.sup.1, X.sup.4, X.sup.5 and X.sup.6 represent C. Preference is also given to compounds of formula (I) in which only X.sup.4 represents N and X.sup.2, X.sup.3, X.sup.1, X.sup.5 and X.sup.6 represent C.
(116) Particular preference is also given to compounds of formula (Ib).
(117) Preference is also given to compounds of formula (Ib) in which at least one of R.sup.3 and R.sup.4 represents hydrogen.
(118) Preference is also given to compounds of formula (Ib) in which at least one of R.sup.5 R.sup.7 and Ra represents hydrogen.
(119) Particular preference is also given to compounds of formula (Ic).
(120) Preference is also given to compounds of formula (Ic) in which at least one of R.sup.3 and R.sup.4 represents hydrogen.
(121) Preference is also given to compounds of formula (Ic) in which at least one of R.sup.6 and R.sup.7 represents hydrogen.
(122) Particular preference is also given to compounds of formula (Id).
(123) Preference is also given to compounds of formula (Id) in which at least one of R.sup.3 and R.sup.4 represents hydrogen.
(124) Preference is also given to compounds of formula (Id) in which at least two of R.sup.5 R.sup.6 R.sup.7 and Ra represent hydrogen.
(125) Particular preference is also given to compounds of formula (Ie).
(126) Preference is also given to compounds of formula (Ie) in which at least one of R.sup.3 and R.sup.4 represents hydrogen.
(127) Preference is also given to compounds of formula (Ie) in which at least two of R.sup.5 R.sup.6 R.sup.7 and R.sup.8 represent hydrogen.
(128) Particular preference is also given to compounds of formula (Ia). Particular preference is given to compounds of formula (Ia) in which R.sup.2 represents trifluormethane, difluorcyclopropane. Particular preference is given to compounds of formula (Ia) in which R.sup.1 represents methylpyrazole, cyclopropane. Particular preference is given to compounds of formula (Ia) in which R.sup.5 and R.sup.6 represent fluoro or R.sup.5 represents fluoro.
(129) Another object of the present invention is a process for the preparation of the compounds of formula (I) characterized by reacting a compound of formula (II)
(130) ##STR00013##
in which R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 have the meaning given above, in an inert solvent with a condensing agent such as 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride in the presence of a base such as N,N-diisopropylethylamine and an auxiliary reagent such as HOBt with a compound of formula (III) which may be used as salt (e.g. hydrochloride)
(131) ##STR00014##
in which R.sub.1 has the meaning given above.
(132) Inert solvents for process step (II)+(III).fwdarw.(I) are, for example, halogenated hydrocarbons, such as dichloromethane, trichlorethylene, chloroform orchlorobenzene, ethers, such as diethyl ether, dioxane, tetrahydrofuran, 1,2-dimethoxyethane or diglyme, hydrocarbons such as benzene, toluene, xylene, hexane, cyclohexane or petroleum fractions or other solvents such as acetonitrile, N,N-dimethylformamide, N,N-dimethylacetamide, dimethyl sulfoxide, N,N-dimethylpropyleneurea (DMPU), N-methyl-2-pyrrolidone (NMP) or pyridine. It is also possible to use mixtures of the said solvents. Preference is given to using dichloromethane or N,N-dimethylformamide. Dichloromethane is particularly preferably used.
(133) Suitable condensing agents for amide formation in process step (II)+(III).fwdarw.(I) are, for example, carbodiimides such as N,N-diethyl-, N,N-dipropyl-, N,N-diisopropyl-, N,N-dicyclohexylcarbodiimide (DCC) or N-(3-dimethylamino-propyl)-N-ethylcarbodiimide hydrochloride (EDC), phosgene derivatives such as N,N-carbonyldiimidazole (CDI), 1,2-oxazolium compounds such as 2-ethyl-5-phenyl-1,2-oxazolium-3-sulfate or 2-tert-butyl-5-methyl-isoxazolinium perchlorate, acylamino compounds such as 2-ethoxy-1-ethoxy-carbonyl-1,2-dihydrohydroquinoline, or isobutyl chloroformate, propanephosphonic acid anhydride (T3P), 1-chloro-N,N,2-trimethylprop-1-en-1-amine, cyanophosphonic acid diethyl ester, (2-oxo-3-oxazolidinyl)-phosphoryl chloride, benzotriazazol-1-yloxy-tris(dimethylamino) phosphonium-hexafluorophosphate, benzotriazol-1-yl-oxytripyrrolidinophosphonium hexafluorophosphate (PyBOP), 2-(1H-Benzotriazole-1-yl)-1,1,3,3-tetramethylaminium tetrafluoroborate (TBTU), 2-(1H-benzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate (HBTU), 0-(1,2-Dihydro-2-oxo-1-pyridyl)-N,N,NN-tetramethyluronium tetrafluoroborate (TPTU), 1-[Bis(dimethylamino)methylene]-1H-1,2,3-triazolo[4,5-b]pyridinium 3-oxid hexafluorophosphate (HATU) or O-(6-Chloro-1-hydrocibenzotriazol-1-yl)-1,1,3,3-tetramethyluroniumtetrafluoroborate (TCTU), if appropriate in combination with other excipients such as 1 hydroxybenzotriazole (HOBt), 1-hydroxy-7-azabenzotriazole (HOAt) or N-hydroxysuccinimide (HOSu). Preferably EDC and HATU is used. Particular preference is given to using EDC.
(134) Suitable bases for amide formation in process step (II)+(III).fwdarw.(I) are, for example, alkali metal carbonates, e.g. sodium or potassium carbonate or hydrogen carbonate, or organic bases such as trialkylamines, e.g. triethylamine (TEA), trimethylamine, N methylmorpholine, N-methylpiperidine or N,N-diisopropylethylamine (DIPEA) or 4-(dimethylamino) pyridine (DMAP). Preferably, DIPEA, trimethylamine and TEA are used. Particular preference is given to using DIPEA.
(135) The condensations (II)+(III).fwdarw.(I) is generally carried out in a temperature range from 20 C. to +100 C., preferably at 0 C. to +60 C. The reaction can be carried out at normal, elevated or reduced pressure (for example from 0.5 to 5 bar). In general, one works at room temperature and normal pressure.
(136) Alternatively, the carboxylic acid of the formula (II) can also first be converted into the corresponding carboxylic acid chloride and then reacted directly or in a separate reaction with a compound of the formula (III) to give the compounds according to the invention. The formation of carboxylic acid chlorides from carboxylic acids is carried out by the methods known to those skilled in the art, for example by treating (II) or the corresponding carboxylate with thionyl chloride, sulfuryl chloride or oxalyl chloride in the presence of a suitable base, for example in the presence of pyridine, and optionally with the addition of dimethylformamide, optionally in a suitable inert solvent.
(137) The compounds used are commercially available, known from the literature or can be prepared analogously to processes known from the literature.
(138) The general procedure is exemplified by the scheme below (Scheme 1)
(139) ##STR00015##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(140) Amines of the formula (III) can be prepared by the process exemplified in Scheme 2
(141) ##STR00016##
wherein R.sub.1 is as defined above.
(142) Another alternative process variant is shown in Scheme 3
(143) ##STR00017##
wherein R.sub.1 is as defined above.
(144) Another alternative process variant is shown in Scheme 4
(145) ##STR00018##
wherein R.sub.1 is as defined above.
(146) Another alternative process variant is shown in Scheme 5
(147) ##STR00019##
wherein R.sub.1 is as defined above.
(148) Another alternative process variant is shown in Scheme 6
(149) ##STR00020##
(150) Another alternative process variant is shown in Scheme 7
(151) ##STR00021##
(152) Another alternative process variant is shown in Scheme 8
(153) ##STR00022##
wherein R.sub.1 is as defined above.
(154) A process variant for the preparation of compounds of formula (I) is shown in Scheme 9
(155) ##STR00023##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(156) Another object of the invention is a process for the preparation of the compounds of formula (II)
(157) ##STR00024##
prepared by suzuki-reaction between a boronic acid or a corresponding boronic ester and a bromoaromatic, in which R2, R3, R4, R5, R6, R7, R8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 have the meaning given above. The reaction is carried out in an inert solvent with a catalyst in the present of a base and, if necessary, a ligand.
(158) Inert solvents for this process step are, for example, DME, 1,4-dioxane, THF, DMF, toluene, n-propanol or 1-butanol. It is also possible to use mixtures of the said solvents. Preference is given to using DME.
(159) Suitable catalysts are, for example, bis(triphenylposphine)palladium(II)chloride PdCl.sub.2(PPh.sub.3).sub.2, tetrakis(triphenylphosphine)palladium(0) Pd(PPh.sub.3).sub.4, [1,1-bis(diphenylphosphino)ferrocene]palladium(II)dichloride Pd(dppf)Cl.sub.2, palladium(II)acetate Pd(OAc).sub.2 or tris(dibenzylideneacetone)dipalladium(0) Pd.sub.2(dba).sub.3. Preferably Pd(PPh.sub.3).sub.4 and PdCl.sub.2(PPh.sub.3).sub.2 are used. Particular preference is given using PdCl.sub.2(PPh.sub.3).sub.2.
(160) For example and if necessary dicyclohexyl[2,4,6-tri(propan-2-yl)biphenyl-2-yl]phosphane (XPhos) is used as ligand.
(161) Suitable bases are, for example, aqueous solutions of sodium carbonate (Na.sub.2CO.sub.3), sodium bicarbonate (NaHCO.sub.3), potassium fluoride (KF), potassium phosphate (K.sub.3PO.sub.4), potassium carbonate (K.sub.2CO.sub.3) or cesium fluoride (CsF). Organic bases like triethylamine (Et.sub.3N) or diisopropylethylamine (DIPEA) could also be used. Preferably a2M aqueous solution of sodium carbonate is used.
(162) The Suzuki reaction is generally carried out in a temperature range from RT to +200 C., preferably in a temperature range from 80 C. to 90 C. under an argon atmosphere. The reaction can be carried out at normal, elevated or reduced pressure (for example from 0.5 to 5 bar). In general, one works at normal pressure.
(163) If carboxylic acid esters were used in the suzuki-reaction they must be converted into the carboxylic acids bevor they can be used in the next step. For this, the carboxylic acid esters are dissolved in an organic solvent like THE and treated with an aqueous solution of an alkali metal hydroxide like lithium hydroxide or an acid like hydrochloric acid in case of tert.butyl esters.
(164) The compounds used are commercially available, known from the literature or can be prepared analogously to processes known from the literature.
(165) Acids of formula (II) can be prepared by the method exemplified in Scheme 10
(166) ##STR00025##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(167) An alternative process variant is shown in Scheme 11
(168) ##STR00026##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(169) Another alternative process variant is shown in Scheme 12
(170) ##STR00027##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(171) Another alternative process variant is shown in Scheme 13
(172) ##STR00028##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(173) Another alternative process variant is shown in Scheme 14
(174) ##STR00029##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(175) Another alternative process variant is shown in Scheme 15
(176) ##STR00030##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(177) Another alternative process variant is shown in Scheme 16
(178) ##STR00031##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(179) Another alternative process variant is shown in Scheme 17
(180) ##STR00032##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(181) Another alternative process variant is shown in Scheme 18
(182) ##STR00033##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(183) Another alternative process variant is shown in Scheme 19
(184) ##STR00034##
wherein R.sub.2, R.sub.3, R.sub.4, R.sub.5, R.sub.6, R.sub.7, R.sub.8 and X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6 are as defined above.
(185) Another object of the invention is a process for the preparation of hydantoins (III)
(186) ##STR00035##
in which R.sub.1 has the meaning given above.
(187) Hydantoins can be prepared by reacting a for example BOC or Z protected -amino ketone or aldehyde with a mixture of ammonium carbonate, alkali cyanide like potassium cyanide in ethanol and water, preferably in a sealed flask. In some cases ammonium chloride is added to the mixture as well. Instead of ethanol, methanal may be used. Example processes are shown in scheme 2, scheme 3, scheme 4, scheme 5, scheme 6, scheme 7, scheme 8 and scheme 9.
(188) The reaction is generally carried out at a temperature between room temperature and 200 C. Preferably a temperature between 40 C. to 80 C. is used. The reaction can be performed at normal pressure. Preferably the reaction is performed in a sealed flask.
(189) The compounds used are commercially available, known from the literature or can be prepared analogously to processes known from the literature.
(190) Detailed instructions are also to be found in the experimental part in the section for preparing the starting compounds and intermediates.
(191) Compounds of the current invention possess valuable pharmacological properties and can be used for the treatment and/or prophylaxis of diseases/disease state affecting human beings and animals.
(192) Compounds concerning the present invention are potent, chemically stable antagonists of the ADAMTS7 metalloprotease and are suited for the treatment and/or prevention of diseases in human beings and animals such as, heart diseases, vascular diseases, and/or cardiovascular diseases, including atherosclerosis, coronary artery disease (CAD), peripheral vascular disease (PAD)/arterial occlusive disease and/or restenosis after angioplasty (including the use of drug-coated or non drug-coated balloons and/or stent-implantation) and/or for the treatment and/or prophylaxis of lung diseases, inflammatory diseases, fibrotic diseases, metabolic diseases, cardiometabolic diseases and/or diseases/disease states affecting the kidneys and/or the central nervous and/or neurological system as well as gastrointestinal and/or urologic and/or ophthalmologic diseases/disease states.
(193) In the context of the present invention heart diseases, vascular diseases and/or cardiovascular diseases or disease of the cardiovascular system include, e.g., acute and chronic heart failure, arterial hypertension, coronary heart disease, stable and instable angina pectoris, myocardial ischemia, myocardial infarction, coronary microvascular dysfunction, microvascular obstruction, no-reflow-phenomenon, shock, atherosclerosis, coronary artery disease, peripheral artery disease, peripheral arterial disease, intermittent claudication, severe intermittent claudication, limb ischemia, critical limb ischemia, hypertrophy of the heart, cardiomyopathies of any etiology (such as, e.g., dilatative cardiomyopathy, restrictive cardiomyopathy, hypertrophic cardiomyopathy, ischemic cardiomyopathy), fibrosis of the heart, atrial and ventricular arrhythmias, transitory and/or ischemic attacks, apoplexy, ischemic and/or hemorrhagic stroke, preeclampsia, inflammatory cardiovascular diseases, metabolic diseases, diabetes, type-I-diabetes, type-II-diabetes, diabetes mellitus, peripheral and autonomic neuropathies, diabetic neuropathies, diabetic microangiopathies, diabetic retinopathy, diabetic ulceraat the extremities, gangrene, CREST-syndrome, hypercholesterolemia, hypertriglyceridemia, lipometabolic disorder, metabolic syndrome, increased levels of fibrinogen and low-density lipoproteins (i.e. LDL), increased concentrations of plasminogen-activator inhibitor 1 (PAI-1), as well as peripheral vascular and cardiac vascular diseases, peripheral circulatory disorders, primary and secondary Raynaud syndrome, disturbances of the microcirculation, arterial pulmonary hypertension, spasms of coronary and peripheral arteries, thromboses, thromboembolic diseases, edema-formation, such as pulmonary edema, brain-edema, renal edema, myocardial edema, myocardial edema associated with heart failure, restenosis after i.e. thrombolytic therapies, percutaneous-transluminal angioplasties (PTA), transluminal coronary angioplasties (PTCA), heart transplantations, bypass-surgeries as well as micro- and macrovascular injuries (e.g., vasculitis), reperfusion-damage, arterial and venous thromboses, microalbuminuria, cardiac insufficiency, endothelial dysfunction.
(194) In the light of the present invention, heart failure includes more specific or related kinds of diseases such as acute decompensated heart failure, right heart failure, left heart failure, global insufficiency, ischemic cardiomyopathy, dilatative cardiomyopathy, congenital heart defect(s), valve diseases, heart failure related to valve diseases, mitral valve stenosis, mitral valve insufficiency, aortic valve stenosis, aortic valve insufficiency, tricuspid valve stenosis, tricuspid valve insufficiency, pulmonary valve stenosis, pulmonary valve insufficiency, combined valvular defects, inflammation of the heart muscle (myocarditis), chronic myocarditis, acute myocarditis, viral myocarditis, bacterial myocarditis, diabetic heart failure, alcohol- toxic cardiomyopathy, cardiac storage diseases, heart failure with preserved ejection fraction (HFpEF), diastolic heart failure, heart failure with reduced ejection fraction (HFrEF), systolic heart failure.
(195) In the context of the present invention, the terms atrial arrhythmias and ventricular arrhythmias also include more specific and related disease-entitites, such as: Atrial fibrillation, paroxysmal atrial fibrillation, intermittent atrial fibrillation, persistent atrial fibrillation, permanent atrial fibrillation, atrial flutter, sinus arrhythmia, sinus tachycardia, passive heterotopy, active heterotopy, replacement systoles, extrasystoles, disturbances in the conduction of impulses, sick-sinus syndrome, hypersensitive carotis-sinus, tachycardias, AV-node re-entry tachycardias, atrioventricular re-entry tachycardia, WPW-syndrome (Wolff-Parkinson-White syndrome), Mahaim-tachycardia, hidden accessory pathways/tracts, permanent junctional re-entry tachycardia, focal atrial tachycardia, junctional ectopic tachycardia, atrial re-entry tachycardia, ventricular tachycardia, ventricular flutter, ventricular fibrillation, sudden cardiac death.
(196) In the context of the present invention, the term coronary heart disease also includes more specific or related diseases entities, such as: Ischemic heart disease, stable angina pectoris, acute coronary syndrome, instable angina pectoris, NSTEMI (non-ST-segement-elevation myocardial infarction), STEMI (ST-segement-elevation myocardial infarction), ischemic damage of the heart, arrhythmias, and myocardial infarction.
(197) In the context of the present invention, diseases of the central nervous and neurological system or central nervous and neurological diseases/diseases states refer to, e.g., the following diseases/diseases states: Transitory and ischemic attacks, stroke/apoplexy, ischemic and hemorrhagic stroke, depression, anxiety disorder, post-traumatic stress-disorder, poly-neuropathy, diabetic poly-neuropathy, stress-induced hypertension.
(198) Compounds concerning the present invention are furthermore suited for the prophylaxis and/or treatment of poly-cystic kidney-disease (PCKD) and the syndrome of inadequate ADH-secretion (SIADH). Furthermore, the compounds described in the present invention are suited for the treatment and/or prophylaxis of kidney diseases, especially of acute and chronic renal insufficiency as well as of acute and chronic renal failure.
(199) In the context of the present invention, the term acute renal insufficiency/renal failure includes acute presentations of kidney diseases, kidney failure and/or renal insufficiency with or without the dependency on dialysis as well as underlying or related kidney diseases such as renal hypoperfusion, hypotension during dialysis, lack of volume (i.e. dehydration, blood-loss), shock, acute glomerulonephritis, hemolytic-uremic syndrome (HUS), vascular catastrophe (arterial or venous thrombosis or embolism), cholesterol-embolism, acute Bence-Jones-kidney associated with plasmacytoma, acute supravesical or subvesical outlow obstructions, immunologic kidney diseases such as kidney transplant rejection, immuncomplex-induced kidney diseases, tubular dilatation, hyperphosphatemia and/or akute kidney diseases which may be characterized by the need for dialysis. Also included are conditions of partial nephrectomy, dehydration caused by force diuresis, uncontrolled increase in blood pressure accompanied by malignant hypertension, urinary tract obstructions and infections and amyloidosis as well as systemic disorders with glomerular participation such as rheumatologic-immunologic systemic disorders, such as Lupus erythematodes, renal artery thrombosis, renal vein thrombosis, analgesics-induced nephropathy and renal-tubular acidosis as well as radio-opaque substance- as well as drug-induced acute interstitial kidney diseases.
(200) In the context of the present invention the term chronic renal insufficiency/chronic renal failure includes chronic manifestations/presentations of kidney diseases, renal failure and/or renal insufficiency with and without the dependency on dialysis as well as underlying or related kidney diseases such as renal hypoperfusion, hypotension during dialysis, obstructive uropathy, glomerulopathies, glomerular and tubular proteinuria, renal edema, hematuria, primary, secondary as well as chronic glomerulonephritis, membraneous and membraneous-proliferative glomerulonephritis, Alport-syndrome, glomerulosclerosis, tubulointerstitial diseases, nephropathic diseases such as primary and hereditary kidney disease(s), renal inflammation, immunologic kidney diseases such as transplant rejection, immuncomplex-induced kidney diseases, diabetic and non-diabetic nephropathy, pyelonephritis, renal cysts, nephrosclerosis, hypertensive nephrosderosis and nephrotic syndrome, which are diagnostically characterized by i.e. abnormally reduced creatinine- and/or water-excretion, abnormally increased blood-concentrations of urea, nitrogen, potassium and/or creatinine, altered activity of kidney enzymes, such as, e.g., glutamylsynthase, altered urinary osmolarity or volume, increased microalbuminuria, macroalbuminuria, lesions associated with glomeruli and arterioles, tubular dilatation, hyperphosphatemia and/or the need for dialysis, likewise included are renal cell carcinomas, conditions after partial kidney-resection, dehydration attributed to force diuresis, uncontrolled increase in blood pressure with malignant hypertension, urinary tract obstruction and urinary tract infection and amyloidosis as well as systemic diseases with glomerular participation such as rheumatologic-immunologic systemic diseases, such as lupus erythematodes, as well as renal artery stenosis, renal artery thrombosis, renal vein thrombosis, analgesics-induced nephropathy and renal-tubular acidosis. Furthermore, included are radio-opaque substance- or drug-induced chronic interstitial kidney diseases, metabolic syndrome and dyslipidemia. The current invention also includes the use of the drugs of the current invention for the treatment and/or prophylaxis of after-effects of renal insufficiency such as lung edema, heart failure, uremia, anemia, disturbances in electrolytes (e.g., hyperkalemia, hyponatremia) and disturbances in bone- and carbohydrate-metabolism.
(201) Additionally, compounds of the current invention are suited for the treatment and/or prophylaxis of lung diseases (partially also seen as vascular diseases), such as, e.g., pulmonary arterial hypertension (PAH) and other forms of pulmonary hypertension (PH), chronic-obstructive pulmonary disease (COPD), acute respiratory distress syndrome (ARDS), acute lung injury (ALI), lung fibrosis, lung emphysema (e.g., lung emphysema induced by cigarette smoke), cystic fibrosis (CF) as well as for the treatment and/or prophylaxis of alpha-1-antitrypsin deficiency (AATD), acute coronary syndrome (ACS), inflammation of the heart muscle (myocarditis) and other autoimmune diseases of the heart (pericarditis, endocarditis, valvolitis, aortitis, cardiomyopathies), cardiogenicshock, aneurysms, sepsis (SIRS), multiple organ failure (MODS, MOF), inflammatory kidney diseases, chronic bowel diseases (IBD, Crohn's Disease, UC), pancreatitis, peritonitis, rheumatoid diseases, inflammatory skin diseases as well as inflammatory eye diseases.
(202) Furthermore, compounds of the current invention can be used for the treatment and/or prophylaxis of asthmatic diseases of different severity with intermittent or persistent courses (refractive asthma, bronchial asthma, allergic asthma, intrinsic asthma, extrinsic asthma, asthma induced by drugs or dust), of different kinds of bronchitis (chronic bronchitis, infectious bronchitis, eosinophilic bronchitis), of bronchiolitis obliterans, bronchiectasia, pneumonia, idiopathic interstitial pneumonia, farmer's lung and related diseases, coughing and common cold diseases (chronic inflammatory cough, iatrogenic cough), inflammations of the nasal mucosa (including drug-induced rhinitis, vasomotor rhinitis and season-dependent allergic rhinitis, e.g., allergic coryza) as well as of polyps.
(203) The compounds described in the current invention also represent active compounds for the treatment of diseases of the central nervous system, characterized by disturbances of the NO/cGMP-system. They are especially suited for improvement of perception, concentration-performance, learning-behaviour or memory-performance after cognitive disturbances as they occur with conditions/illnesses/syndromes such as mild cognitive impairment, age-associated learning- and memory-disturbances, age-associated memory-loss, vascular dementia, craniocerebral injury, stroke, dementia occurring after stroke (post stroke dementia), post-traumatic craniocerebral injury, general concentration-disturbances, concentration-disturbances affecting children with learning- and memory-problems, Alzheimer's disease, dementia with Lewy-bodies, dementia with degeneration of the frontal lobe including Pick's syndrome, Parkinson's Disease, dementia with corticobasal degeneration, amyotrophic lateral sclerosis (ALS), Huntington's Disease, demyelination, multiple sclerosis, thalamic degeneration, Creutzfeld-Jacob-dementia, HIV-dementia, schizophrenia with dementia or Korsakoff-psychosis. They are also suited for the treatment and or prevention of diseases/disease states of the central nervous system such as conditions of anxiety, tension/pressure and depressions, bipolar disorder, sexual dysfunction due to disturbances in the central nervous system as well as sleep abnormalities and for regulation of pathological disturbances of food-, luxury food- and dependence causing substance-intake.
(204) Furthermore, the compounds of the current invention are also suited for the treatment and/or prophylaxis of urologic diseases/disease states such as, e.g., urinary incontinence, stress-induced incontinence, urge incontinence, reflex incontinence and overflow incontinence, detrusor hyperactivity, neurogenic detrusor hyperactivity, idiopathic detrusor hyperactivity, benign prostate hyperplasia (BPH-syndrome), lower urinary tract symptoms.
(205) The compounds of the current invention are further suited for the treatment and/or prevention of conditions of pain, such as, e.g., menstrual disorders, dysmenorrhea, endometriosis, preterm delivery, tocolysis.
(206) The compounds of the current invention are likewise suited for the treatment and/or prevention of erythematosis, onychomycosis, rheumatic diseases as well as for facilitation of wound healing.
(207) The compounds of the current invention are also suited for the treatment and/or prevention of gastrointestinal diseases such as, e.g., diseases/disease states affecting the oesophagus, vomiting, achalasia, gastrooesophageal reflux disease, diseases of the stomach, such as, e.g., gastritis, diseases of the bowel, such as, e.g., diarrhea, constipation, malassimilation syndromes, syndromes of bile acid-loss, Crohn's Disease, Colitis ulcerosa, microscopic colitis, irritable bowel syndrome.
(208) Furthermore, compounds of the current invention are suited for the treatment and/or prophylactic treatment of fibrotic diseases of inner organs such as lung, heart, kidney, bone marrow, and especially liver as well as dermatological fibrosis and fibrotic eye diseases. In the context of the current invention the term fibrotic diseases includes liver fibrosis, liver cirrhosis, lung fibrosis, endomyocardial fibrosis, cardiomyopathy, nephropathy, glomerulonephritis, interstitial kidney fibrosis, fibrotic damage as a consequence of diabetes, bone marrow fibrosis and similar fibrotic diseases, scleroderma, morphaea, keloids, hypertrophic scarring (also after surgical intervention), naevus, diabetic retinopathy and proliferative vitroretinopathy.
(209) In addition, the compounds of the current invention can be used to treat and/or prophylactically treat dyslipidemias (hypercholesterolemia, hypertriglyceridemia, increased concentrations of post-prandial plasma triglycerides, hypo-alphalipoproteinemia, combined hyperlipidemias), metabolic diseases (type I and type II diabetes, metabolic syndrome, overweight, adipositas), nepropathy and neuropathy, cancer (skin cancer, brain tumors, breast cancer, tumors of the bone marrow, leukemias, liposarcoma, carcinoma of the gastrointestinal tract, liver, pancreas, lung, kidney, ureter, prostate and gential tract as well as carcinoma of the lymphoproliferative system such as, e.g., Hodgkin's and Non-Hodgkin's lymphoma), of gastrointestinal and abdominal diseases (glossitis, gingivitis, periodontitis, esophagitis, eosinophilic gastroenteritis, mastocytosis, Crohn's disease, colitis, proctitis, anal pruritis, diarrhea, celiac disease, hepatitis, chronic hepatitis, liver fibrosis, liver zirrhosis, pancreatitis and cholecystitis), skin diseases (allergicskin diseases, psoriasis, acne, eczema, neurodermatitis, multiple kinds of dermatitis, as well as keratitis, bullosis, vasculitis, cellulitis, panniculitis, lupus erythematodes, erythema, lymphoma, skin cancer, Sweet-syndrome, Weber-Christian-syndrome, scarring, wart formation, chilblains), of diseases of the sceletal bones and the joints as well as of sceletal muscle (multiple kinds of arthritis, multiple kinds of arthropathies, scleroderma as well as of further diseases with inflammatory or immunologic components, such as, e.g., paraneoplastic syndrome, rejection reactions after organ transplantations and for wound healing and angiogenesis, especially with chronic wounds.
(210) The compounds of the current invention are suited for the treatment and/or prophylactic treatment of ophthalmologic diseases such as, e.g., glaucoma, normotensive glaucoma, increased/high ocular pressure and their combination, of age-related macula degeneration (AMD), dry (non-exudative) AMD, wet (exudative, neovascular) AMD, choroidal neovascularization (CNV), retinal detachment, diabetic retinopathy, atrophic changes of the retinal pigmented epithelium (RPE), hypertrophic changes of the retinal pigmented epithelium, diabetic macula edema, diabetic retinopathy, retinal vein occlusion, choroidal retinal vein occlusion, macula edema, diabetic macula edema, macula edema as a consequence of retinal vein occlusion, angiogenesis at the front-side of the eye such as corneal angiogenesis i.e. after keratitis, cornea transplantation or keratoplasty, corneal angiogenesis due to hypoxia (extensive wearing of contact lenses), Pterygium conjunctivae, sub-retinal edema and intra-retinal edema.
(211) Furthermore, compounds of the current invention are suited for the treatment and/or prophylactic treatment of increased and high inner ocular pressure as a result of traumatic hyphema, periorbital edema, post-operative viscoelastic retention, intra-ocular inflammation, corticosteroid-use, pupil-block or idiopathic causes such as increased inner ocular pressure after trabeculectomy and due to pre-operative additives.
(212) Furthermore, compounds of the current invention are suited for the treatment and/or prophylaxis of hepatitis, neoplasms, osteoporosis, glaucoma and gastroparesis.
(213) Likewise, compounds of the current invention are suited for the regulation of cerebral blood circulation and represent useful agents for the treatment and or prophylaxis of migraine. They are also suited for the treatment and prophylaxis of cerebral infarcts such as stroke, cerebral ischemias and traumatic brain injury. Likewise, compounds of the current invention can be used for the treatment and/or prophylactic treatment of pain, neuralgias and tinnitus.
(214) The aforementioned, well characterized human diseases may occur in other mammalians with a comparable etiology as well can be treated with the compounds of the current invention.
(215) In the context of the current invention the term treatment or treat or treated includes inhibition, retardation, stopping, relief, reduction, attenuation, restriction, minimizing, suppression, repression or healing of a disease, a suffering, an illness, an injury or a health disorder, or the development, course and progression of such states/conditions and/or symptoms of these states/conditions.
(216) The terms prevention and prophylaxis are used synonymously in the context of the present invention and refer to avoiding or reducing the risk to get, receive, experience, suffer from a disease, a suffering, an illness, an injury or a health disorder, the development, course and progression of such states/conditions and/or symptoms of these states/conditions.
(217) Treatment or prevention of a disease, a suffering, an illness, an injury or a health disorder can be pursued in part or completely.
(218) Other embodiments of the current invention therefore relate to the use of the compounds of the current invention for the treatment and/or prevention of diseases, especially of the aforementioned diseases/disease states.
(219) Other embodiments of the current invention therefore relate to the use of the compounds of the current invention for the production/manufacturing of a compound/of compounds for the treatment and/or prevention of diseases, especially of the aforementioned diseases/disease states.
(220) Other embodiments of the current invention therefore relate to is a drug containing at least one of the compounds of the present invention for the treatment and/or prevention of diseases, especially of the aforementioned diseases/disease states.
(221) Other embodiments of the current invention therefore relate to the use of the compounds of the current invention in a process for the treatment and/or prevention of diseases, especially of the aforementioned diseases/disease states.
(222) Other embodiments of the current invention therefore relate to a process for the treatment and/or prevention of diseases, especially of the aforementioned diseases, by use of an effective dose/amount of at least one of the compounds of the current invention.
(223) Other embodiments of the current invention therefore relate to drugs and pharmaceutical formulations which contain at least one compound of the current invention, typically together with one or more inert, non- toxic, pharmaceutically suited additives, as well as their use for the aforementioned purposes.
(224) Further embodiments of the current invention include the use of compound of formula (I) in a method for the treatment and/or prevention of heart diseases, vascular diseases, cardiovascular diseases, lung diseases, inflammatory diseases, fibrotic diseases, metabolic diseases and/or cardiometabolic diseases. Further embodiments of the current invention include the use of compound of formula (I) in a method for the treatment and/or prevention of Atherosclerosis, athersclerosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplasty. Further embodiments include the use of a compound according to formula (I) for the manufacture of a pharmaceutical composition for the treatment and/or preventing atherosclerosis, athersclerosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplasty. Further embodiments include the use of a compound according to the current invention for the manufacture of a pharmaceutical composition for the treatment and/or prevention atherosclerosis, athersclerosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplasty. Further embodiments include a pharmaceutical composition comprising a compound according to the current invention and one or more pharmaceutically acceptable excipients. Other embodiments include a pharmaceutical composition comprising one or more first active ingredients, in particular compounds according to the current invention and one or more further active ingredients, in particular one or more additional therapeutic agents selected from the group consisting of angiotensin-converting enzyme inhibitors, angiotensin-receptor blockers, mineralocorticoid-receptor antagonists, endothelin antagonists, renin inhibitors, calcium blockers, beta-receptor blockers, vasopeptidase inhibitors, Sodium-Glucose-Transport-Antagonists, Metformin, Pioglitazones and Dipeptidyl-peptidase-IV inhibitors.
(225) Further embodiments of the current invention include the pharmaceutical composition as defined above for the treatment and/or prevention of atherosclerosis, athersclerosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplasty
(226) Further embodiments of the invention include a method for the treatment and/or prevention atherosclerosis, athersclerosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplasty in a human or other mammal, comprising administering to a human or other mammal in need thereof a therapeutically effective amount of one or more compounds according to the current invention or of a pharmaceutical composition as defined above.
(227) The compounds according to the invention can be used alone or in combination with one or more other pharmacologically active compounds if necessary as long as these combinations do not lead to unacceptable side effects. The present invention further relates to drugs containing at least one of the compounds according to the invention and one or more further active compounds/active components, in particular for the treatment and/or prophylaxis of the aforementioned diseases. As suitable active compounds/active components for combination, the following ones are mentioned exemplarily and preferably: Positive inotropic compounds, such as, e.g., cardiac glycosides (digoxin), beta-adrenergic and dopaminergic agonists, such as isoprenaline, adrenaline, noradrenaline, dopamine or dobutamine and serelaxine; Vasopressin-receptor antagonists, for example and preferably Conivaptan, Tolvaptan, Lixivaptan, Mozavaptan, Satavaptan, SR-121463, RWJ 676070 or BAY 86-8050, as well as the compounds described in WO 2010/105770, WO 2011/104322 and WO 2016/071212; Natriuretic peptides, for example and preferably atrial natriuretic peptide (ANP), natriuretic peptide type B (BNP, Nesiritide), natriuretic peptide type C (CNP) or urodilatin; Activators of cardiac myosin, for example and preferably e.g., Omecamtiv mecarbil (CK-1827452); Calcium-sensitizers, for example and preferably Levosimendan; Compounds affecting mitochondrial function and/or production of reactive oxygen species (ROS), for example Bendavia/Elamipritide; Compounds influencing cardiac energy-metabolism, for example and preferably etomoxir, dichloroacetate, ranolazine, trimetazidine, full or partial adenosine A1 receptor agonists such as GS-9667 (formerly known as CVT-3619), capadenosone and neladenosone; Compounds with an effect on heart rate, e.g., ivabradine Organic nitrates and NO-donors, such as sodium nitroprusside, nitroglycerin, isosorbide mononitrate, isosorbide dinitrate, molsidomine or SIN-1, and inhalational NO; Compounds that inhibit the degradation of cyclic guanosine monophosphate (cGMP) and/or cyclic adenosine monophosphate (cAMP), such as inhibitors of phosphodiesterases (PDE) 1, 2, 3, 4 and/or 5, in particular PDE 4 inhibitors such as roflumilast or revamilast and PDE 5 inhibitors such as sildenafil, vardenafil, tadalafil, udenafil, dasantafil, avanafil, mirodenafil, Iodenafil or PF-00489791; Compounds increasing cGMP synthesis, such as, e.g., sGC modulators in particular riociguat, nelociguat, vericiguat, cinaciguat and the compounds described in WO 00/06568, WO 00/06569, WO 02/42301, WO 03/095451, WO 2011/147809, WO 2012/004258, WO 2012/028647, WO 2012/059549, WO 2014/068099 and WO 2014/131760 as well as the compounds described in WO 01/19355, WO 01/19780, WO 2012/139888 and WO 2014/012934; Compounds which inhibit the soluble epoxid-hydrolase (sEH), such as, e.g., N,N-dicyclohexylurea, 12-(3-Adamantan-1-yl-ureido)-dodecanoic acid or 1-Adamantan-1-yl-3-{5-[2-(2-ethoxyethoxy)ethoxy]pentyl}-urea; Compounds modulating neurotransmitters, such as, e.g., tricyclic antidepressants such as, e.g., amitryptiline and imaprimine, monoaminooxidase (MAO) inhibitors such as moclobemide, serotonin-noradrenaline-reuptake inhibitors such as venlaflaxine, selective serotonin-reuptake inhibitors such as sertraline or noradrenergic and specific serotonergic antidepressants such as mirtazapine. Compounds with anxiolytic, sedative and hypnotic properties, so-called tranquilizers such as, e.g., short- as well as mid-long acting benzodiazepines. Prostacyclin analogs and IP receptor agonists, for example and preferably iloprost, bera-prost, treprostinil, epoprostenol, NS-304, selexipag, or ralinepag; Compounds which inhibit the signal transduction cascade, in particular from the group of the tyrosine kinase inhibitors and/or from the group of serine/threoninekinase-inhibitors, for example and preferably dasatinib, nilotinib, bosutinib, regorafenib, sorafenib, sunitinib, cediranib, axitinib, telatinib, imatinib, brivanib, pazopanib, vatalanib, gefitinib, erlotinib, lapatinib, canertinib, lestaurtinib, pelitinib, semaxanib, masitinib or tandutinib, Rho kinase inhibitors, such as fasudil, Y-27632, SLx-2119, BF-66851, BF-66852, BF-66853, KI-23095 or BA-1049; Anti-obstructive agents as used, for example, for the therapy of chronic-obstructive pulmonary disease (COPD) or bronchial asthma, for example and preferably inhalatively or systemically administered beta-receptor mimetics (e.g., bedoradrine) or inhalatively administered anti-muscarinergic substances; Compounds with a bronchodilatory effect, for example and preferably from the group of -adrenergic receptor-agonists, such as particularly albuterol, isoproterenol, metaproterenol, terbutaline, formoterol or salmeterol or from the group of anti-cholinergics, such as particularly ipratropiumbromide; Anti-inflammatory and/or immunosuppressive agents as used, for example for the therapy of chronic-obstructive pulmonary disease (COPD), of bronchial asthma or pulmonary fibrosis, for example and preferably from the group of corticosteroids, such as particularly prednisone, prednisolone, methylprednisolone, triamcinolone, dexamethasone, beclomethasone, betamethasone, flunisolide, budesonide or fluticasone as well as from the group of non-steroidal anti-inflammatory drugs (NSAIDs), such as particularly acetylsalicylic acid (Aspirin), ibuprofen and naproxen, 5-aminosalicylic acid derivatives, leukotriene/leukotriene receptor antagonists, TNF- inhibitors and chemokine receptor antagonists, such as, e.g., CCR-1, -2 and/or -5 inhibitors. Furthermore, drugs such as pirfenidone, acetylcysteine, azathioprine or BIBF-1120; Chemotherapeutics as used, for example, for the therapy of neoplasias of the lung or other organs; Active compounds used for the systemic and/or inhalative treatment of pulmonary disorders, for example for cystic fibrosis (alpha-1-antitrypsin, aztreonam, ivacaftor, lumacaftor, ataluren, amikacin, levofloxacin), chronic obstructive pulmonary diseases (COPD) (LAS40464, PT003, SUN-101), acute respiratory distress syndrome (ARDS) and acute lung injury (ALI) (interferon-beta-1a, traumakines), obstructive sleep apnea (VI-0521), bronchiectasis (mannitol, ciprofloxacin), Bronchiolitis obliterans (cyclosporine, aztreonam) and sepsis (pagibaximab, Voluven, ART-123); Active compounds used for treating muscular dystrophy, for example idebenone; Antithrombotic agents, for example and preferably from the group of platelet aggregation inhibiting drugs (platelet aggregation inhibitors, thrombocyte aggregation inhibitors), anticoagulants or compounds with anticoagulant properties or profibrinolytic substances; Active compounds for lowering blood pressure, for example and preferably from the group of calcium antagonists, angiotensin All antagonists, ACE inhibitors, NEP inhibitors, vasopeptidase inhibitors, and combinations thereof, such as, e.g., sacubitril/valsartan (Entresto), furthermore nicorandil, endothelin antagonists/endothelin receptor antagonists, such as bosentan, darusentan, ambrisentan, macicentan or sitaxentan, thromboxane A2 (TXA2) antagonists/thromboxane A2 (TBX2) receptor antagonists, renin inhibitors, alpha-receptor blockers, beta-receptor blockers, mineralocorticoid-receptor antagonists, Rho-kinase inhibitors, diuretics as well as further vasoactive compounds/active components such as i.e. adenosine and adenosine receptor agonists. Compounds which inhibit degradation and remodelling of the extracellular matrix, for example and preferably inhibitors of matrix metalloproteases (MMPs), in particular chymase-inhibitors, stromelysin-inhibitors, collagenase-inhibitors, gelatinase-inhibitors and aggrecanase-inhibitors (in these terms especially MMP-1, MMP-3, MMP-8, MMP-9, MMP-10, MMP-11 and MMP13) as well as inhibitors of the metallo-elastase MMP-12 as well as neutrophil elastase (HNE) inhibitors, for example and preferably sivelestat or DX-890 (Reltran); Compounds which inhibit the binding of serotonin to its receptor, for example and preferably antagonists of the 5-HT.sub.1-, 5-HT.sub.2a-, 5-HT.sub.2b-, 5-HT.sub.2e-, 5-HT.sub.3- and 5-HT.sub.4-receptors; Anti-arrhythmic compounds/active components, for example and preferably sodium channel inhibitors, beta-receptor blockers, potassium channel blockers, calcium antagonists, I.sub.f-channel blockers, digitalis, parasympatholytics (vagolytics), sympathomimetics and other anti-arrhythmic drugs such as, e.g., adenosine, adenosine-receptor agonists as well as vernakalant. Active compounds that alter fat metabolism, for example and preferably from the group of thyroid receptor agonists, cholesterol synthesis inhibitors, for example and preferably HMG-CoA-reductase or squalene synthesis inhibitors, ACAT inhibitors, CETP inhibitors, MTP inhibitors, PPAR-alpha-, PPAR-gamma- and/or PPAR-delta-agonists, cholesterol absorption inhibitors, lipase inhibitors, polymericbile acid adsorbers, bile acid reabsorption inhibitors and lipoprotein (a) antagonists. Active ingredients which inhibit neoangiogenesis, for example and preferably inhibitors of the VEGF and/or PDGF signalling pathways, inhibitors of the integrin signalling pathways, inhibitors of the angiopoietin-Tie signalling pathways, inhibitors of the PI3K-Akt-mTor signalling pathways, inhibitors of the Ras-Raf-Mek-Erk signalling pathway, inhibitors of the MAPK signalling pathways, inhibitors of the FGF signalling pathways, inhibitors of the sphingosine-1-phosphate signalling pathways, inhibitors of endothelial cell proliferation or apoptosis-inducing active ingredients; Active ingredients which reduce vascular wall permeability (edema formation), for example and preferably corticosteroids, inhibitors of the ALK1-Smad1/5 signalling pathway, inhibitors of the VEGF and/or PDGF signalling pathways, cyclooxygenase inhibitors, inhibitors of the kallikrein-kinin system or inhibitors of the sphingosine-1-phosphate signalling pathways; Active ingredients which reduce damage to the retina under oxidative stress, for example and preferably addressing the complement system, especially antagonists of the complement C5a receptor, or agonists of the 5-HT1A receptor; Antioxidants and free-radical scavengers; Active hypotensive ingredients, for example and preferably from the group of the calcium antagonists, angiotensin All antagonists, ACE inhibitors, beta-receptor blockers, alpha-receptorblockers, diuretics, phosphodiesterase inhibitors, sGC stimulators, cGMP elevators, aldosterone antagonists, mineralocorticoid-receptor antagonists, ECE inhibitors and vasopeptidase inhibitors; Antidiabetics and accordingly compounds/active components changing glucose metabolism, for example and preferably from the group of the insulins and/or insulin derivatives, biguanides, sulfonylureas, acarbose, DPP4-inhibitors, meglitinide derivatives, glucosidase inhibitors, GLP 1 receptor agonists/GLP1 analogues, SGLT-2 inhibitors, glucagon antagonists, PPAR-gamma agonists/insulin sensitizers, such as, e.g., thiazolidinediones, CCK1 receptor agonists, leptin receptor agonists, potassium channel antagonists and the inhibitors of hepatic enzymes that are involved in the stimulation of gluconeogenesis and/or glycogenolysis; Antiinfectives, for example and in particular from the group of the antibacterial, antifungal and/or antiviral substances; Substances for treatment of glaucoma, for example and in particular from the group of the adrenergics, beta-receptor blockers, carbonic anhydrase inhibitors, parasympathomimetics and prostaglandins; Pain-reducing compounds such as opiates.
(228) Antithrombotic agents are for example and preferably to be understood as compounds from the group of platelet aggregation inhibiting drugs (platelet aggregation inhibitors, thrombocyte aggregation inhibitors), anticoagulants or compounds with anticoagulant properties or profibrinolytic substances.
(229) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with compounds from the group of platelet aggregation inhibiting drugs (platelet aggregation inhibitors, thrombocyte aggregation inhibitors), for example and preferably aspirin, clopidogrel, prasugrel, ticlopidine, ticagrelor, cangrelor, elinogrel, tirofiban, PAR1-antagonists such as, e.g., vorapaxar, PAR4-antagonists, EP3-antagonists, such as, e.g., DG041 or inhibitors of adenosine-transport, such as dipyridamole;
(230) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a thrombin inhibitor, for example and preferably ximelagatran, melagatran, dabigatran, bivalirudin or Clexane.
(231) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a GPIIb/IIIa antagonist, for example and preferably tirofiban or abciximab.
(232) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a factor Xa inhibitor, for example and preferably rivaroxaban, apixaban, edoxaban (DU-176b), darexaban, betrixaban, otamixaban, letaxaban, fidexaban, razaxaban, fondaparinux, idraparinux, as well as thrombin-inhibitors, for example and preferably dabigatran, dual thrombin/factor Xa-inhibitors, such as for example and preferably tanogitran or with factor XI- or factor XIa-inhibitors.
(233) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with heparin or a low molecular weight (LMW) heparin derivatives, such as i.e. tinzaparin, certoparin, parnaparin, nadroparin, ardeparin, enoxaparin, reviparin, dalteparin, danaparoid, semuloparin (AVE 5026), adomiparin (M118) and EP-42675/ORG42675.
(234) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a vitamin K antagonist, for example and preferably coumarines, such as marcumar/phenprocoumon.
(235) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with pro-fibrinolytic substances, for example and preferably streptokinase, urokinase or plasminogen-activator.
(236) The agents for lowering blood pressure are preferably to be understood as compounds from the group of calcium antagonists, angiotensin All antagonists, ACE inhibitors, endothelin antagonists/endothelin receptor antagonists, thromboxane A2 (TBX2)-antagonists/thromboxane A2 (TBX2) receptor antagonists, renin inhibitors, alpha-receptor blockers, beta-receptor blockers, mineralocorticoid-receptor antagonists, Rho-kinase inhibitors as well as diuretics.
(237) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a calcium antagonist, for example and preferably nifedipine, amlodipine, verapamil or diltiazem.
(238) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with an alpha-1-receptor blocker, for example and preferably prazosin.
(239) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a beta-receptor blocker, for example and preferably propranolol, atenolol, timolol, pindolol, alprenolol, oxprenolol, penbutolol, bupranolol, metipranolol, nadolol, mepindolol, carazolol, sotalol, metoprolol, betaxolol, celiprolol, bisoprolol, carteolol, esmolol, labetalol, carvedilol, adaprolol, landiolol, nebivolol, epanolol or bucindolol.
(240) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with an angiotensin All antagonist, for example and preferably losartan, candesartan, valsartan, telmisartan or embursatan, irbesartan, olmesartan, eprosartan or azilsartan or a dual angiotensin All-antagonist/NEP-inhibitor, for example and preferably Entresto (LCZ696, Valsartan/Sacubitril).
(241) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with an ACE-inhibitor, for example and preferably enalapril, captopril, lisinopril, ramipril, delapril, fosinopril, quinopril, perindopril or trandopril.
(242) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with an endothelin antagonist/endothelin receptor antagonist, for example and preferably bosentan, darusentan, ambrisentan, avosentan, macicentan, atrasentan or sitaxsentan.
(243) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a renin inhibitor, for example and preferably aliskiren, SPP-600 or SPP-800.
(244) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a thromboxane A2 (TBX2)-antagonist, for example and preferably seratrodast or KP-496.
(245) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a mineralocorticoid-receptor antagonist, for example and preferably spironolactone, eplerenone or finerenone.
(246) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a diuretic, for example and preferably furosemide, torasemide bumetanide and piretanide, with potassium-saving diuretics, such as, e.g., amiloride or triamterene as well as with thiazide diuretics, such as, e.g., hydrochlorthiazide, chlorthalidone, xipamide and indapamide. Likewise, the combination with further diuretics is applicable, for example and preferably with bendroflumethiazide, chlorthiazide, hydroflumethiazide, methyclothiazide, polythiazide, trichlormethiazide, metolazone, quinethazone, acetazolamide, dichlorphenamide, methazolamide, glycerol, isosorbide or mannitol.
(247) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a Rho-kinase inhibitor, for example and preferably fasudil, Y 27632, SLx-2119, BF-66851, BF-66852, BF-66853, KI-23095, SB-772077, GSK-269962A or BA-1049.
(248) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with natriuretic peptides, such as, for example atrial natriuretic peptide (ANP, Anaritide), B-type natriuretic peptide, brain natriuretic peptide (BNP, Nesiritide), C-type natriuretic peptide (CNP) or Urodilatin;
(249) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with inhibitors of the endopeptidase (NEP-inhibitors), for example Sacubitril, Omapatrilat or AVE-7688, or as dual combinations (ARNIs) with Angiotensin receptor antagonists (for example Valsartan), such as, for example Entresto/LCZ696.
(250) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with type II antidiabetic drugs, such as inhibitors of the sodium-glucose co-transporter 2 (SGLT2 inhibitors), for example Empagliflozin, Canagliflozin, Dapagliflozin, Ipragliflozin, Tofogliflozin and inhibitors of the dipeptidyl peptidase 4 (DPP-4 inhibitors), for example sitagliptin, saxagliptin, linagliptin, alogliptin.
(251) Substances altering fat metabolism are preferably to be understood as compounds from the group of CETP inhibitors, thyroid receptor agonists, cholesterol synthesis inhibitors such as HMG-CoA-reductase or squalene synthesis inhibitors, the ACAT inhibitors, MTP inhibitors, PPAR-alpha, PPAR-gamma and/or PPAR-delta agonists, cholesterol-absorption inhibitors, polymeric bile acid adsorbers, bile acid reabsorption inhibitors, lipase inhibitors as well as the lipoprotein (a) antagonists.
(252) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a CETP inhibitor, for example and preferably torcetrapib (CP-529414), anacetrapib, JJT-705 or CETP-vaccine (Avant).
(253) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a thyroid receptor agonist, for example and preferably D-thyroxin, 3,5,3-triiodothyronin (T3), CGS 23425 or axitirome (CGS 26214).
(254) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a HMG-CoA-reductase inhibitor from the class of statins, for example and preferably lovastatin, simvastatin, pravastatin, fluvastatin, atorvastatin, rosuvastatin or pitavastatin.
(255) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a squalene synthesis inhibitor, for example and preferably BMS-188494 or TAK-475.
(256) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with an ACAT inhibitor, for example and preferably avasimibe, melinamide, pactimibe, eflucimibe or SMP-797.
(257) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with an MTP inhibitor, for example and preferably implitapide, BMS-201038, R-103757 or JTT-130.
(258) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a PPAR-gamma agonist, for example and preferably pioglitazone or rosiglitazone.
(259) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a PPAR-delta agonist, for example and preferably GW 501516 or BAY 68-5042.
(260) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a cholesterol-absorption inhibitor, for example and preferably ezetimibe, tiqueside or pamaqueside.
(261) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a lipase inhibitor, for example and preferably orlistat.
(262) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a polymeric bile acid adsorber, for example and preferably cholestyramine, colestipol, colesolvam, CholestaGel or colestimide.
(263) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a bile acid reabsorption inhibitor, for example and preferably ASBT (=IBAT) inhibitors, such as i.e. AZD-7806, S-8921, AK-105, BARI-1741, SC-435 or SC-635.
(264) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a lipoprotein (a) antagonist, for example and preferably gemcabene calcium (CI-1027) or nicotinic acid.
(265) Substances inhibiting signal transduction are preferably to be understood as compounds from the group of the tyrosinekinase inhibitors and/or serine/threonine-kinase-inhibitors.
(266) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a kinase-inhibitor, for example and preferably canertinib, erlotinib, gefitinib, dasatinib, imatinib, lapatinib, lestaurtinib, lonafarnib, nintedanib, nilotinib, bosutinib, axitinib, telatinib, brivanib, pazopanib, pegaptinib, pelitinib, semaxanib, regorafenib, sora-fenib, sunitinib, tandutinib, tipifarnib, vatalanib, cediranib, masitinib, fasudil, lonidamine, leflunomide, BMS-3354825 or Y-27632.
(267) Substances modulating glucose metabolism are preferably to be understood as compounds from the group of insulins, sulfonylureas, acarbose, DPP4-inhibitors, GLP-1 analogues or SGLT-2 inhibitors.
(268) Substances modulating neurotransmitters are preferably to be understood as compounds from the group of tricyclic antidepressants, monoaminooxidase (MAO)-inhibitors, serotonin-noradrenaline-reuptake inhibitors (SNRI) and noradrenergic and specific serotonergic antidepressants (NaSSa).
(269) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a tricyclic antidepressant, for example and preferably amitryptilin or imipramin.
(270) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a monoaminooxidase (MAO)-inhibitor, for example and preferably moclobemide.
(271) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a selective serotonine-noradrenaline reuptake inhibitor (SNRI), for example and preferably venlafaxine.
(272) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a selective serotonine reuptake inhibitor (SSRI), such as i.e. sertraline.
(273) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a noradrenergic and specific serotonergic antidepressants (NaSSa), for example and preferably mirtazapine.
(274) Substances with pain-reducing, anxiolytic or sedatative properties are preferably to be understood as compounds from the group of opiates and benzodiazepines.
(275) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with an opiate, for example and preferably morphine or sulfentanyl or fentanyl.
(276) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a benzodiazepine, for example and preferably midazolam or diazepam.
(277) Substances modulating cGMP-synthesis, such as, e.g., sGC-modulators, are preferably to be understood as compounds that stimulate or activate the soluble guanylate cyclase.
(278) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with sGC modulators, for example and preferably in riociguat, nelociguat, vericiguat, cinciguat and the compounds described in WO 00/06568, WO 00/06569, WO 02/42301, WO 03/095451, WO 2011/147809, WO 2012/004258, WO 2012/028647, WO 2012/059549, WO 2014/068099 and WO 2014/131760 as well as the compounds described in WO 01/19355, WO 01/19780, WO 2012/139888 and WO 2014/012934;
(279) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with full or partial adenosine A1 receptor agonists, such as, e.g., GS-9667 (formerly known as CVT-3619), capadenosone and neladenosone or compounds affecting mitochondrial function/ROS-production such as i.e. Bendavia/elamipritide.
(280) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a TGF-beta antagonist, for example and preferably pirfenidone or fresolimumab.
(281) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a TNF-alpha antagonist, for example and preferably adalimumab.
(282) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with HIF-PH-inhibitors, for example and preferably molidustat or roxadustat.
(283) In preferred embodiments of the invention, the compounds according to the invention are administered in combination with a serotonin-receptor antagonist, for example and preferably PRX-08066.
(284) It is possible for the compounds according to the invention to have systemic and/or local activity. For this purpose, they can be administered in a suitable manner, such as, for example, via the oral, parenteral, pulmonary, nasal, sublingual, lingual, buccal, rectal, vaginal, dermal, transdermal, conjunctival, otic route or as an implant or stent.
(285) For these administration routes, it is possible for the compounds according to the invention to be administered in suitable administration forms.
(286) For oral administration, it is possible to formulate the compounds according to the invention to dosage forms known in the art that deliver the compounds of the invention rapidly and/or in a modified manner, such as, for example, tablets (uncoated or coated tablets, for example with enteric or controlled release coatings that dissolve with a delay or are insoluble), orally-disintegrating tablets, films/wafers, films/lyophylisates, capsules (for example hard or soft gelatine capsules), sugar-coated tablets, granules, pellets, powders, emulsions, suspensions, aerosols or solutions. It is possible to incorporate the compounds according to the invention in crystalline and/or amorphised and/or dissolved form into said dosage forms.
(287) Parenteral administration can be effected with avoidance of an absorption step (for example intravenous, intraarterial, intracardial, intraspinal or intralumbal) or with inclusion of absorption (for example intramuscular, subcutaneous, intracutaneous, percutaneous or intraperitoneal). Administration forms which are suitable for parenteral administration are, inter alia, preparations for injection and infusion in the form of solutions, suspensions, emulsions, lyophylisates or sterile powders.
(288) Examples which are suitable for other administration routes are pharmaceutical forms for inhalation [inter alia powder inhalers, nebulizers], nasal drops, nasal solutions, nasal sprays; tablets/films/wafers/capsules for lingual, sublingual or buccal administration; suppositories; eye drops, eye ointments, eye baths, ocular inserts, ear drops, ear sprays, ear powders, ear-rinses, ear tampons; vaginal capsules, aqueous suspensions (lotions, mixturae agitandae), lipophilic suspensions, emulsions, ointments, creams, transdermal therapeutic systems (such as, for example, patches), milk, pastes, foams, dusting powders, implants or stents.
(289) The compounds according to the invention can be incorporated into the stated administration forms. This can be effected in a manner known per se by mixing with pharmaceutically suitable excipients. Pharmaceutically suitable excipients include, interalia,
(290) fillers and carriers (for example cellulose, microcrystalline cellulose (such as, for example, Avicel), lactose, mannitol, starch, calcium phosphate (such as, for example, Di-Cafos)),
(291) ointment bases (for example petroleum jelly, paraffins, triglycerides, waxes, wool wax, wool wax alcohols, lanolin, hydrophilic ointment, polyethylene glycols),
(292) bases for suppositories (for example polyethylene glycols, cacao butter, hard fat),
(293) solvents (for example water, ethanol, isopropanol, glycerol, propylene glycol, medium chain-length triglycerides fatty oils, liquid polyethylene glycols, paraffins),
(294) surfactants, emulsifiers, dispersants or wetters (for example sodium dodecyl sulfate), lecithin, phospholipids, fatty alcohols (such as, for example, Lanette), sorbitan fatty acid esters (such as, for example, Span), polyoxyethylene sorbitan fatty acid esters (such as, for example, Tween), polyoxyethylene fatty acid glycerides (such as, for example, Cremophor), polyoxethylene fatty acid esters, polyoxyethylene fatty alcohol ethers, glycerol fatty acid esters, poloxamers (such as, for example, Pluronic),
(295) buffers, acids and bases (for example phosphates, carbonates, citric acid, acetic acid, hydrochloric acid, sodium hydroxide solution, ammonium carbonate, trometamol, triethanolamine),
(296) isotonicity agents (for example glucose, sodium chloride),
(297) adsorbents (for example highly-disperse silicas),
(298) viscosity-increasing agents, gel formers, thickeners and/or binders (for example polyvinylpyrrolidone, methylcellulose, hydroxypropylmethylcellulose, hydroxypropylcellulose, carboxymethylcellulose-sodium, starch, carbomers, polyacrylic acids (such as, for example, Carbopol); alginates, gelatine),
(299) disintegrants (for example modified starch, carboxymethylcellulose-sodium, sodium starch glycolate (such as, for example, Explotab), cross-linked polyvinylpyrrolidone, croscarmellose-sodium (such as, for example, AcDiSol)),
(300) flow regulators, lubricants, glidants and mould release agents (for example magnesium stearate, stearic acid, talc, highly-disperse silicas (such as, for example, Aerosil)),
(301) coating materials (for example sugar, shellac) and film formers for films or diffusion membranes which dissolve rapidly or in a modified manner (for example polyvinylpyrrolidones (such as, for example, Kollidon), polyvinyl alcohol, hydroxypropylmethylcellulose, hydroxypropylcellulose, ethylcellulose, hydroxypropylmethylcellulose phthalate, cellulose acetate, cellulose acetate phthalate, polyacrylates, polymethacrylates such as, for example, Eudragit)),
(302) capsule materials (for example gelatine, hydroxypropylmethylcellulose),
(303) synthetic polymers (for example polylactides, polyglycolides, polyacrylates, polymethacrylates (such as, for example, Eudragit), polyvinylpyrrolidones (such as, for example, Kollidon), polyvinyl alcohols, polyvinyl acetates, polyethylene oxides, polyethylene glycols and their copolymers and block copolymers),
(304) plasticizers (for example polyethylene glycols, propylene glycol, glycerol, triacetine, triacetyl citrate, dibutyl phthalate),
(305) penetration enhancers,
(306) stabilisers (for example antioxidants such as, for example, ascorbic acid, ascorbyl palmitate, sodium ascorbate, butylhydroxyanisole, butylhydroxytoluene, propyl gallate),
(307) preservatives (for example parabens, sorbic acid, thiomersal, benzalkonium chloride, chlorhexidine acetate, sodium benzoate),
(308) colourants (for example inorganic pigments such as, for example, iron oxides, titanium dioxide),
(309) flavourings, sweeteners, flavour- and/or odour-masking agents.
Biological Definitions
(310) Unless otherwise defined, all scientific and technical terms used in the description, figures and claims have their ordinary meaning as commonly understood by one of ordinary skill in the art. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will prevail. If two or more documents incorporated by reference include conflicting and/or inconsistent disclosure with respect to each other, then the document having the later effective date shall control. The materials, methods, and examples are illustrative only and not intended to be limiting. Unless stated otherwise, the following terms used in this document, including the description and claims, have the definitions given below.
(311) The terms comprising, including, containing, having etc. shall be read expansively or open-ended and without limitation.
(312) Singular forms such as a, an or the include plural references unless the context clearly indicates otherwise.
(313) Unless otherwise indicated, the term at least preceding a series of elements is to be understood to refer to every element in the series. The terms at least one and at least one of include for example, one, two, three, four, or five or more elements.
(314) Mutation numbering follows the species based positions for each construct, i.e. rat ADAMTS7 SP-Pro (1-217) followed by human ADAMTS7 CD (237-537).
(315) The term ADAMTS-7 (also ADAMTS7, ADAM-TS 7, ADAM-TS7) refers to the protein A disintegrin and metalloproteinase with thrombospondin motifs 7. The ADAMTS-7 protein is encoded by the gene ADAMTS-7. The ADAMTS-7 protein comprises human, murine, rat and further mammalian and non-mamalian homologues. Sequence(s) for human ADAMTS-7 are accessible via UniProt Identifier Q9UKP4 (ATS7_HUMAN), for instance human isoform Q9UKP4-1. Sequence(s) for murine ADAMTS-7 are accessible via UniProt Identifier Q68SA9 (ATS7_MOUSE). Different isoforms, variants and SNPs may exist for the different species and are all comprised by the term ADAMTS-7. Also comprised are ADAMTS-7 molecules before and after maturation, i.e., independent of cleavage of one or more pro-domains. In addition, synthetic variants of the ADAMTS-7 protein may be generated and are comprised by the term ADAMTS-7. The protein ADAMTS-7 may furthermore be subject to various modifications, e.g, synthetic or naturally occurring modifications. Recombinant functional human ADAMTS-7 (e.g. according to SEQ ID No. 01 and 02) can be manufactured as described in the examples.
(316) The term ADAMTS-12 (also ADAMTS12, ADAM-TS 12, ADAM-TS12) refers to the protein A disintegrin and metalloproteinase with thrombospondin motifs 12. Such proteins preferably include a ADAMTS-12 catalytic domain. The ADAMTS-12 protein is encoded by the gene ADAMTS-12. The ADAMTS-12 protein comprises human, murine, rat and further mammalian and non-mamalian homologues. Sequence(s) for human ADAMTS-12 including the catalytic domains are accessible via UniProt Identifier P58397 (ATS12_HUMAN), for instance human isoform P58397-1. Sequence(s) for murine ADAMTS-12 are accessible via UniProt Identifier Q811B3 (ATS12_MOUSE). Different isoforms and variants may exist for the different species and are all comprised by the term ADAMTS-12. Also comprised are ADAMTS-12 molecules before and after maturation, i.e., independent of cleavage of one or more pro-domains. In addition, synthetic variants of the ADAMTS-12 protein may be generated and are comprised by the term ADAMTS-12. The protein ADAMTS-12 may furthermore be subject to various modifications, e.g., synthetic or naturally occurring modifications. Recombinant functional human ADAMTS-12 (e.g., according to SEQ ID NO: 15) can be manufactured as described in the examples.
(317) The terms ADAMTS-4 and ADAMTS-5 refer to the protein A disintegrin and metalloproteinase with thrombospondin motifs 4 and 5, respectively. The ADAMTS-4 and -5 proteins are encoded by the genes ADAMTS4 and ADAMTS-5, respectively. These proteins comprises human, murine, rat and further mammalian and non-mamalian homologues. Sequence(s) for human ADAMTS-4/-5 are accessible via UniProt Identifier 075173 (ATS4_HUMAN)/Q9UNA0 (ATS5_HUMAN), respectively. Different isoforms and variants may exist. Recombinant active human ADAMTS-4 and ADAMTS-5 can be manufactured as known in the art.
(318) The terms MMP2, MMP12, and MMP15 refer to the 72 kDa type IV collagenase, Macrophage metalloelastase 2 and 12 and Matrix metalloproteinase-15, respectively. The MMP2, MMP12, and MMP15 proteins are encoded by the genes MMP2, MMP12, and MMP15, respectively. The proteins comprises human, murine, rat and further mammalian and non-mamalian homologues. Sequence(s) for human ADAMTS-4/-5 are accessible via UniProt Identifier P08253 (MMP2_HUMAN), P39900 (MMP12_HUMAN) and P51511 (MMP15_HUMAN), respectively. Different isoforms and variants may exist. Recombinant active human ADAMTS-4 and ADAMTS-5 can be manufactured as known in the art.
(319) The term ADAM17 refers to Disintegrin and metalloproteinase domain-containing protein 17, encoded by the gene ADAM17. The protein comprises human, murine, rat and further mammalian and non-mamalian homologues. Sequence(s) for human ADAM17 are accessible via UniProt Identifier P78536 (ADA17_HUMAN). Different isoforms and variants may exist. Recombinant active human ADAM17 can be manufactured as known in the art.
(320) The term prodomain includes parts of ADAMTS-7 or ADAMTS-12 that are relatively N-terminal to the respective protein's functional chain (e.g., parts having metalloprotease function and disintergrin motifs). For example, a prodomain of ADAMTS-7 as provided in SEQ ID NO: 1 can include its signal peptide (residues 1-20) and its propeptide (residues 21-217), both of which are N-terminal to its peptidase domain, although not necessarily immediately N-terminal to it. In some embodiments, prodomain of ADAMTS-7 or ADAMTS-12 includes 75%, 80%, 85%, 90%, 95%, or 100% of the N-terminal part of the respective protein with its signal peptide plus its propeptide. The term prodomain also encompasses the parts of the encoded polypeptide that are processed (e.g., cleaved off) before generation of the functional enzymatic chain in the natural environment of the enzyme.
(321) A furin cleavage site or furin consensus site is R-x-K/R-RD/S, cf. Shiryaev 2013 PLoS One. The ADAMTS7 prodomain contains multiple Furin protease cleavage sites, the last of which is thought to fully process the zymogen into the active form. Mutational analysis was described by Sommerville 2004 JBC for rat ADAMTS7 with R60A and R217A (referred to as mouse R220A in publication). R60A changes rat ADAMTS7 from LRKRD to LRKAD and R217A changes rat ADAMTS7 RQQRS to RQQAS.
(322) The term catalytic domain includes parts of ADAMTS-7 or ADAMTS-12 that have ADAMTS-7 or ADAMTS-12 functionality, respectively, and that are C-terminal to the respective protein's prodomain. In some embodiments, the term catalytic domain refers to the peptidase plus disintegrin part of the respective protein (e.g., as characterized by UniProt), potentially also including any residues C-terminal to the respective protein's prodomain and N-terminal to the respective protein's peptidase domain. In some embodiments, the catalytic domain includes 75%, 80%, 85%, 90%, 95%, or 100% of the part of the respective enzyme having its disintegrin domain, its peptidase domain, and any residues it might have between its prodomain and its peptidase domain.
(323) The term functional protein refers to a protein which has biological activity. For example, functional ADAMTS-7 refers to ADAMTS-7 which is able to catalyze the proteolytic cleavage of its (natural) substrate(s), e.g. TSP1 and/or COMP.
(324) The term metalloproteinase refers to a protease enzyme whose catalytic mechanism involves a metal. Therefore a functional metalloproteinase is a functional protein, wherein the protein is a protease and wherein the protease is a metalloproteinase according to the foregoing definitions.
(325) The expression a cleavage site for a protease refers to any peptide or protein sequence which is recognized and cleaved by the functional protease. A cleavage site for ADAMTS-7 thus refers to any peptide or protein sequence which is recognized and cleaved by functional ADAMTS-7. For example, being natural substrates of ADAMTS-7, the sequences of proteins COMP and TSP1 both comprise cleavage sites for ADAMTS-7. In particular the subsequence DELSSMVLELRGLRT (derived from TSP1, residues 275-289) constitutes or comprises a cleavage site for ADAMTS-7 and ADAMTS-12.
(326) A substrate is a molecule upon which an enzyme acts. For example, the substrate of a proteinase can be a peptide or protein or derivative thereof, which is cleaved by the proteinase. Metalloproteinase paralogs ADAMTS-7/-12 on the one hand and their common peptide substrate on the other hand are interrelated in the sense of a plug and socket relationship.
(327) The term COMP, TSP-5 or TSP5 refers to the protein Cartilage oligomeric matrix protein. The COMP protein is encoded by the gene COMP. The COMP protein comprises human, murine, rat and further mammalian and homologues. Sequence(s) for human COMP are accessible via UniProt Identifier P49747 (COMP_HUMAN), for instance human isoform P49747-1. Sequence(s) for murine COMP are accessible via UniProt Identifier Q9ROG6 (COMP_MOUSE). Different isoforms and variants may exist for the different species and are all comprised by the term COMP. Also comprised are COMP molecules before and after maturation, i.e., independent of cleavage of one or more pro-domains. In addition, synthetic variants of the COMP protein may be generated and are comprised by the term COMP. The protein COMP may furthermore be subject to various modifications, e.g, synthetic or naturally occurring modifications. Recombinant human COMP or derivatives thereof can be manufactured as described in the examples.
(328) The term TSP1 (also THBS1 or TSP) refers to the protein Thrombospondin-1. The TSP1 protein is encoded by the gene THBS1. The TSP1 protein comprises human, murine, rat and further mammalian and non-mammalian homologues. Sequence(s) for human TSP1 are accessible via UniProt Identifier P07996 (TSP1_HUMAN), for instance human isoform P07996-1. Sequence(s) for murine TSP1 are accessible via UniProt Identifier P35441 (TSP1_MOUSE). Different isoforms and variants may exist for the different species and are all comprised by the term TSP1. Also comprised are TSP1 molecules before and after maturation, i.e., independent of cleavage of one or more pro-domains. In addition, synthetic variants of the TSP1 protein may be generated and are comprised by the term TSP1. The protein TSP1 may furthermore be subject to various modifications, e.g, synthetic or naturally occurring modifications. Recombinant human TSP1 or derivatives thereof can be manufactured as described in the examples.
(329) The term fluorophore according to the current invention refers to a molecule or chemical group which has the ability to absorb energy from light, transfer this energy internally, and emit this energy as light of a characteristic wavelength. Without being bound by theory, since some energy is lost during this process, the energy of the emitted fluorescence light is lower than the energy of the absorbed light, and therefore emission occurs at a longer wavelength than absorption. A variety of fluorophores and quenchers has been described in the art and can be used according to the current invention, see for example Bajar et al, Sensors 2016, A Guide to Fluorescent Protein FRET Pairs.
(330) The term quencher according to the current invention refers to a molecule or chemical group which has the ability to decrease the fluorescence intensity of a given fluorophore. Without being bound by theory a variety of processes can result in quenching, such as excited state reactions, energy transfer, complex-formation and collisional quenching. Dark quenchers are dyes with no native fluorescence. Quencher fluorescence can increase background noise due to overlap between the quencher and reporter fluorescence spectra. A variety of fluorophores and quenchers has been described in the art and can be used according to the current invention, see for example Bajar et al, Sensors 2016, A Guide to Fluorescent Protein FRET Pairs. Suitable quenchers according to the current invention include DDQ-I A (430 nm), Dabcyl (475 nm), Eclipse B (530 nm), Iowa Black FQ C (532 nm), BHQ-1 D (534 nm), QSY-7 E (571 nm), BHQ-2 D (580 nm), DDQ-1l A (630 nm), Iowa Black RQ C (645 nm), QSY-21 E (660 nm) or BHQ-3 D (670 nm). Preferred examples of quenchers according to the current invention include Dabsyl(dimethylaminoazobenzenesulfonic acid), which absorbs in the green spectrum and is often used with fluorescein, black hole quenchers which are capable of quenching across the entire visible spectrum, Qxl quenchers which span the full visible spectrum, Iowa black FQ (absorbs in the green-yellow part of the spectrum), Iowa black RQ (blocks in the orange-red part of the spectrum) and IRDye QC-1 (quenches dyes from the visible to the near-infrared range (500-900 nm)).
(331) Suitable internally quenched fluorescent (IQF)/FRET pairs include ABz-Tyr(NO2), ABz-EDDNP, Trp-Dansyl, and 7-methoxy-coumarin-4-yl acetic acid-2,4-dinitrophenyl-lysine (MCA-Lys(DNP)) (Poreba, Marcin et al., Highly sensitive and adaptable fluorescence-quenched pair discloses the substrate specificity profiles in diverse protease families. Scientific reports 7, 43135. (2017), doi:10.1038/srep43135). Further suitable examples are listed in: Poreba M. & Drag M. Current strategies for probing substrate specificity of proteases. Curr Med Chem 17, 3968-3995 (2010).
(332) The term construct refers to nucleic acids (e.g., double stranded DNA, which can be in the form of a plasmid).
(333) The term align in the context of two sequences (e.g., amino acid sequences), includes arranging the two sequences with respect to each other (e.g., the first sequence along a first row, and the second sequence along a second row, potentially with gap(s) in one or both sequences) to obtain a measure of their relationship to each other (e.g., % identity, % similarity, alignment score). A particular alignment of two sequences can be optimal (i.e., there are no alignments of the two sequences that result in a higher alignment score, if alignment score is the metric of concern for optimality) or non-optimal. In addition, a particular alignment can be global or local with respect to either sequence. For example, if the alignment is global with respect to both sequences (i.e., a global-global alignment), then all residues of both of the sequences are factored in to the calculation of the measure of their relationship, including any internal or external gaps in either sequence. In contrast, in a global-local alignment, while all residues and gaps in the first sequence are considered, no external gaps in the second sequence are considered, thereby allowing fitting the first sequence into a part of the second sequence.
(334) The term Needleman-Wunsch score implies that either a global-global or a global-local (or local-global) alignment has been used to generate the alignment score. When partiality modifiers are used for both the first sequence (e.g., portion) and the second sequence (e.g., segment), this implies that the alignment is global-global. A Needleman-Wunsch score includes scores calculated by the originally published method (S. B. Needleman & C. D. Wunsch, A general method applicable to the search for similarities in the amino acid sequence of two proteins, J. Mol. Biol. 48(3):443-53 (1970)) as well as by subsequent refinements of the method. Although Needleman-Wunsch algorithm is able to, and is designed to, find an optimal alignment, and thereby a maximum alignment score, the term Needleman-Wunsch score as used here is not restricted to the optimal/maximum score; it can be the alignment score of any alignment of the two sequences as long as at least one of the sequences (e.g., as defined, for example as a residue range) is considered globally.
(335) Alignment methods (e.g., Needleman-Wunsch) that generate an alignment score (e.g., Needleman-Wunsch score) can make use of a substitution matrix. A particular substitution matrix that can be used is BLOSUM62, which is reproduced below in Table B1.
(336) TABLE-US-00002 TABLE B1 A R N D C Q E G H I L K M F P S T W Y V B Z X * A 4 1 2 2 0 1 1 0 2 1 1 1 1 2 1 1 0 3 2 0 2 1 0 4 R 1 5 0 2 3 1 0 2 0 3 2 2 1 3 2 1 1 3 2 3 1 0 1 4 N 2 0 6 1 3 0 0 0 1 3 3 0 2 3 2 1 0 4 2 3 3 0 1 4 D 2 2 1 6 3 0 2 1 1 3 4 1 3 3 1 0 1 4 3 3 4 1 1 4 C 0 3 3 3 9 3 4 3 3 1 1 3 1 2 3 1 1 2 2 1 3 3 2 4 Q 1 1 0 0 3 5 2 2 0 3 2 1 0 3 1 0 1 2 1 2 0 3 1 4 E 1 0 0 2 4 2 5 2 0 3 3 1 2 3 1 0 1 3 2 2 1 4 1 4 G 0 2 0 1 3 2 2 6 2 4 4 2 3 3 2 0 2 2 3 3 1 2 1 4 H 2 0 1 1 3 0 0 2 8 3 3 1 2 1 2 1 2 2 2 3 0 0 1 4 I 1 3 3 3 1 3 3 4 3 4 2 3 1 0 3 2 1 3 1 3 3 3 1 4 L 1 2 3 4 1 2 3 4 3 2 4 2 2 0 3 2 1 2 1 1 4 3 1 4 K 1 2 0 1 3 1 1 2 1 3 2 5 1 3 1 0 1 3 2 2 0 1 1 4 M 1 1 2 3 1 0 2 3 2 1 2 1 5 0 2 1 1 1 1 1 3 1 1 4 F 2 3 3 3 2 3 3 3 1 0 0 3 0 6 4 2 2 1 3 1 3 3 1 4 P 1 2 2 1 3 1 1 2 2 3 3 1 2 4 7 1 1 4 3 2 2 1 2 4 S 1 1 1 0 1 0 0 0 1 2 2 0 1 2 1 4 1 3 2 2 0 0 0 4 T 0 1 0 1 1 1 1 2 2 1 1 1 1 2 1 1 5 2 2 0 1 1 0 4 W 3 3 4 4 2 2 3 2 2 3 2 3 1 1 4 3 2 11 2 3 4 3 2 4 Y 2 2 2 3 2 1 2 3 2 1 1 2 1 3 3 2 2 2 7 1 3 2 1 4 V 0 3 3 3 1 2 2 3 3 3 1 2 1 1 2 2 0 3 1 4 3 2 1 4 B 2 1 3 4 3 0 1 1 0 3 4 0 3 3 2 0 1 4 3 3 4 1 1 4 Z 1 0 0 1 3 3 4 2 0 3 3 1 1 3 1 0 1 3 2 2 1 4 1 4 X 0 1 1 1 2 1 1 1 1 1 1 1 1 1 2 0 0 2 1 1 1 1 1 4 * 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 1
(337) In this table, the first 20 columns (and the first 20 rows) labelled with single-letter amino acid codes represent the standard amino acids. The remaining columns/rows represent additional residue types (e.g., B for Asx (Asn/Asp), Z for Glx (Gln/Glu), X for any amino acid, and * for a translation stop encoded by a termination codon). If the sequences of interest have only a subset of these residues, then a corresponding sub-matrix of BLOSUM62 can also be alternatively sufficient for aligning them (e.g., the scores from the upper-left 2020 part of the scores if only standard amino acids that are singly-identified are of concern).
(338) As a demonstration of using BLOSUM62 in calculating an alignment score, if residues 1-8 of SEQ ID NO: 14 (EEVKAKVQ) were aligned with themselves, the alignment score would be the sum of scores for each of those amino acids pairing with itself (e.g., when residue A in the first sequence pairs with itself, an A, in the second sequence, it contributes a score of 4, as seen in the cell at row 2, column 2 of the BLOSUM62 matrix). Therefore, the alignment score in this hypothetical example would be 37 (5+5+4+5+4+5+4+5). If the A in the second sequence, in this hypothetical, is changed into a W, the alignment score would be 30 (5+5+4+5-3+5+4+5). If the E at residue one, or the K at residue four, or the Q at residue eight is deleted in the second sequence instead, in this hypothetical, the alignment score in each case would be 20 (the original total score of 37 is lessened by 5 due to the deleted residue, and there is an additional total gap penalty of 12 in this case, as explained further next). The total gap penalty is calculated by summing a gap extension penalty as multiplied by the number of residues in the gap with a gap-opening penalty. As an example, a gap-opening penalty of 11 and a gap extension penalty of 1 can be used. In that case, a single gap as in the last hypothetical example would result in a total gap penalty of 12 (11+1*1), regardless of whether the gap is internal or external, which can be the case for global-global alignments. If the gap were three amino acids long in the middle of a sequence, the total gap penalty would be 14 (11+1*3), which would be subtracted from of the scores of the aligning residues (identical as well as non-identical) to arrive at the alignment score.
(339) Using a substitution matrix such as BLOSUM62 is superior to cruder methods such as percent identity calculations, at least because different aligned identical residues can give different contributions to the overall score depending on how rare or common themselves or their mutations are (e.g., a W:W alignment contributes 11, as seen in Table B1, while an A:A alignment contributes only 4). In addition, mutations into different residues can also be treated differently with a substitution matrix (e.g., a D:E change has a positive score, 2, as seen in Table B1, while a D:L change has a negative score, 4, whereas each of these changes would be clumped as the same non-identical change in a percent-identity approach). Overall, using a substitution matrix like BLOSUM62 provides a dramatically more sensitive measure for inferring sequence relatedness than percent identity methods, since the matrix allows calibrating the score of changing each of the amino acids (e.g., 20) into each of the amino acids (e.g., 20) individually, while with percent identity the changes are limited to merely identical and non-identical ones. As a result, a polypeptide sequence defined with respect to its alignment to a reference sequence in terms of a Needleman-Wunsch score obtained by using BLOSUM62 matrix is significantly more likely to have structural features, physical properties, and functional features in common with the polypeptide of the reference sequence.
(340) For percent sequence identity values, the same alignment method (e.g., Needleman-Wunsch algorithm for global-global alignment, using BLOSUM62 matrix, with gap opening penalty of 11 and a gap extension penalty of 1) can be used to obtain the alignment, after which the pairs of aligned identical residues can be counted and then divided by the total length of the alignment (including gaps, internal as well as external) to arrive at the percent identity value. For percent similarity values, the same approach as for percent identity values can be used, except that what is counted, instead of pairs of identical residues, would be the aligned residue pairs with BLOSUM62 values that are not negative (i.e., >0).
(341) Numerous programs as well as websites exist for calculation of alignment scores. For example, executables for local use can be downloaded from the UVa FASTA Server (available from World Wide Web at fasta.bioch.virginia.edu/fasta_www2/fasta_list2.shtml). Among the programs available at the UVa FASTA server, ggsearch can perform global-global alignments (e.g., using Needleman-Wunsch algorithm, and BLOSUM62 matrix with gap opening penalty of 11 and a gap extension penalty of 1) and glsearch can perform global-local alignments. Similar functionality is also available through an online submission form at the same server (e.g., World Wide Web at fasta.bioch.virginia.edu/fasta_www2/fasta_www.cgi?rm=select&pgm=gnw, after selecting Align two sequences to align two sequences rather than one sequence against a database). Additional online sources for similar functionality include the National Center for Biotechnology Information (available through the World Wide Web at https://blast.ncbi.nlm.nih.gov/Blast.cgi) and the European Bioinformatics Institute of the European Molecular Biology Laboratory (available through the World Wide Web at https://www.ebi.ac.uk/Tools/sss/fasta/).
Biological Embodiments
(342) According to a first biological aspect of the current invention, there is provided a recombinant nucleic acid sequence for the improved expression and purification of functional ADAMTS-7.
(343) According to some first embodiments according to the first biological aspect, there is provided a recombinant nucleic acid for expression of an ADAMTS-7 polypeptide that comprises a rodent prodomain of ADAMTS-7 as a first portion and a functional human ADAMTS-7 as a second portion.
(344) Commercial expression and purification of recombinant functional ADAMTS-7 has so far been a challenge (cf.
(345) The constructs according to the first biological aspect are suited for the production of sufficient amounts of ADAMTS-7 with reproducible activity and purity. The resulting recombinant functional ADAMTS-7 can therefore be used in an assay for the identification and characterization of modulators of ADAMTS-7.
(346) In order to obtain a suitable construct for the expression of functional ADAMTS-7, more than 50 E. coli constructs, 20 constructs from Baculovirus and 30 HEK293 constructs were designed and evaluated to achieve the efficient expression of functional ADAMTS-7. The recombinant nucleic acid according to the first biological aspect surprisingly solved these problems and enabled the efficient expression and purification of functional ADAMTS-7 protein: In particular it was surprisingly found that a rodent prodomain is more effective in driving folding of the catalytic domain of human ADAMTS-7, thereby improving the yield of the soluble ADAMTS-7 proteins 10 fold (see example B2).
(347) In some embodiments according to the first biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion and a second portion, wherein the first portion has a sequence identity of >80% with the sequence of residues 1-217 of SEQ ID NO: 1 or with the sequence of residues 1-217 of SEQ ID NO: 2, and the second portion has a sequence identity of >80% with the sequence of residues 218-518 of SEQ ID NO: 1.
(348) In some embodiments according to the first biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion and a second portion, wherein the first portion has a sequence identity of >90% with the sequence of residues 1-217 of SEQ ID NO: 1 or with the sequence of residues 1-217 of SEQ ID NO: 2, and the second portion has a sequence identity of >90% with the sequence of residues 218-518 of SEQ ID NO: 1.
(349) In some embodiments according to the first biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion and a second portion, wherein the first portion has a sequence identity of >95% with the sequence of residues 1-217 of SEQ ID NO: 1 or with the sequence of residues 1-217 of SEQ ID NO: 2, and the second portion has a sequence identity of >95% with the sequence of residues 218-518 of SEQ ID NO: 1.
(350) In some embodiments according to the first biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion and a second portion, wherein the first portion has a sequence identity of >98% with the sequence of residues 1-217 of SEQ ID NO: 1 or with the sequence of residues 1-217 of SEQ ID NO: 2, and the second portion has a sequence identity of >98% with the sequence of residues 218-518 of SEQ ID NO: 1.
(351) In some embodiments according to the first biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion and a second portion, wherein the first portion comprises residues 1-217 of SEQ ID NO: 1 or residues 1-217 of SEQ ID NO: 2, and/or the second portion comprises residues 218-518 of SEQ ID NO: 1 (cf. example B1). In some embodiments the second portion is C-terminal to the first portion.
(352) In some embodiments according to the first biological aspect, the recombinant nucleic acid sequence encodes for a polypeptide that has a first portion and a second portion. The first portion of the polypeptide, in some embodiments, has an amino acid sequence that when aligned with an amino acid sequence of a ADAMTS-7 prodomain or a fragment thereof from a first species generates a Needleman-Wunsch score greater than 700, if BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used. In some embodiments, this generated Needleman-Wunsch score is greater than 750, 800, 850, 900, 950, 1000, 1050, or 1100. In some embodiments, the first portion and the ADAMTS-7 prodomain share a sequence identity that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97% or 98%. The second portion of the polypeptide, in some embodiments, has an amino acid sequence that when aligned with an amino acid sequence of a ADAMTS-7 catalytic domain or a fragment thereof from a second species generates a Needleman-Wunsch score greater than 1000 if BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used. In some embodiments, this generated Needleman-Wunsch score is greater than 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, or 1650. In some embodiments, the second portion and the ADAMTS-7 catalytic domain share a sequence identity that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97% or 98%.
(353) In some embodiments according to the first biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion having an amino acid sequence that aligns with an amino acid sequence of an ADAMTS-7 prodomain or a fragment thereof from a first species with a Needleman-Wunsch score greater than 700, when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used; and a second portion having an amino acid sequence that aligns with an amino acid sequence of a ADAMTS-7 catalytic domain or a fragment thereof from a second species with a Needleman-Wunsch score greater than 1000 when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used.
(354) In some embodiments, the first species is a non-human species, such as a rodent species, such as rat. In some different or the same embodiments the second species is human, e.g. the catalytic domain is derived from human ADAMTS-7. In some embodiments the first species is a rodent species and the second species is human.
(355) In some embodiments according to the first biological aspect the first portion of the polypeptide comprises a mutation within the furin cleavage site.
(356) In some embodiments the first portion comprises triple mutant R58A/R61A/R217A (rPro-hCD-3RA).
(357) According to some embodiments of the first biological aspect the recombinant nucleic acid sequence encodes at least for a rat pro-domain of ADAMTS-7 (SEQ ID No. 1, residues 1-217) and a catalytic domain of human ADAMTS-7, wherein optionally within the rat pro-domain of ADAMTS-7 the motif RQQR is mutated to RQKR (SEQ ID No. 2, cf. residues 1-217). In some of these embodiments said rat pro-domain of ADAMTS-7 comprises or consists of a sequence according to SEQ ID No. 1, residues 1-217 or SEQ ID No. 2, residues 1-217 and/or said catalytic domain of human ADAMTS-7 comprises or consists of a sequence according to SEQ ID No. 1, residues 218-518 or SEQ ID No. 2, residues 218-518.
(358) In some embodiments the polypeptide or a fragment thereof encoded by the recombinant nucleic acid is suited to cleave a peptide comprising standard residues 1-15 of the amino acid sequence of SEQ ID NO: 4. For example, the polypeptide is suited to cleave a peptide comprising standard residues 1-15 of the amino acid sequence of SEQ ID NO: 4 and/or SEQ ID No. 11 with a kcat/KM of at least 20% of a corresponding kcat/KM of human ADAMTS-7.
(359) The produced polypeptide (e.g., having both the first portion and the second portion, or having only the second portion) can have a catalytic activity close to that of human ADAMTS-7 enzyme, e.g., in terms of kcat/KM, which can be even higher than the kcat/KM of the human enzyme, or can be within 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, or 5% of the kcat/KM of the human enzyme, for example when a peptide having the sequence of SEQ ID No. 11 is used as the substrate.
(360) In some embodiments, for a given substrate, the produced polypeptide (e.g., having both the first portion and the second portion, or having only the second portion) has a catalytic activity in the same order of magnitude as rat ADAMTS-7, e.g., in terms of kcat, cf.
(361) Sequential cleavage or processing of ADAMTS-7 at furin cleavage sites by cellular enzyme furin leading to a complete removal of the Pro domain from the rest of the protein is likely a necessary step to a fully active or mature ADAMTS-7.
(362) In some embodiments the recombinant nucleic acid sequence furthermore encodes for additional residues, such as a purification tag, such as a FLAG tag, a His tag, a Strep tag or any combination or repetition thereof. In some embodiments of the first biological aspect, the encoded polypeptide can have additional residues (e.g., purification tags such as His tag, Strep tag, 2Strep tag, FLAG tag, 3FLAG tag, and cleavage sequences such as TEV cleavage site). The presence of these additional residues is compatible with each of the described embodiments of the biological aspect. Purification of a polypeptide obtained from a nucleic acid according to the current invention can occur as described in example B3.
(363) The recombinant nucleic acid according to the first biological aspect can be used for the expression of functional ADAMTS7 as described in example B3. For example, the construct can be inserted into a plasmid which is compatible with a certain expression system. In certain preferred embodiments the construct can be cloned into a plasmid, preferably into a mammalian expression vector, such as pcDNA6mycHis. Expression can be performed in a compatible expression system, such as in a mammalian expression system, such as in HEK cells or Expi293 cells as known in the art. The Gibco Expi293 Expression System is a commercially available high-yield transient expression system based on suspension-adapted Human Embryonic Kidney (HEK) cells.
(364) According to a second biological aspect of the current invention, there is provided a recombinant nucleic acid for the expression of functional ADAMTS-12. It was surprisingly found that human ADAMTS-12 expression is improved when a non human prodomain is used (cf. example B9, cf.
(365) According to some first embodiments according to the second biological aspect, there is provided a recombinant nucleic acid for expression of an ADAMTS-12 polypeptide that comprises a rodent prodomain of ADAMTS-12 as a first portion and a functional human ADAMTS-12 as a second portion.
(366) In some embodiments according to the second biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion and a second portion, wherein the first portion has a sequence identity of >80% with the sequence of residues 1-244 of SEQ ID NO: 15, and the second portion has a sequence identity of >80% with the sequence of residues 245-547 of SEQ ID NO: 15 (cf. 241-544 of ADAMTS12).
(367) For example, ADAMTS12 rat/human hybrid can be made by fusing respective rat ADAMTS12 SP-Pro (1-244) followed by human ADAMTS12 CD (241-544).
(368) In some embodiments according to the second biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion and a second portion, wherein the first portion has a sequence identity of >90% with the sequence of residues 1-244 of SEQ ID NO: 15, and the second portion has a sequence identity of >90% with the sequence of residues 245-547 of SEQ ID NO: 15.
(369) In some embodiments according to the second biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion and a second portion, wherein the first portion has a sequence identity of >95% with the sequence of residues 1-244 of SEQ ID NO: 15, and the second portion has a sequence identity of >95% with the sequence of residues 245-547 of SEQ ID NO: 15.
(370) In some embodiments according to the second biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion and a second portion, wherein the first portion has a sequence identity of >98% with the sequence of residues 1-244 of SEQ ID NO: 15, and the second portion has a sequence identity of >98% with the sequence of residues 245-547 of SEQ ID NO: 15.
(371) In some embodiments, according to the second biological aspect, the recombinant nucleic acid sequence encodes for a recombinant polypeptide that comprises a first portion and a second portion, wherein the first portion comprises residues 1-244 of SEQ ID NO: 15, and/or the second portion comprises residues 245-547 of SEQ ID NO: 15. In some different or the same embodiments the second portion is immediately C-terminal to the first portion.
(372) In some embodiments according to the second biological aspect, the recombinant nucleic acid encodes a polypeptide that has a first portion and a second portion. The first portion of the polypeptide, in some embodiments, has an amino acid sequence that when aligned with an amino acid sequence of an ADAMTS-12 prodomain (or a fragment thereof) from a first species generates a Needleman-Wunsch score greater than 800 if BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used. In some embodiments, this generated Needleman-Wunsch score is greater than 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, or 1300. In some embodiments, the first portion and the ADAMTS-12 prodomain share a sequence identity that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97% or 98%. The second portion of the polypeptide, in some embodiments, has an amino acid sequence that when aligned with an amino acid sequence of a human ADAMTS-12 catalytic domain (or a fragment thereof) generates a Needleman-Wunsch score greater than 1000 if BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used. In some embodiments, this generated Needleman-Wunsch score is greater than 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, or 1650. In some embodiments, the second portion and the ADAMTS-12 catalytic domain share a sequence identity that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97% or 98%.
(373) In some embodiments according to the second biological aspect, the recombinant nucleic acid for expression of an ADAMTS-12 polypeptide encodes for a recombinant polypeptide that comprises a first portion having an amino acid sequence that aligns with an amino acid sequence of a ADAMTS-12 prodomain or a fragment thereof from anon-human species with a Needleman-Wunsch score greater than 800 when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used; and a second portion having an amino acid sequence that aligns with an amino acid sequence of a ADAMTS-12 catalytic domain or a fragment thereof from a second species with a Needleman-Wunsch score greater than 1000 when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used.
(374) In some embodiments, the first species is a non-human species, such as a rodent species, such as rat. In some different or the same embodiments the second species is human, e.g. the catalytic domain is derived from human ADAMTS-12. In some embodiments the first species is a rodent species and the second species is human.
(375) In some embodiments the second portion comprises a mutation at position E393, such as E393Q (EQ). This mutation results in increased protein yield similar to ADAMTS-7 catalytic mutations. Mutation numbering E393Q follows the species based positions for the human ADAMTS12 region of the construct, i.e. rat ADAMTS12 SP-Pro (1-244) followed by human ADAMTS12 CD (241-544).
(376) In some embodiments the polypeptide or a fragment thereof encoded by the recombinant nucleic acid is suited to cleave a peptide comprising standard residues 1-15 of the amino acid sequence of SEQ ID NO: 4. For example, in some embodiments the polypeptide is suited to cleave a peptide comprising standard residues 1-15 of the amino acid sequence of SEQ ID NO: 4 and/or SEQ ID No. 11 with a kcat/KM of at least 20% of a corresponding kcat/KM of human ADAMTS-12.
(377) The produced polypeptide (e.g., having both the first portion and the second portion, or having only the second portion) can have a catalytic activity close to that of human ADAMTS-12 enzyme (e.g., in terms of kcat/KM, which can be even higher than the kcat/KM of the human enzyme, or can be within 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, or 5% of the kcat/KM of the human enzyme, for example when a peptide having the sequence of SEQ ID No. 4 or 11 is used as the substrate.
(378) In some embodiments the recombinant nucleic acid sequence furthermore encodes for additional residues such as a purification tag, such as a FLAG tag, a His tag, a Strep tag or any combination or repetition thereof. In some embodiments of the second biological aspect, the encoded polypeptide can have additional residues (e.g., purification tags such as His tag, Strep tag, 2Strep tag, FLAG tag, 3FLAG tag, and cleavage sequences such as TEV cleavage site). The presence of these additional residues is compatible with each of the described embodiments of the biological aspect. Purification of the functional ADAMTS-12 obtained from a recombinant nucleic acid according to the current invention can occur as described in example B4.
(379) According to some embodiments of the second biological aspect the recombinant nucleic acid sequence encodes at least for a rat pro-domain of ADAMTS-12, such as amino acids 1-244 of rat sequence UniProt D3ZTJ3 and/or encodes for a catalytic domain of human ADAMTS-12, such as amino acids 241-543 of human sequence UniProt P58397, cf. example B1. In certain preferred embodiments said recombinant nucleic acid encodes for a sequence according to SEQ ID No. 15.
(380) The recombinant nucleic acid according to the second biological aspect can be used for the expression of functional ADAMTS-12 as described in example B4. For example, the recombinant nucleic acid can be inserted into a plasmid which is compatible with a certain expression system.
(381) In certain preferred embodiments the construct can be inserted into a plasmid, preferably into a mammalian expression vector, such as pcDNA3.4. Expression can be performed in a compatible expression system, such as in a mammalian expression system, such as in HEK cells or Expi293 cells as known in the art. The Gibco Expi293 Expression System is a commercially available high-yield transient expression system based on suspension-adapted Human Embryonic Kidney (HEK) cells.
(382) According to a third biological aspect of the current invention, there is provided a recombinant polypeptide, wherein the recombinant polypeptide is the recombinant polypeptide encoded by a recombinant nucleic acid according to the first or second biological aspect, or a fragment thereof. In some embodiments the fragment is the processed polypeptide which results after Furin cleavage. In some embodiments, the Furin cleavage occurs at the site known in the art or described herein.
(383) In some embodiments the recombinant polypeptide according to the third biological aspect or a fragment thereof is suited to cleave a peptide substrate comprising standard residues 1-15 of SEQ ID NO: 4. The recombinant polypeptide according to the third biological aspect or a fragment thereof can be used in an assay for the identification and characterization of modulators of ADAMTS-7 and/or ADAMTS-12, as shown within the examples.
(384) In some embodiments, the recombinant polypeptide according to the third biological aspect or a fragment thereof is a functional ADAMTS-7 protein. In some embodiments the polypeptide comprises a rodent prodomain of ADAMTS-7 as a first portion and afunctional human ADAMTS-7 as a second portion.
(385) In some embodiments the polypeptide comprises a first portion and a second portion, wherein the first portion has a sequence identity of >80% with the sequence of residues 1-217 of SEQ ID NO: 1 or with the sequence of residues 1-217 of SEQ ID NO: 2, and the second portion has a sequence identity of >80% with the sequence of residues 218-518 of SEQ ID NO: 1.
(386) In some embodiments according to the third biological aspect, the recombinant polypeptide comprises a first portion having an amino acid sequence that aligns with an amino acid sequence of an ADAMTS-7 prodomain or a fragment thereof from a first species with a Needleman-Wunsch score greater than 700, when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used; and a second portion having an amino acid sequence that aligns with an amino acid sequence of a ADAMTS-7 catalytic domain or a fragment thereof from a second species with a Needleman-Wunsch score greater than 1000 when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used. In some embodiments the first species is a rodent species such as rat and the second species is human.
(387) In some embodiments the first portion of the polypeptide comprises a mutation within the furin cleavage site. In some embodiments, the motif RQQR within the first portion of the polypeptide is altered, preferably into RQKR. Thus, in some embodiments the first portion comprises a mutation, e.g. at position 216, such as the mutation Q216K. This mutation was found to improve cleavage by Furin between the prodomain and the catalytic domain of ADAMTS-7, thereby leading to improved yields of processed ADAMTS-7 compared to the wild type (WT). (cf. example B1, cf.
(388) In some embodiments the polypeptide comprises a rodent prodomain of ADAMTS-12 as a first portion and a functional human ADAMTS-12 as a second portion.
(389) In some embodiments the polypeptide comprises a first portion and a second portion, wherein the first portion has a sequence identity of >80% with the sequence of residues 1-244 of SEQ ID NO: 15, and the second portion has a sequence identity of >80% with the sequence of residues 245-547 of SEQ ID NO: 15.
(390) In some embodiments according to the current biological aspect, the polypeptide comprises a first portion having an amino acid sequence that aligns with an amino acid sequence of a ADAMTS-12 prodomain or a fragment thereof from a first species with a Needleman-Wunsch score greater than 800 when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used; and a second portion having an amino acid sequence that aligns with an amino acid sequence of a ADAMTS-12 catalytic domain or a fragment thereof from a second species with a Needleman-Wunsch score greater than 1000 when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used. In some embodiments, the first species is a non-human species, such as a rodent species, such as rat. In some different or the same embodiments the second species is human, e.g. the catalytic domain is derived from human ADAMTS-12. In some embodiments the first species is a rodent species and the second species is human.
(391) In some embodiments the second portion comprises a mutation at position E393, such as E393Q (EQ). This mutation results in increased protein yield.
(392) In some embodiments the polypeptide (e.g., having both the first portion and the second portion, or having only the second portion) has a catalytic activity close to that of human ADAMTS-7 or ADAMTS-12 enzyme (e.g., in terms of kcat/KM, which can be even higher than the kcat/KM of the human enzyme, or can be within 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, or 5% of the kcat/KM of the human enzyme, for example when a peptide having the sequence of of SEQ ID No. 4 or 11 is used as the substrate.
(393) In some embodiments the polypeptide or a fragment thereof is suited to cleave a peptide comprising standard residues 1-15 of the amino acid sequence of SEQ ID NO: 4. In some embodiments, the polypeptide is suited to cleave a peptide comprising standard residues 1-15 of the amino acid sequence of SEQ ID NO: 4 and/or SEQ ID No. 11 with a kcat/KM of at least 20% of a corresponding kcat/KM of human ADAMTS-7 or human ADAMTS-12.
(394) In some embodiments the polypeptide comprises a purification tag, such as a FLAG tag, a His tag, a Strep tag or any combination or repetition thereof. In some embodiments of the first biological aspect, the encoded polypeptide can have additional residues (e.g., purification tags such as His tag, Strep tag, 2Strep tag, FLAG tag, 3FLAG tag, and cleavage sequences such as TEV cleavage site). The presence of these additional residues is compatible with each of the described embodiments of the biological aspect.
(395) Surprisingly, the recombinant polypeptide according to the current biological aspect was found to fold into a functional ADAMTS, e.g. ADAMTS-7 or ADAMTS-12. Expression and purification of recombinant functional ADAMTS protein according to the third biological aspect can occur as described in example B3.
(396) According to a fourth biological aspect of the current invention there is provided a recombinant peptide substrate for ADAMTS-7 and/or ADAMTS-12. The peptide substrate according to the current invention can be used as an artificial substrate for ADAMTS-7 and/or ADAMTS-12. The peptide substrate can furthermore be used in order to determine the proteolytic activity of ADAMTS-7 and/or ADAMTS-12, identify modulators of ADAMTS-7 and/or ADAMTS-12, and/or to determine the degree of modulation induced by an agonist or antagonist.
(397) In some embodiments the peptide substrate comprises a subsequence of a natural ADAMTS-7 and/or ADAMTS-12 substrate, such as a subsequence of TSP1 or COMP. In some embodiments, the peptide substrate according to the fourth biological aspect comprises at least a sequence according to any of SEQ ID No. 4, 5, 8, 11, 12 or 13, or a fragment thereof comprising the amino acids EL. It was surprisingly found that theses sequences can be used as cleavage site for ADAMTS-7 and ADAMTS-12: For example, the sequence DELSSMVLELRGLRT, derived from TSP1, residues 275-289 has been surprisingly identified as a suitable substrate for ADAMTS-7 and ADAMTS-12. Without being bound by theory, cleavage occurs between Glu283 and Leu284 (EL).
(398) In some embodiments the peptide substrate comprises (a) residues 1-15 of the amino acid sequence of SEQ ID NO: 4, or (b) residues 1-15 of the amino acid sequence of SEQ ID NO: 5, or (c) residues 1-13 of the amino acid sequence of SEQ ID NO: 8, or (d) a fragment of any of the sequences according to a), b) or c), the fragment comprising the amino acid sequence EL.
(399) In some embodiments, the peptide substrate according to the fourth biological aspect comprises at least the amino acids EL. In some embodiments, the peptide substrate according to the fourth biological aspect comprise at least the SEQ ID No. 4, or a fragment thereof comprising the amino acids EL. In some embodiments, the peptide substrate according to the fourth biological aspect comprises at least the SEQ ID No. 5, or a fragment thereof comprising the amino acids EL. In some embodiments, the peptide substrate according to the fourth biological aspect comprises at least the SEQ ID No. 8, or a fragment thereof comprising the amino acids EL.
(400) In some embodiments, the peptide substrate according to the fourth biological aspect comprises at least the SEQ ID No. 11, 12 or 13 or a fragment thereof comprising the amino acids EL. It was surprisingly found that the solubility of the described peptide substrate according to the fourth biological aspect could be improved by including an additional hydrophilic moiety without affecting the activity profile (cf. SEQ ID No. 11, 12, 13).
(401) In some embodiments the peptide substrate according to the fourth biological aspect comprises a first moiety conjugated to a residue that is N-terminal to sequence fragment EL as comprised within SEQ ID No. 4, 5, or 8 or the fragment thereof, and a second moiety conjugated to a residue that is C-terminal to said sequence fragment EL. In some embodiments the first moiety comprises a fluorophore and the second moiety comprises a quencher, or the first moiety comprises a quencher and the second moiety comprises a fluorophore.
(402) Without being bound by theory, the fluorophore of the peptide substrate can be excited at a suitable wavelength, e.g. by exposing it to light. The suitability of a wavelength depends on the specific fluorophore and can be determined as known in the art. Without being bound by theory, the excited fluorophore transfers the energy to the closely located quencher, which has the ability to decrease the fluorescence intensity of the fluorophore, such that no fluorescence or only background fluorescence is detected at the emission wavelength of the fluorophore. If the peptide substrate according to the current invention is however exposed to or contacted with a functional ADAMTS-7 or ADAMTS-12, the enzyme cleaves the peptide, thereby separating fluorophore and quencher. In the absence of the quencher, the excited fluorophore emits light in returning to the ground state and an increase in fluorescence can be detected.
(403) Using a combination of functional ADAMTS-7 and the peptide substrate comprising a fluorophore and a quencher according to the fourth biological aspect as a substrate thus allows for the robust and reproducible identification and characterization of ADAMTS-7 modulators and/or ADAMTS-12 modulators.
(404) The skilled person understands that according to the various biological aspects and embodiments of the current invention, multiple sites can be used to attach the fluorophore and the quencher to the peptide as long as a) the distance between fluorophore and quencher allows for the transfer of energy between fluorophore and quencher and b) the ADAMTS-7 cleavage site is arranged in such a way that fluorophore and quencher are separated upon ADAMTS-7 cleavage of the peptide. The latter effect can be obtained by interposing the ADAMTS-7 cleavage site between the fluorophore and the quencher.
(405) A variety of suitable pairs of fluorophores and quenchers have been described in the literature. The skilled person is well aware which pairs of fluorophore and quencher can be combined. To obtain a peptide according to the biological aspect at hand, the distance between fluorophore and quencher has to be adjusted to allow for the necessary transfer of energy as described herein. The specific distance depends on the specific selection of fluorophore and quencher and can be adjusted as known in the art. For example in some embodiments according to the biological aspect at hand, EDANS as a fluorophore can be paired with DABCYL or DABSYL as a quencher. When EDANS and DABCYL are in a close proximity (10-100 ), the energy emitted from EDANS will be quenched by Dabcyl, resulting in low or no fluorescence. However, if the compounds are separated EDANS will fluoresce. The optimal absorbance and emission wavelengths of EDANS are abs=336 nm and em=490 nm respectively, and for Dabcyl, the maximum absorbance wavelength is abs=472 nm, which, to a large extent, overlap with the emission spectra of EDANS.
(406) Another pair of fluorophore and quencher where the compounds can be used alone or in combination is 7-methoxy-coumarin-4-yl acetic acid (MCA) as the fluorophore with Lys(DNP) as a quencher. In some preferred embodiments according to the biological aspect at hand the fluorophore is MCA and the quencher is Lys(DNP). A further pair which can be used according to the current invention comprises 7-amino-4-carbamoylmethylcoumarin (ACC) as the fluorophore and 2,4-dinitrophenyl-lysine (Lys(DNP)) as the quencher. In some preferred embodiments according to the biological aspect at hand the fluorophore is ACC and the quencher is Lys(DNP). Another pair of fluorophore and quencher that can be used alone or in combination is HiLyteFluor, e.g. HiLyteFluor-488 as the fluorophore with QXL, e.g. QXL520 as a quencher. HiLyte Fluor fluorophores are commercially available for various wavelengths and can be prepared as known in the art (Jungbauer, L M et al. Preparation of fluorescently-labeled amyloid-beta peptide assemblies: the effect of fluorophore conjugation on structure and function Journal of molecular recognition: JMR vol. 22.5 (2009): 403-13.). QXL quenchers are commercially available for various wavelengths and can be prepared as known in the art. QXL 570 dyes are optimized quenchers for rhodamines (such as TAMRA, sulforhodamine B, ROX) and Cy3 fluorophores. Their absorption spectra overlap with the fluorescence spectra of TAMRA, sulforhodamine B, ROX and Cy3.
(407) According to some embodiments according to the fourth biological aspect said fluorophore is HiLyteFluor, such as HiLyteFluor-488 and the quencher is a matching QXL quencher, such as QXL520.
(408) According to some embodiments according to the fourth biological aspect said peptide substrate comprises or consists of a subsequence of a natural ADAMTS-7 and/or ADAMTS-12 substrate, such as a subsequence of TSP1 or COMP, such as (a) residues 1-15 of the amino acid sequence of SEQ ID NO: 4, or (b) residues 1-15 of the amino acid sequence of SEQ ID NO: 5, or (c) residues 1-13 of the amino acid sequence of SEQ ID NO: 8, or (d) a fragment of any of the sequences according to a), b) or c), the fragment comprising the amino acid sequence EL, said fluorophore is HiLyteFluor, such as HiLyteFluor-488 and the quencher is a matching QXL quencher such as QXL520.
(409) According to some embodiments according to the fourth biological aspect said peptide substrate comprises or consists of a subsequence of a natural ADAMTS-7 and/or ADAMTS-12 substrate, such as a subsequence of TSP1 or COMP, such as (a) residues 1-15 of the amino acid sequence of SEQ ID NO: 4, or (b) residues 1-15 of the amino acid sequence of SEQ ID NO: 5, or (c) residues 1-13 of the amino acid sequence of SEQ ID NO: 8, or (d) a fragment of any of the sequences according to a), b) or c), the fragment comprising the amino acid sequence EL, said fluorophore is MCA and said quencher is Lys(DNP).
(410) According to some embodiments according to the fourth biological aspect said peptide substrate comprises or consists of a subsequence of a natural ADAMTS-7 and/or ADAMTS-12 substrate, such as a subsequence of TSP1 or COMP, such as (a) residues 1-15 of the amino acid sequence of SEQ ID NO: 4, or (b) residues 1-15 of the amino acid sequence of SEQ ID NO: 5, or (c) residues 1-13 of the amino acid sequence of SEQ ID NO: 8, or (d) a fragment of any of the sequences according to a), b) or c), the fragment comprising the amino acid sequence EL, said fluorophore is ACC and said quencher is Lys(DNP).
(411) In some embodiments, the fluorophore, such as HiLyte fluor488 is attached to the N-terminus of the peptide and the quencher, such as QXL520, is attached to the C-terminus or vice versa.
(412) In certain preferred embodiments according to the biological aspect at hand, an additional negative residue, such as carboxyl position glutamic acid is attached C-terminal of the quencher, e.g. after the QXL520 quencher. The addition of the residue improved the solubility behavior of the peptide substrate and thereby lead to an improved reproducibility of the assay.
(413) According to some embodiments according to the biological aspect at hand said peptide substrate for ADAMTS-7 and/or ADAMTS-12 comprises or consists of a subsequence of a natural ADAMTS-7 substrate, such as a subsequence of TSP1 or COMP, such as (a) residues 1-15 of the amino acid sequence of SEQ ID NO: 4, or (b) residues 1-15 of the amino acid sequence of SEQ ID NO: 5, or (c) residues 1-13 of the amino acid sequence of SEQ ID NO: 8, or (d) a fragment of any of the sequences according to a), b) or c), the fragment comprising the amino acid sequence EL, and the peptide substrate is further characterized in comprising an additional negatively charged residue such as a carboxyl position glutamic acid, e.g. C-terminal of the quencher.
(414) According to some embodiments according to the biological aspect at hand said peptide substrate for ADAMTS-7 and/or ADAMTS-12 comprises or consists of a subsequence of a natural ADAMTS-7 substrate, such as a subsequence of TSP1 or COMP, such as (a) residues 1-15 of the amino acid sequence of SEQ ID NO: 4, or (b) residues 1-15 of the amino acid sequence of SEQ ID NO: 5, or (c) residues 1-13 of the amino acid sequence of SEQ ID NO: 8, or (d) a fragment of any of the sequences according to a), b) or c), the fragment comprising the amino acid sequence EL, said fluorophore is HiLyteFluor, such as HiLyteFluor-488, said quencher is a matching QXL quencher such as QXL520 and the peptide substrate is further characterized in comprising an additional negatively charged residue such as a carboxyl position glutamic acid, e.g. C-terminal of the quencher.
(415) According to a fifth biological aspect of the current invention there is provided a method for the identification or characterization of an ADAMTS-7 and/or ADAMTS-12 modulator comprising the steps of a) contacting a recombinant polypeptide or a fragment thereof according to the third biological aspect, and b) contacting said recombinant polypeptide or fragment thereof with a peptide substrate according to the fourth biological aspect, wherein the peptide substrate comprises a fluorophore and a quencher, and c) detecting fluorescence as a measure for the activity of said recombinant polypeptide or a fragment thereof.
(416) In some embodiments, the recombinant polypeptide is suited to cleave a peptide comprising standard residues 1-15 of the amino acid sequence of SEQ ID NO: 4.
(417) In some embodiments, the recombinant polypeptide comprises a first portion and a second portion, the first portion having a sequence identity of at least 80% with the sequence of residues 1-217 of SEQ ID NO: 1 and/or having a sequence identity of at least 80% with the sequence of residues 1-217 of SEQ ID NO: 2, and the second portion having a sequence identity of >80% with the sequence of residues 218-518 of SEQ ID NO: 1 and the peptide substrate comprises (a) residues 1-15 of the amino acid sequence of SEQ ID NO: 4, or (b) residues 1-15 of the amino acid sequence of SEQ ID NO: 5, or (c) residues 1-13 of the amino acid sequence of SEQ ID NO: 8, or (d) a fragment of any of the sequences according to a), b) or c), the fragment comprising the amino acid sequence EL.
(418) In some embodiments, the recombinant polypeptide comprises a first portion and a second portion, the first portion having a sequence identity of >80% with the sequence of residues 1-244 of SEQ ID NO: 15, and the second portion having a sequence identity of >80% with the sequence of residues 245-547 of SEQ ID NO: 15 and the peptide substrate comprises (a) residues 1-15 of the amino acid sequence of SEQ ID NO: 4, or (b) residues 1-15 of the amino acid sequence of SEQ ID NO: 5, or (c) residues 1-13 of the amino acid sequence of SEQ ID NO: 8, or (d) a fragment of any of the sequences according to a), b) or c), the fragment comprising the amino acid sequence EL.
(419) In some embodiments, the recombinant polypeptide comprises a sequence according to SEQ ID No. 01, SEQ ID No. 02 or SEQ ID No. 15 and/or the peptide substrate comprises (a) residues 1-15 of the amino acid sequence of SEQ ID NO: 4, or (b) residues 1-15 of the amino acid sequence of SEQ ID NO: 5, or (c) residues 1-13 of the amino acid sequence of SEQ ID NO: 8, or (d) a fragment of any of the sequences according to a), b) or c), the fragment comprising the amino acid sequence EL, and optionally comprises a further carboxy group.
(420) Contacting of different compounds can be performed by preparing a solution comprising the respective compounds, e.g. in an appropriate concentration, e.g. as described in the examples. The test compound can be any molecule, such as any small molecule provided for throughout this application.
(421) There is no specific order with regard to the steps of the method, except for the obvious restrictions resulting from the mode of action. In some embodiments the method according to the biological aspect at hand is further characterized in that step c) is performed for a solution comprising said recombinant polypeptide, said test compound, and said peptide substrate.
(422) In some embodiments, the method according to the biological aspect at hand can be used to determine the half maximal inhibitory concentration (IC50) or the half maximal effective concentration (EC50) of an ADAMTS-7 and/or ADAMTS-12 modulator. According to the FDA, IC50 represents the concentration of a drug that is required for 50% inhibition in vitro. The determined IC50 as described herein is a measure of the potency of the test compound in inhibiting ADAMTS-7 and/or ADAMTS-12 induced cleavage of a natural or artificial substrate. Half maximal effective concentration (EC50) refers to the concentration of a test compound which induces a response halfway between the baseline and maximum after a specified exposure time and can be used as a measure of agonistic potency of a compound. IC50 and EC50 can be determined as known in the art. In brief, the IC50 of a drug can be determined by constructing a dose-response curve and analyzing the resulting fluorescence for different concentrations of the test compound.
(423) In some embodiments according to the fifth biological aspect a test compound can be or is selected as a modulator (e.g. agonist or inhibitor) if after contacting the recombinant polypeptide with the at least one test compound according to step a) and after contacting said recombinant polypeptide with a peptide substrate according to step b) no significant increase of fluorescence is detected or if an increase of fluorescence is detected which is significantly lower than the increase of fluorescence which is detectable for a control in the absence of the test compound. In some embodiments according to the fifth biological aspect a test compound is selected as an ADAMTS-7 and/or ADAMTS-12 agonist if after contacting the recombinant polypeptide with the at least one test compound according to step a) and after contacting said recombinant polypeptide with a peptide substrate according to step b) an increase of fluorescence is detected which is significantly higher than the increase of fluorescence which is detectable for a control in the absence of the test compound. An exemplary way how the method can be performed is described in example B5.
(424) According to some embodiments according to the current biological aspect there is provided a method for evaluating the selectivity of an ADAMTS-7 and/or ADAMTS-12 modulator comprising the method according to the fifth biological aspect further characterized in comprising the steps of a) contacting a functional recombinant metalloproteinase different from ADAMTS-7 and ADAMTS-12 with the at least one test compound, and b) contacting said functional recombinant metalloproteinase with a peptide substrate comprising a fluorophore and a quencher, wherein said peptide substrate comprises a cleavage site for said functional recombinant metalloproteinase different from ADAMTS-7 and/or ADAMTS-12; and c) detecting the fluorescence as a measure for the activity of functional recombinant metalloproteinase different from ADAMTS-7 and ADAMTS-12.
(425) In certain preferred embodiments, the functional recombinant metalloproteinase different from ADAMTS-7 and ADAMTS-12 is ADAMTS4, ADAMTS5, MMP12, MMP15, MMP2 or ADAM17 or any other enzyme listed in table 2. In some preferred embodiments, the peptide comprising a fluorophore and a quencher is the peptide as specified in table 2 and/or comprises a cleavage site of said functional recombinant metalloproteinase different from ADAMTS-7 and/or ADAMTS-12 as disclosed in table 2.
(426) For characterization of the inhibition, based on the fluorescence IC50 values can be calculated from percentage of inhibition of enzyme activity as a function of test compound concentration.
(427) According to a sixth biological aspect there is provided a modulator of ADAMTS-7 and/or ADAMTS-12 identified by a method according to the fifth biological aspect for use in the treatment of heart disease, vascular disease, and/or cardiovascular disease, including atherosclerosis, coronary artery disease (CAD), myocardial infarction (MI), peripheral vascular disease (PAD)/arterial occlusive disease and/or restenosis after angioplasty (including the use of drug-coated or non drug-coated balloons and/or stent-implantation) and/or for the treatment and/or prophylaxis of lung disease, inflammatory disease, fibrotic disease, metabolic disease, cardiometabolic disease and/or diseases/disease states affecting the kidneys and/or the central nervous and/or neurological system as well as gastrointestinal and/or urologic and/or ophthalmologic disease/disease states.
(428) For these diseases or disease states, alterations or aberrant expression with regard to ADAMTS-7 and/or ADAMTS-12 have been described earlier. In some embodiments the modulator of ADAMTS-7 and/or ADAMTS-12 is a modulator for use in the treatment of coronary artery disease (CAD), peripheral vascular disease (PAD) and myocardial infarction (MI). In some embodiments, the modulator according to the sixth biological aspect is a small molecule. In some embodiments, the modulator according to the seventh biological aspect is an antagonist of human ADAMTS-7. In some different or the same embodiments, the modulator according to the sixth biological aspect is an antagonist of human ADAMTS-12. In some different or the same embodiments, the modulator according to the sixth biological aspect is an antagonist of human ADAMTS4. In some embodiments the modulator according to the sixth biological aspect is a small molecule, e.g. as provided in the examples. While the identification of selective ADAMTS-7 and ADAMTS-12 modulators has been extremely challenging in the past, the provided assay now offers all means to obtain these moulators according to the current biological aspect.
(429) According to a seventh biological aspect there is provided a method of producing a recombinant polypeptide according to any of the previous biological aspects, the method comprising cultivating a recombinant host cell comprising a recombinant nucleic acid according to any biological aspect described herein and recovering the recombinant polypeptide of a fragment thereof.
(430) According to an eighth biological aspect there is provided a kit of parts comprising a recombinant nucleic acid according to the first and/or second biological aspect and/or a polypeptide according to the third biological aspect and a peptide substrate according to the fourth biological aspect. In some embodiments the kit of parts can be used to perform a method according to the fifth biological aspect in a convenient and reproducible way. In some embodiments the provided kit of parts can be used to evaluate whether a test molecule is a modulator of ADAMTS-7. In some different or the same embodiments the provided kit of parts can be used to evaluate whether a test molecule is a modulator of ADAMTS-12. In some embodiments the provided kit of parts can be used to evaluate whether a test molecule is a modulator of ADAMTS-7 and a modulator of ADAMTS-12.
(431) Experimental SectionStarting Materials and Intermediates
(432) NMR Analytical Method:
(433) Where indicated, intermediates and examples were characterized by .sup.1H NMR with a 300 MHz spectrometer. Spectra were recorded on a Bruker Ultrashield AV300 MHz spectrometer, with a Bruker 5 mm BBI 1H/D-BB Z-GRD probe, using a BACS-60 sample changer, and registered with Bruker Topspin 2.1 software. For the .sup.1H spectra, all chemical shifts are reported in part per million () units, and are relative to the residual signal at 7.26 and 2.50 ppm for CDCl.sub.3 and DMSO, respectively, at 25 C.
(434) NMR peak forms are stated as they appear in the spectra, possible higher order effects have not been considered.
(435) The .sup.1H NMR data of selected synthesis intermediates and working examples are stated in the form of .sup.1H NMR peak lists. For each signal peak, first the [ppm]=value in ppm and then the signal intensity in round brackets are listed. The [ppm]=value/signal intensity number pairs for different signal peaks are listed with separation from one another by commas. The peak list for an example therefore takes the following form: [ppm]=1 (intensity.sub.1), [ppm]=2 (intensity.sub.2), . . . , [ppm]=.sub.i(intensity.sub.i), . . . , [ppm]=.sub.n(intensity.sub.n).
(436) The intensity of sharp signals correlates with the height of the signals in a printed example of an NMR spectrum in cm and shows the true ratios of the signal intensities in comparison with other signals. In the case of broad signals, several peaks or the middle of the signal and the relative intensity thereof may be shown in comparison to the most intense signal in the spectrum. The lists of the .sup.1H NMR peaks are similar to the conventional .sup.1H NMR printouts and thus usually contain all peaks listed in a conventional NMR interpretation. In addition, like conventional .sup.1H NMR printouts, they may show solvent signals, signals of stereoisomers of the target compounds which are likewise provided by the invention, and/or peaks of impurities. The peaks of stereoisomers of the target compounds and/or peaks of impurities usually have a lower intensity on average than the peaks of the target compounds (for example with a purity of >90%). Such stereoisomers and/or impurities may be typical of the particular preparation process. Their peaks can thus help in identifying reproduction of our preparation process with reference to by-product fingerprints. An expert calculating the peaks of the target compounds by known methods (MestreC, ACD simulation, or using empirically evaluated expected values) can, if required, isolate the peaks of the target compounds, optionally using additional intensity filters. This isolation would be similar to the peak picking in question in conventional .sup.1H NMR interpretation. A detailed description of the presentation of NMR data in the form of peak lists can be found in the publication Citation of NMR Peaklist Data within patent applications (cf. Research Disclosure Database Number 605005, 2014, 1 Aug. 2014 or http://www.researchdisclosure.com/searching-disclosures). In the peak picking routine described in Research Disclosure Database Number 605005, the parameter MinimumHeight can be set between 1% and 4%. Depending on the type of chemical structure and/or depending on the concentration of the compound to be analysed, it may be advisable to set the parameters MinimumHeight to values of <1%.
(437) Chemical names were generated using the ACD/Name software from ACD/Labs. In some cases generally accepted names of commercially available reagents were used in place of ACD/Name generated names.
(438) The following table 1 lists the abbreviations used in this paragraph and in the Examples section as far as they are not explained within the text body. Other abbreviations have their meanings customary per se to the skilled person.
(439) TABLE-US-00003 TABLE 1 Abbreviations Abbreviation Meaning Ac acetate acac acetylacetonate ACN acetonitrile aq. aqueous bp broad peak br broad (.sup.1H-NMR signal) Bu Butyl BuLi butyllithium CDI carbonyldiimidazole CI chemical ionisation conc. concentrated d doublet (.sup.1H-NMR signal) DBU 1,8-Diazabicyclo[5.4.0]undec-7-ene DCM dichloromethane dd double-doublet (.sup.1H-NMR signal) ddd doublet of doublets of doublets diamix mixture of diastereoisomers DIPEA diisopropylethylamine DMA dimethylacetamide DMAP N,N-dimethylpyridin-4-amine DME 1,2-dimethoxyethane DMF N,N-Dimethylformamide DMSO dimethylsulfoxide EDC 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride ent enantiomerically pure compound eq. equivalents ESI electrospray (ES) ionisation Et ethyl EtOH ethanol h hour(s) HATU (1-[bis(dimethylamino)methylene)-1H-1,2,3-triazolo[4,5- b]pyridinium-3-oxide hexafluorophosphate HOBt 1-hydroxybenzotriazole hydrate HPLC high performance liquid chromatography iPr isopropyl LC-MS liquid chromatography mass spectrometry LiHMDS Lithium bis(trimethylsilyl)amide M molar (concentration) Me CH.sub.3 MeOH methanol min minute(s) MS mass spectrometry N normal (concentration) NBS N-bromosuccinimide NCS N-chlorosuccinimide NMR nuclear magnetic resonance spectroscopy: chemical shifts () are given in ppm. The chemical shifts were corrected by setting the DMSO signal to 2.50 ppm unless otherwise stated. PCC Pyridinium chlorochromate PdCl.sub.2(PPh.sub.3).sub.2 dichloropalladium-triphenylphosphane (1:2) Pd(PPh.sub.3).sub.4 palladium-triphenylphosphane (1:4) Ph.sub.3P triphenylphosphane q quartet rac racemic mixture RF reflux RP Reversed-Phase chromatography Rt retention time (as measured either with HPLC or UPLC) in minutes RT Room Temperature s singlet (.sup.1H-NMR signal) sat. saturated SQD Single-Quadrupole-Detector t triplet (.sup.1H-NMR signal) TBAF tetrabutylammoniumfluoride TBDMSCI tert.-butyldimethylsilylchlorid td triple-doublet (.sup.1H-NMR signal) TEA triethylamine TFA trifluoroacetic acid TFE 2,2,2-trifluoroethanol THF tetrahydrofuran TLC Thin Layer Chromatography UPLC ultra performance liquid chromatography X-Phos dicyclohexyl[2,4,6-tri(propan-2-yl)biphenyl-2- yl]phosphane
(440) The following table lists the abbreviations used herein.
(441) The various aspects of the invention described in this application are illustrated by the following examples which are not meant to limit the invention in any way.
(442) The example testing experiments described herein serve to illustrate the present invention and the invention is not limited to the examples given.
(443) Experimental SectionGeneral Part
(444) All reagents, for which the synthesis is not described in the experimental part, are either commercially available, or are known compounds or may be formed from known compounds by known methods by a person skilled in the art.
(445) The compounds and intermediates produced according to the methods of the invention may require purification. Purification of organic compounds is well known to the person skilled in the art and there may be several ways of purifying the same compound. In some cases, no purification may be necessary. In some cases, the compounds may be purified by crystallization. In some cases, impurities may be stirred out using a suitable solvent. In some cases, the compounds may be purified by chromatography, particularly flash column chromatography, using for example prepacked silica gel cartridges, e.g. Biotage SNAP cartridges KP-Sil or KP-NH in combination with a Biotage autopurifier system (SP4 or Isolera Four) and eluents such as gradients of hexane/ethyl acetate or DCM/methanol. In some cases, the compounds may be purified by preparative HPLC using for example a Waters autopurifier equipped with a diode array detector and/or on-line electrospray ionization mass spectrometer in combination with a suitable prepacked reverse phase column and eluents such as gradients of water and acetonitrile which may contain additives such as trifluoroacetic acid, formic acid or aqueous ammonia.
(446) In some cases, purification methods as described above can provide those compounds of the present invention which possess a sufficiently basic or acidic functionality in the form of a salt, such as, in the case of a compound of the present invention which is sufficiently basic, a trifluoroacetate or formate salt for example, or, in the case of a compound of the present invention which is sufficiently acidic, an ammonium salt for example. A salt of this type can either be transformed into its free base or free acid form, respectively, by various methods known to the person skilled in the art, or be used as salts in subsequent biological assays. It is to be understood that the specific form (e.g. salt, free base etc.) of a compound of the present invention as isolated and as described herein is not necessarily the only form in which said compound can be applied to a biological assay in order to quantify the specific biological activity.
(447) LC-MS Procedures
(448) General Remarks:
(449) Method 1-6 were performed using an Agilent G1956A LC/MSD quadrupole coupled to an Agilent 1100 series liquid chromatography (LC) system consisting of a binary pump with degasser, autosampler, thermostated column compartment and diode array detector. The mass spectrometer (MS) was operated with an atmospheric pressure electro-spray ionization (API-ES) source in positive ion mode (Mass method 1). The capillary voltage was set to 3000 V, the fragmentor voltage to 70 V and the quadrupole temperature was maintained at 100 C. The drying gas flow and temperature values were 12.0 L/min and 350 C., respectively. Nitrogen was used as the nebuliser gas, at a pressure of 35 psi. Data acquisition was performed with Agilent Chemstation software.
(450) Method 1:
(451) Analyses were carried out on a YMC pack ODS-AQ C18 column (50 mm long4.6 mm I.D.; 3 m particle size) at 35 C., with a flow rate of 2.6 mL/min. A gradient elution was performed from 95% (Water+0.1% Formic acid)/5% Acetonitrile to 5% (Water+0.1% Formic acid)/95% Acetonitrile in 4.8 min; the resulting composition was held for 1.0 min; from 5% (Water+0.1% formic acid)/95% Acetonitrile to 95% (Water+0.1% formic acid)/5% Acetonitrile in 0.2 min. The standard injection volume was 2 L. Acquisition ranges were set to 190-400 nm for the UV-PDA detector and 100-1400 m/z for the MS detector.
(452) Method 2:
(453) Analyses were carried out on a Phenomenex Kinetex 00B-4475-AN C18 column (50 mm long2.1 mm I.D.; 1.7 m particles) at 60 C., with a flow rate of 1.5 mL/min. A gradient elution was performed from 90% (Water+0.1% Formic acid)/10% Acetonitrile to 10% (Water+0.1% Formic acid)/90% Acetonitrile in 1.50 minutes; the resulting composition was held for 0.40 min; then the final mobile phase composition; from 10% (Water+0.1% Formic acid)/90% Acetonitrile to 90% (Water+0.1% Formic acid)/10% Acetonitrile in 0.10 minutes. The injection volume was 2 L with Agilent autosampler injector or 5 L with Gerstel MPS injector. MS acquisition range and DAD detector were set to 100-800 m/z and 190-400 nm respectively.
(454) Method 3:
(455) Analyses were carried out on a Thermo Scientific Accucore C18 (50 mm long2.1 mm I.D., 2.6 m) at 35 C., with a flow rate of 1.50 mL/min. A gradient elution was performed from 95% (Water+0.1% Formic acid)/5% Acetonitrile to 5% (Water+0.1% Formic acid)/95% Acetonitrile in 1.30 minutes; the resulting composition was held for 0.5 min; then the final mobile phase composition; from 5% (Water+0.1% Formic acid)/95% Acetonitrile to 90% (Water+0.1% Formic acid)/10% Acetonitrile in 0.10 minutes. The injection volume was 1 L. MS acquisition range and UV detector were set to 100-1000 m/z and 190-400 nm respectively.
(456) Method 4:
(457) Analyses were carried out on a Thermo Scientific Accucore C18 column PN17126-054630 (50 mm long4.6 mm I.D.; 2.6 m particles) at 30 C., with a flow rate of 3 mL/min. A gradient elution was performed from 90% (Water+0.1% Formic acid)/10% Acetonitrile to 5% (Water+0.1% Formic acid)/95% Acetonitrile in 1.50 minutes; the resulting composition was held for 0.90 min; then the final mobile phase composition; from 10% (Water+0.1% Formic acid)/90% Acetonitrile to 90% (Water+0.1% Formic acid)/10% Acetonitrile in 0.10 minutes. The injection volume was 2 L. MS acquisition range and DAD detector were set to 100-1000 m/z and 200-400 nm respectively.
(458) Method 5:
(459) Analyses were carried out on a Thermo Scientific Accucore AQ C18 (50 mm long2.1 mm I.D., 2.6 m) at 35 C., with a flow rate of 1.50 mL/min. A gradient elution was performed from 95% (Water+0.1% Formic acid)/5% Acetonitrile to 5% (Water+0.1% Formic acid)/95% Acetonitrile in 1.50 minutes; the resulting composition was held for 0.3 min; then the final mobile phase composition; from 5% (Water+0.1% Formic acid)/95% Acetonitrile to 95% (Water+0.1% Formic acid)/5% Acetonitrile in 0.10 minutes. The injection volume was 1 L. MS acquisition range and UV detector were set to 100-1000 m/z and 190-400 nm respectively.
(460) Method 6:
(461) Analyses were carried out on a YMC pack ODS-AQ C18 column (50 mm long4.6 mm I.D.; 3 m particle size) at 35 C., with a flow rate of 2.6 mL/min. A gradient elution was performed using ISET 2V1.0 Emulated Agilent Pump G1312A V1.0 from 94.51% (Water+0.1% Formic acid)/5.49% Acetonitrile to 5% (Water+0.1% Formic acid)/95% Acetonitrile in 4.8 min; the resulting composition was held for 1.0 min; from 5% (Water+0.1% formic acid)/95% Acetonitrile to 95% (Water+0.1% formic acid)/5% Acetonitrile in 0.2 min. The standard injection volume was 2 L. Acquisition ranges were set to 190-400 nm for the UV-PDA detector and 100-1000 m/z for the TOF-MS detector.
(462) Method 7:
(463) Instrument MS: Thermo Scientific FT-MS; Instrument type UHPLC+: Thermo Scientific UltiMate 3000; Column: Waters, HSST3, 2.175 mm, C18 1.8 m; eluent A: 1 L water+0.01% formic acid; eluent B: 1 L acetonitrile+0.01% formic acid; gradient: 0.0 min 10% B.fwdarw.2.5 min 95% B.fwdarw.3.5 min 95% B; oven: 50 C.; flow rate: 0.90 ml/min; UV detection: 210 nm/optimum integration path 210-300 nm.
(464) Method 8:
(465) Instrument: Waters ACQUITY SQD UPLC System; Column: Waters Acquity UPLC HSS T3 1.8 501 mm; eluent A: 1 L water+0.25 ml 99% formic acid, eluent B: 1 L acetonitrile+0.25 ml 99% formic acid; gradient: 0.0 min 90% A.fwdarw.1.2 min 5% A.fwdarw.2.0 min 5% A; oven: 50 C.; flow rate: 0.40 ml/min; UV detection: 210 nm.
(466) Method 9
(467) Instrument: Waters Single Quad MS System; Instrument Waters UPLC Acquity; Column: Waters BEH C18 1.7502.1 mm; eluent A: 1 L water+1.0 mL (25% ammonia)/L, eluent B: 1 L acetonitrile; gradient: 0.0 min 92% A.fwdarw.0.1 min 92% A.fwdarw.1.8 min 5% A.fwdarw.3.5 min 5% A; oven: 50 C.; flow rate: 0.45 mL/min; UV-detection: 210 nm.
(468) Method 10
(469) Instrument: Agilent MS Quad 6150; HPLC: Agilent 1290; column: Waters Acquity UPLC HSS T3 1.8 m 502.1 mm; eluent A: 1 L water+0.25 ml 99% formic acid, eluent B: 1 L acetonitrile+0.25 ml 99% formic acid; gradient: 0.0 min 90% A.fwdarw.0.3 min 90% A.fwdarw.1.7 min 5% A.fwdarw.3.0 min 5% A; ofen: 50 C.; flow rate: 1.20 mL/min; UV-detection: 205-305 nm.
(470) Method 11
(471) Instrument: Agilent MS Quad 6150; HPLC: Agilent 1290; column: Waters Acquity UPLC HSS T3 1.8 m 502.1 mm; eluent A: 1 L water+0.25 ml 99% formic acid, eluent B: 1 L acetonitrile+0.25 ml 99% formic acid; gradient: 0.0 min 90% A.fwdarw.0.3 min 90% A.fwdarw.1.7 min 5% A.fwdarw.3.0 min 5% A; oven: 50 C.; flow rate: 1.20 ml/min; UV-detection: 205-305 nm.
(472) Method 12
(473) Instrument: Waters ACQUITY SQD UPLC System; column: Waters Acquity UPLC HSS T3 1.8 m 501 mm; eluent A: 1 l water+0.25 ml 99% formic acid, Eluent B: 1 l Acetonitril+0.25 ml 99% formic acid; gradient: 0.0 min 95% A.fwdarw.6.0 min 5% A.fwdarw.7.5 min 5% A; oven: 50 C.; flow rate: 0.35 ml/min; UV-detection: 210 nm.
(474) Method 13:
(475) Instrument MS: Waters SQD; Instrument type HPLC: Waters Alliance 2795; Column: Waters, Cortecs, 3.030 mm, C18 2.7 m; eluent A: 1 L water+0.01% formic acid; eluent B: 1 L acetonitrile+0.01% formic acid; gradient: 0.0 min 5% B.fwdarw.1.75 min 95% B.fwdarw.2.35 min 95% B; oven 45 C.: flow rate: 1.75 mL/min; UV detection: 210 nm.
(476) Method 14:
(477) Instrument MS: Waters SQD; Instrument HPLC: Waters UPLC; column: Zorbax SB-Aq (Agilent), 50 mm2.1 mm, 1.8 m; eluent A: water+0.025% formic acid, eluent B: acetonitrile (ULC)+0.025% formic acid; gradient: 0.0 min 98% A.fwdarw.0.9 min 25% A.fwdarw.1.0 min 5% A.fwdarw.1.4 min 5% A.fwdarw.1.41 min 98% A.fwdarw.1.5 min 98% A; oven: 40 C.; flow: 0.600 ml/min; UV-detection: DAD; 210 nm.
(478) GC-MS Procedures
(479) Method A:
(480) Instrument: Thermo Scientific DSQII, Thermo Scientific Trace GC Ultra; column: Restek RTX-35MS, 15 m200 m0.33 m; constant flow with helium: 1.20 ml/min; oven: 60 C.; Inlet: 220 C.; gradient: 60 C., 30 C./min.fwdarw.300 C. (3.33 min hold).
(481) Enantiomeric Separation, Preparative Scale:
(482) Method 1 D: Phase: Daicel Chiralpak IF, 5 m 250 mm20 mm, eluent: n-heptane/ethanol 50:50; flow: 20 ml/min, temperature: 40 C.; UV-Detection: 220 nm.
(483) Method 2D: Phase: Daicel Chiralpak IE, 5 m 250 mm20 mm, eluent: n-heptane/2-propanol 60:40; flow: 15 ml/min, temperature: 50 C.; UV-Detection: 220 nm.
(484) Method 3D: Phase: Daicel Chiralpak IG, 5 m 250 mm20 mm, eluent: ethanol 100%; flow: 15 ml/min, temperature: 50 C.; UV-Detection: 220 nm.
(485) Method 4D: Phase: Daicel Chiralpak AD-H, 5 m 250 mm20 mm, eluent: n-heptane:ethanol 40:60; flow: 25 ml/min, temperature: 35 C.; UV-Detection: 220 nm.
(486) Method 5D: Phase: Daicel Chiralpak AD-H, 5 m 250 mm20 mm, eluent: n-heptane:ethanol 50:50; flow: 25 ml/min, temperature: 30 C.; UV-Detection: 220 nm.
(487) Method 6D: Phase: Daicel Chiralpak IF, 5 m 250 mm20 mm, eluent: n-heptane:ethanol 50.50; flow: 15 ml/min, temperature: 40 C.; UV-Detection: 210 nm.
(488) Method 7D: Phase: Daicel Chiralpak IF, 5 m 250 mm20 mm, Eluent: n-heptane:ethanol 50:50; flow: 15 ml/min, temperature: 40 C.; UV-Detection: 220 nm.
(489) Method 8D: Phase: Daicel Chiralpak AD-H, 5 m 250 mm20 mm, Eluent: i-hexand:ethanol 50:50; flow: 20 ml/min, temperature: 40 C.; UV-Detection: 210 nm.
(490) Method 9D: Phase: Daicel Chiralpak IF, 5 m 250 mm20 mm, eluent: n-heptane:ethanol 40:60; flow: 15 ml/min, temperature: 40 C.; UV-Detection: 210 nm.
(491) Method 10D: Phase: Daicel Chiralpak IG, 5 m 250 mm20 mm, eluent: n-heptane:ethanol 30:70; flow: 15 ml/min, temperature: 30 C.; UV-Detection: 220 nm.
(492) Method 11 D: Phase: Daicel Chiralpak IG, 5 m 250 mm20 mm, eluent: ethanol 100%; flow: 15 ml/min, temperature: 50 C.; UV-Detection: 220 nm.
(493) Method 12D: Phase: Daicel Chiralpak IG, 5 m 250 mm20 mm, eluent: n-heptane:ethanol 10:90; flow: 15 ml/min, temperature: 50 C.; UV-Detection: 220 nm.
(494) Method 13D: Phase: Daicel Chiralpak IG, 5 m 250 mm20 mm, Eluent: ethanol 100%; flow: 15 ml/min, temperature: 50 C.; UV-Detection: 220 nm.
(495) Method 14D: Phase: Daicel Chiralpak IF, 5 m 250 mm20 mm, Eluent: ethanol 100%; flow: 15 ml/min, temperature: 50 C.; UV-Detection: 220 nm.
(496) Method 15D: Phase: Daicel Chiralpak IG, 5 m 250 mm20 mm, eluent: n-heptane:ethanol 60:40; flow: 15 ml/min, temperature: 50 C.; UV-Detection: 235 nm.
(497) Method 16D: Phase: Daicel Chiralpak IG, 5 m 250 mm20 mm, eluent: n-heptane:ethanol 10:90; flow: 15 ml/min, temperature: 30 C.; UV-Detection: 235 nm.
(498) Method 17D: Phase: Daicel Chiralpak IF, 5 m 250 mm20 mm, eluent: ethanol 100%; flow: 15 ml/min, temperature: 70 C.; UV-Detection: 220 nm.
(499) Enantiomeric Separation, Analytical Scale:
(500) Method 1E: Phase: Chiratek IF-3; eluent: i-hexane/ethanol 50:50; flow: 1 ml/min; UV-Detection: 220 nm.
(501) Method 2E: Phase: Daicel Chiralpak IF, 5 m 250 mm4.6 mm; eluent: hexane/2-propanol 30:70; flow: 1.0 ml/min, temperature: 60 C.; UV-Detection: 270 nm.
(502) Method 3E: Phase: Daicel Chiralpak IG, 5 m 250 mm4.6 mm; eluent: ethanol 100%; flow: 1.0 ml/min, temperature: 50 C.; UV-Detection: 220 nm.
(503) Method 4E: Phase: Daicel AD, 5 m 250 mm4.60 mm; eluent: ethanol 100%; flow: 1.0 ml/min; UV-Detection: 220 nm.
(504) Method 5E: Phase: Daicel Chiralpak AD-H, 5 m 250 mm4.6 mm; eluent: ethanol 100%; flow: 1.0 ml/min, UV-Detection: 220 nm.
(505) Method 6E: Phase: Daicel Chiralpak IF, 5 m 50 mm4.6 mm; eluent: n-heptane:ethanol 50:50; flow: 1.0 ml/min, Temperature: 25 C.; UV-Detection: 220 nm.
(506) Method 7E: Phase: Daicel Chiralpak IF, 5 m 50 mm4.6 mm; eluent: n-heptane:ethanol 50:50; flow: 1.0 ml/min, UV-Detection: 220 nm.
(507) Method 8E: Phase: Chiracel-H AD, 5 m 250 mm4.6 mm Eluent: n-heptane:ehanol 50:50; flow: 1.0 ml/min, UV-Detection: 220 nm.
(508) Method 9E: Phase: Daicel Chiralpak IF-3, 5 m 50 mm4.6 mm; eluent: n-heptane:ehanol 50:50; flow: 1.0 ml/min, UV-Detection: 220 nm.
(509) Method 10E: Phase: Daicel IG-3, 5 m 50 mm4.6 mm; flow: 1.0 ml/min, UV-Detection: 220 nm.
(510) Method 11E: Phase: Daicel Chiralpak IG-3, 5 m 250 mm4.6 mm; eluent: ethanol 100%, flow: 1.0 ml/min, temperature: 50 C.; UV-Detection: 220 nm.
(511) Method 12E: Phase: Daicel Chiralpak IG-3, 5 m 250 mm4.6 mm; eluent: ethanol 100%, flow: 1 ml/min, temperature: 50 C.; UV-Detection: 220 nm.
(512) Method 13E: Phase: Daicel Chiralpak IG-3, 5 m 250 mm4.6 mm; eluent: ethanol 100%, flow: 1.0 ml/min, temperature:50 C.; UV-Detection: 220 nm.
(513) Method 14E: Phase: Daicel Chiralpak IF, 5 m 50 mm4.60 mm; eluent: ethanol 100%, flow: 1.0 ml/min, UV-Detection: 220 nm.
(514) Method 15E: Phase: Daicel Chiralpak IF, 5 m 250 mm4.60 mm; eluent: ethanol 100%, flow: 1.0 ml/min, temperature: 50 C.; UV-Detection: 220 nm.
(515) Method 16E: Phase: Daicel IG-3 3 m 50 mm4.60 mm; eluent: ethanol 100%, flow 1.0 ml/min; UV-Detection: 220 nm.
(516) Method 17E: Phase: Daicel Chiralpak IG 5 m 50 mm4.60 mm; eluent: ethanol 100%, flow 1.0 ml/min; temperature: 70 C., UV-Detection: 220 nm.
(517) Preparative HPLC:
(518) Method 1f
(519) Column: Chromatorex C18 10 m; 12520 mm; Eluent A: water+0.05% trifluoroacetic acid, Eluent B: acetonitrile+0.05% trifluoroacetic acid; Gradient: 10% B.fwdarw.100% B; Flow: 20 ml/min UV-Detection 210 nm.
(520) Method 2f
(521) Column: Chromatorex C18 10 m; 12530 mm; Eluent A: water+0.05% trifluoroacetic acid, Eluent B: acetonitrile+0.05% trifluoroacetic acid; Gradient: 10% B.fwdarw.100% B; Flow: 50 till 100 ml/min UV-Detection 210 nm.
(522) Method 3f
(523) Instrument: Waters Prep LC/MS System, Colunmn: Phenomenex Kinetex C185 m 10030 mm; Eluent A: water, Eluent B: acetonitrile, Eluent C: 2% formic acid in Water, Eluent D: acetonitrile/water (80 Vol %/20 Vol %); Flow rate: 80 ml/min, room temperature, UV-detection 200-400 nm; Gradient: Eluent A 0.fwdarw.2 min 63 ml, Eluent B 0.fwdarw.2 min 7 ml, Eluent A 2.fwdarw.10 min from 63 ml till 39 ml and Eluent B from 7 ml till 31 ml, 10.fwdarw.12 min 0 ml Eluent A and 70 ml Eluent B. Eluent C and Eluent D constant flow of 5 ml/min during the complete HPLC run.
(524) Method 4f
(525) Instrument: Waters Prep LC/MS System, Colunmn: Phenomenex Kinetex C185 m 10030 mm; Eluent A: water, Eluent B: acetonitrile, Eluent C: 2% formic acid in Water, Eluent D: acetonitrile/water (80 Vol. %/20 Vol %); Flow rate: 80 ml/min, room temperature, UV-detection 200-400 nm; Gradient: Eluent A 0.fwdarw.2 min 55 ml, Eluent B 0.fwdarw.2 min 15 ml, Eluent A 2.fwdarw.10 min from 55 ml till 31 ml and Eluent B from 15 ml till 39 ml, 10.fwdarw.12 min 0 ml Eluent A and 70 ml Eluent B. Eluent C and Eluent D constant flow of 5 ml/min during the complete HPLC run.
(526) Method 5f
(527) Instrument: Waters Prep LC/MS System; Column: XBridge C18 5 m 10030 mm; Eluent A: water, Eluent B: acetonitrile, Eluent C: 2% ammonia in water, Eluent D: acetonitrile/water (80 Vol. %/20 Vol %); Flow: 80 ml/min; Room temperature; Wavelength 200-400 nm; At-Column injection (complete injection); Gradient: eluent A 0 to 2 min 70 ml, eluent B 0 to 2 min 0 ml, eluent A 2 to 10 min from 70 ml to 55 ml and eluent B from 0 ml to 15 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow, each 5 ml/min during the complete HPLC run.
(528) Method 6f
(529) Instrument: Waters Prep LC/MS System; Column: Phenomenex Kinetex C18 5 m 10030 mm; Eluent A: water, Eluent B: acetonitrile, Eluent C: 2% formic acid in water, Eluent D: acetonitrile/water (80 Vol. %/20 Vol %); Flow: 80 ml/min; Room temperature; Wavelength 200-400 nm; At-Column injection (complete injection); Gradient: eluent A 0 to 2 min 70 ml, eluent B 0 bis 2 min 0 ml, eluent A 2 to 10 min from 70 ml to 55 ml and eluent B from 0 ml to 15 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow, each 5 ml/min during the complete HPLC run.
(530) Method 7f
(531) Instrument: Waters Prep LC/MS System; Column: XBridge C18 5 m 10030 mm; Eluent A: water, Eluent B: Acetonitrile, Eluent C: 2% ammonia in water, Eluent D: Acetonitrile/water (80 Vol. %/20 Vol %) Flow: 80 ml/min; Room temperature; Wavelength 200-400 nm; At-Column injection (complete injection); Gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow, each 5 ml/min during the complete HPLC run.
(532) Method 8f
(533) Instrument: Waters Prep LC/MS System; Column: Phenomenex Kinetex C18 5 m 10030 mm; Eluent A: water, Eluent B: acetonitrile, Eluent C: 2% formic acid in water, Eluent D acetonitrile/water (80 Vol. %/20 Vol %); Flow: 80 ml/min; Room temperature; Wavelength 200-400 nm; At-Column injection (complete injection); Gradient: eluent A 0 to 2 min 47 ml, eluent B 0 to 2 min 23 ml, eluent A 2 to 10 min from 47 ml to 23 ml and eluent B from 23 ml to 47 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow, each 5 ml/min during the complete HPLC run.
(534) Method 9f
(535) Column: Chromatorex C18 10 m; 12540 mm; Eluent A: water+0.05% trifluoroacetic acid, Eluent B: acetonitrile+0.05% trifluoroacetic acid; Gradient: 10% B.fwdarw.100% B; Flow: 100 ml/min UV-Detection 210 nm.
(536) Experimental SectionStarting Materials and Intermediates
(537) Intermediate 1
1-(2-Cyclopropyl-2-Oxoethyl)-3,5,7-Triaza-1-Azoniatricyclo[3.3.1.1.SUP.3,7.]Decane Bromide
(538) ##STR00036##
(539) 100.00 g (0.61 mol) of 2-bromo-1-cyclopropylethanone was dissolved in 1.4 L of chloroform and 86.00 g (0.61 mol) of hexamethylenetetramine was added allowing the mixture to stir at room temperature for 12 hours. The solvent was partially removed and the resulting precipitate was filtered off, washed with cold chloroform and isolated. The remaining mother liquors were concentrated again, filtered and washed with cold chloroform several times until no more precipitate was appreciated. All the collected solids were dried in vacuo to give 185.67 g (100%) of the product as a white powder. The compound was used as such in the next synthetic step.
(540) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.98-1.10 (m, 4H), 2.02-2.17 (m, 1H), 4.31 (d, 2H), 4.51 (d, 3H), 4.65 (d, 3H), 5.32 (s, 6H).
(541) LC-MS (Method 3): R.sub.t=0.099 min. MS (Mass method 1): m/z=223 (M).sup.+
(542) Intermediate 2
Tert-Butyl (2-Cyclopropyl-2-Oxoethyl)Carbamate
(543) ##STR00037##
(544) 185.67 g (0.61 mol) of 1-(2-cyclopropyl-2-oxoethyl)-3,5,7-triaza-1-azoniatricyclo[3.3.1.1.sup.3,7]decane bromide was dissolved in 0.60 L of ethanol and 0.20 L of hydrochloric acid (conc). and the mixture was refluxed for 30 min. The resulting precipitate was filtered off, washed with ethanol and discarded. The filtrates were evaporated and dried to yield the corresponding crude ammonium salt as a thick oil. Next, 0.10 L (0.73 mol) of triethylamine and 0.14 L (0.61 mol) of di-tert-butyl dicarbonate were added to a solution of the aforementioned crude ammonium salt in 1.3 L of dichloromethane and the mixture was stirred at room temperature for 12 hours. Water was added to the reaction and the phases were separated. The organic layer was dried over magnesium sulfate, filtered and evaporated. The corresponding residue was purified by flash chromatography on silica gel eluting with n-heptane and ethyl acetate. 49.00 g (40%) of the product were isolated as a dark brown oil.
(545) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.78-0.85 (m, 1H), 0.86-0.94 (m, 2H), 1.38 (s, 9H), 1.99-2.11 (m, 1H), 3.88 (d, 2H), 7.03 (bp, 1H).
(546) LC-MS (Method 3): R.sub.t=0.630 min. MS (Mass method 1): m/z=222 (M+Na)+
(547) Intermediate 3
Rac-Tert-Butyl [(4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]Carbamate
(548) ##STR00038##
(549) To a stirring solution of 50.63 g (526.97 mmol) of ammonium carbonate and 7.51 g (140.52 mmol) of ammonium chloride in 40 mL of water was added 7.00 g (35.13 mmol) of tert-butyl (2-cyclopropyl-2-oxoethyl)carbamate in 40 mL of ethanol. After 15 min, 10.29 g (158.09 mmol) of potassium cyanide were added and the mixture was heated up to 60 C. for 16 hours into a sealed pressure flask. The yellow solution was concentrated until only a small fraction of water remained (a white precipitate appeared). Then, more water was added and the suspension was allowed to stand at 0 C. for 1 hour. After that time, the resulting solid was filtered off and washed with water and diethyl ether to give 5.04 g (53%) of the product as a beige powder. The compound was used as such in the next step.
(550) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.01-0.14 (m, 1H), 0.23-0.34 (m, 1H), 0.35-0.46 (m, 2H), 0.97-1.10 (m, 1H), 1.36 (s, 9H), 3.25-3.32 (m, 2H), 6.78 (t, 1H), 7.36 (s, 1H), 10.46 (bp, 1H).
(551) LC-MS (Method 3): R.sub.t=0.388 min. MS (Mass method 1): m/z=214 (MtBu+H).sup.+
(552) Intermediate 4
Tert-Butyl {[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(553) ##STR00039##
(554) rac-tert-Butyl [(4-cyclopropyl-2,5-dioxoimidazolidin-4-yl)methyl]carbamate (26 g) was dissolved in 2600 ml of Methanol at 50 C., filtered and separated into it's enantiomers by chiral chromatography (Machine: SFC Prep Sepiatec 360; Column: Chiralpak AD 20, 45050 mm; Eluent: CO.sub.2/Methanol 70:30; Flow: 350 ml/min; UV Detection: 210 nm; Backpressure: 130 bar; Oven temperature: 35 C.). The enantiomer eluting at 1.52 minutes was collected. Enantiomeric purity was determined on an analytical scale (Column: Chiralpak AD-H 5, 2504.6 mm; Eluent: CO.sub.2/Methanol 80:20; Flow: 3 ml/min; UV Detection: 210 nm) as 99.9% ee. 8.6 g (33% yield).
(555) LC-MS (Method 8): R.sub.t=0.60 min; MS (ESIpos): m/z=270 [M+H].sup.+
(556) The absolute stereochemistry was deduced by deprotection (see next intermediate) and synthesis of example 3 from WO2014066151.
(557) Intermediate 5
(5R)-5-(Aminomethyl)-5-Cyclopropylimidazolidine-2,4-Dione Hydrochloride
(558) ##STR00040##
(559) tert-butyl {[(4R)-4-cyclopropyl-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (6 g, 22.28 mmol) was dissolved in 70 ml of dichloromethane and treated with 4N HCl in dioxane (27.85 ml, 111.4 mmol). The mixture was stirred at room temperature over night. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 4.29 g (94% yield, 100% purity) of the title compound were obtained.
(560) LC-MS (Method 9): R.sub.t=0.27 min; MS (ESIpos): m/z=170 [MHCl+H].sup.+
(561) Intermediate 6
Ethyl 5-(5-Methyl-1,3-Thiazol-4-Yl)-1,3-Oxazole-4-Carboxylate
(562) ##STR00041##
(563) 5-methyl-1,3-thiazole-4-carboxylic acid (940 mg, 6.57 mmol) dissolved in 10 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.28 g, 7.88 mmol) and stirred at room temperature. After 2 h ethyl isocyanoacetate (790 l, 7.2 mmol), dissolved in 10 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (6.6 ml, 1.0 M, 6.6 mmol) were added at 0 C. The mixture was allowed to warm to room temperature and stirred over night. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered, Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 16% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.13 g (100% purity, 72% yield) of the title compound were obtained.
(564) LC-MS (Method 7): R.sub.t=1.15 min; MS (ESIpos): m/z=239 [M+H].sup.+
(565) Intermediate 7
2-Amino-1-(5-Methyl-1,3-Thiazol-4-Yl)Ethan-1-One-Hydrogen Chloride
(566) ##STR00042##
(567) Ethyl 5-(5-methyl-1,3-thiazol-4-yl)-1,3-oxazole-4-carboxylate (1.13 g, 4.74 mmol) was taken up in 25 ml of 6 N hydrochloric acid and stirred at 100 C. After 2 h the solvent was removed on a rotary evaporator and the residue was treated with DCM/MeOH 20:1. The precipitate was filtered off, washed with DCM/MeOH 20:1 and dried in vacuo. 730 mg (98% purity, 79% yield) of the title compound were obtained.
(568) LC-MS (Method 9): R.sub.t=0.80 min; MS (ESIpos): m/z=157 [MHCl+H].sup.+
(569) Intermediate 8
Tert-Butyl [2-(5-Methyl-1,3-Thiazol-4-Yl)-2-Oxoethyl]Carbamate
(570) ##STR00043##
(571) 2-amino-1-(5-methyl-1,3-thiazol-4-yl)ethan-1-one-hydrogen chloride (730 mg, 3.79 mmol) dissolved in 15 ml of dichloromethane was treated with di-tert-butyl dicarbonate (960 l, 4.2 mmol) and triethylamine (1.6 ml, 11 mmol). The mixture was stirred at room temperature. After 2 h the solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 980 mg (100% purity, 101% yield) of the title compound were obtained.
(572) LC-MS (Method 7): R.sub.t=1.57 min; MS (ESIpos): m/z=257 [M+H].sup.+
(573) Intermediate 9
Rac-Tert-Butyl {[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(574) ##STR00044##
(575) In a microwave vial tert-butyl [2-(5-methyl-1,3-thiazol-4-yl)-2-oxoethyl]carbamate (980 mg, 3.82 mmol) was dissolved in 7 ml of methanol. Potassium cyanide (996 mg, 15.3 mmol) and ammonium carbonate (1.47 g, 15.3 mmol) were added. The vial was sealed and the mixture was stirred at 40 C. for 48 h. Further potassium cyanide (996 mg, 15.3 mmol) and ammonium carbonate (1.47 g, 15.3 mmol) were added and the mixture was stirred for 72 h. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 766 mg (100% purity, 61% yield) of the title compound were obtained.
(576) LC-MS (Method 7): R.sub.t=1.09 min; MS (ESIneg): m/z=325 [MH].sup.
(577) Intermediate 10
Rac-5-(Aminomethyl)-5-(5-Methyl-1,3-Thiazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(578) ##STR00045##
(579) rac-tert-butyl {[4-(5-methyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (766 mg, 2.35 mmol) was dissolved in 9 ml of dichloromethane. 4 M hydrochloride acid in 1,4-dioxane (2.9 ml, 4.0 M, 12 mmol) was added and the mixture was stirred for 30 min. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 640 mg (86% purity, 89% yield) of the title compound were obtained.
(580) LC-MS (Method 9): R.sub.t=0.25 min; MS (ESIpos): m/z=227 [MHCl+H].sup.+
(581) Intermediate 11
Ethyl 5-(1-Ethyl-1H-Pyrazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(582) ##STR00046##
(583) A solution of 1-ethyl-1H-pyrazole-5-carboxylic acid (1.00 g, 7.14 mmol) and 1,1-carbonyldiimidazole (1.39 g, 8.56 mmol) in 10 ml of THF was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (860 l, 7.8 mmol) in 10 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (7.1 ml, 1.0 M, 7.1 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 2 h. The reaction was concentrated in vacuo and extracted with ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 16% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.30 g (95% purity, 74% yield) of the title compound were obtained.
(584) LC-MS (Method 7): R.sub.t=1.23 min; MS (ESIpos): m/z=236 [M+H].sup.+
(585) Intermediate 12
2-Amino-1-(1-Ethyl-1H-Pyrazol-5-Yl)Ethan-1-One-Hydrogen Chloride (1/1)
(586) ##STR00047##
(587) Ethyl 5-(1-ethyl-1H-pyrazol-5-yl)-1,3-oxazole-4-carboxylate (1.30 g, 5.53 mmol) were taken up in 29 ml of 6 N hydrochloric acid and stirred at 100 C. for 2 h. The solvent was removed on a rotary evaporator and the residue was taken up in DCM/MeOH 20:1. The solvent was removed an the residue was dried in vacuo. 1.19 g (114% yield) of the title compound were obtained.
(588) Intermediate 13
Tert-Butyl [2-(1-Ethyl-1H-Pyrazol-5-Yl)-2-Oxoethyl]Carbamate
(589) ##STR00048##
(590) 2-amino-1-(1-ethyl-1H-pyrazol-5-yl)ethan-1-one-hydrogen chloride (1/1) (1.10 g, 5.80 mmol) dissolved in 23 ml of dichloromethane were treated with di-tert-butyl dicarbonate (1.5 ml, 6.4 mmol) and triethylamine (2.4 ml, 17 mmol). The mixture was stirred at room temperature for 2 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 25 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 75 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.07 g (100% purity, 73% yield) of the title compound were obtained.
(591) LC-MS (Method 9): R.sub.t=1.40 min; MS (ESIpos): m/z=254 [M+H].sup.+
(592) Intermediate 14
Rac-Tert-Butyl {[4-(1-Ethyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(593) ##STR00049##
(594) In a microwave vial tert-butyl [2-(1-ethyl-1H-pyrazol-5-yl)-2-oxoethyl]carbamate (1.00 g, 3.95 mmol) was dissolved in 8 ml of methanol. Potassium cyanide (1.03 g, 15.8 mmol) and ammonium carbonate (1.52 g, 15.8 mmol) were added. The vial was sealed and the mixture was stirred at 50 C. for 48 h. The mixture was filtered and the filtrate was purified by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min; 0.1% formic acid). Product containing samples were united and the solvents were removed on a rotary evaporator. 137 mg (100% purity, 11% yield) of the title compound were obtained.
(595) LC-MS (Method 7): R.sub.t=1.02 min; MS (ESIpos): m/z=324 [M+H].sup.+
(596) Intermediate 15
Rac-5-(Aminomethyl)-5-(1-Ethyl-1H-Pyrazol-5-Yl)Imidazolidine-2,4-Dione-Hydrogen Chloride
(597) ##STR00050##
(598) rac-tert-butyl {[4-(1-ethyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (137 mg, 424 mol) was dissolved in 2 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (530 l, 4.0 M, 2.1 mmol) was added and the mixture was stirred over night. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 142 mg (90% purity, 116% yield) of the title compound were obtained.
(599) LC-MS (Method 9): R.sub.t=0.22 min; MS (ESIpos): m/z=224 [MHCl+H].sup.+
(600) Intermediate 16
Ethyl 5-(4-Methyl-1,3-Thiazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(601) ##STR00051##
(602) A solution of 4-methyl-1,3-thiazole-5-carboxylic acid (5.00 g, 34.9 mmol) and 1,1-carbonyldiimidazole (6.80 g, 41.9 mmol) in 50 ml of THF was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (4.2 ml, 38 mmol) in 50 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (35 ml, 1.0 M, 35 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature over night. The reaction was concentrated in vacuo and extracted with ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 100 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 5.76 g (100% purity, 69% yield) of the title compound were obtained.
(603) LC-MS (Method 7): R.sub.t=1.15 min; MS (ESIpos): m/z=239 [M+H].sup.+
(604) Intermediate 17
2-Amino-1-(4-Methyl-1,3-Thiazol-5-Yl)Ethan-1-One-Hydrogen Chloride
(605) ##STR00052##
(606) Ethyl 5-(4-methyl-1,3-thiazol-5-yl)-1,3-oxazole-4-carboxylate (5.76 g, 24.2 mmol) were taken up in 130 ml of 6 N hydrochloric acid and stirred at 100 C. for 1 h. The solvent was removed on a rotary evaporator and the residue was taken up in DCM/MeOH 20:1. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 4.79 g (97% purity, 100% yield) of the title compound were obtained.
(607) LC-MS (Method 9): R.sub.t=0.62 min; MS (ESIpos): m/z=157 [MHCl+H].sup.+
(608) Intermediate 18
Tert-Butyl [2-(4-Methyl-1,3-Thiazol-5-Yl)-2-Oxoethyl]Carbamate
(609) ##STR00053##
(610) 2-amino-1-(4-methyl-1,3-thiazol-5-yl)ethan-1-one-hydrogen chloride (4.79 g, 24.9 mmol) dissolved in 100 ml of dichloromethane were treated with di-tert-butyl dicarbonate (6.3 ml, 27 mmol) and triethylamine (10 ml, 75 mmol). The mixture was stirred at room temperature for 4 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 4.98 g (100% purity, 78% yield) of the title compound were obtained.
(611) LC-MS (Method 7): R.sub.t=1.50 min; MS (ESIpos): m/z=257 [M+H].sup.+
(612) Intermediate 19
Rac-Tert-Butyl {[4-(4-Methyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(613) ##STR00054##
(614) In a microwave vial tert-butyl [2-(4-methyl-1,3-thiazol-5-yl)-2-oxoethyl]carbamate (4.98 g, 19.4 mmol) was dissolved in 30 ml of methanol. Potassium cyanide (5.06 g, 77.7 mmol) and ammonium carbonate (7.47 g, 77.7 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. for 3 d. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 100 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 3.00 g (100% purity, 47% yield) of the title compound were obtained.
(615) LC-MS (Method 7): R.sub.t=1.11 min; MS (ESIpos): m/z=327 [M+H].sup.+
(616) Intermediate 20
Rac-5-(Aminomethyl)-5-(4-Methyl-1,3-Thiazol-5-Yl)Imidazolidine-2,4-Dione-Hydrogen Chloride
(617) ##STR00055##
(618) rac-tert-butyl {[4-(4-methyl-1,3-thiazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (200 mg, 613 mol) was dissolved in 3 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (766 l, 4.0 M, 3.1 mmol) was added and the mixture was stirred for 2 h. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 225 mg (95% purity, 133% yield) of the title compound were obtained.
(619) LC-MS (Method 9): R.sub.t=0.23 min; MS (ESIpos): m/z=227 [MHCl+H].sup.+
(620) Intermediate 21
Ethyl 5-[1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-5-Yl]-1,3-Oxazole-4-Carboxylate
(621) ##STR00056##
(622) A solution of 1-(2,2,2-trifluoroethyl)-1H-pyrazole-5-carboxylic acid (1.00 g, 5.15 mmol) and 1,1-carbonyldiimidazole (1.00 g, 6.18 mmol) in 11 ml of THF was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (620 l, 5.7 mmol) in 11 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (5.2 ml, 1.0 M, 5.2 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted with ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 25 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 75 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.16 g (100% purity, 78% yield) of the title compound were obtained.
(623) LC-MS (Method 7): R.sub.t=1.43 min; MS (ESIpos): m/z=290 [M+H].sup.+
(624) Intermediate 22
2-Amino-1-[1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-5-Yl]Ethan-1-One-Hydrogen Chloride
(625) ##STR00057##
(626) Ethyl 5-[1-(2,2,2-trifluoroethyl)-1H-pyrazol-5-yl]-1,3-oxazole-4-carboxylate (1.16 g, 4.01 mmol) were taken up in 20 ml of 6 N hydrochloric acid and stirred at 100 C. for 1 h. The solvent was removed on a rotary evaporator and the residue was taken up in DCM/MeOH 20:1. The solvent was removed and the residue was dried in vacuo. 1.07 g (100% purity, 110% yield of the title compound were obtained.
(627) LC-MS (Method 9): R.sub.t=0.95 min; MS (ESIpos): m/z=208 [MHCl+H].sup.+
(628) Intermediate 23
Tert-Butyl {2-Oxo-2-[1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-5-Yl]Ethyl}Carbamate
(629) ##STR00058##
(630) 2-amino-1-[1-(2,2,2-trifluoroethyl)-1H-pyrazol-5-yl]ethan-1-one-hydrogen chloride (1.07 g, 4.39 mmol) dissolved in 17 ml of dichloromethane were treated with di-tert-butyl dicarbonate (1.1 ml, 4.8 mmol) and triethylamine (1.8 ml, 13 mmol). The mixture was stirred at room temperature for 3 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.37 g (71% purity, 72% yield) of the title compound were obtained.
(631) LC-MS (Method 9): R.sub.t=1.52 min, MS (ESIpos): m/z=308 [M+H].sup.+
(632) Intermediate 24
Rac-Tert-Butyl({2,5-Dioxo-4-[1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-5-Yl]Imidazolidin-4-Yl}Methyl)Carbamate
(633) ##STR00059##
(634) In a microwave vial tert-butyl {2-oxo-2-[1-(2,2,2-trifluoroethyl)-1H-pyrazol-5-yl]ethyl}carbamate (689 mg, 2.24 mmol) was dissolved in 5 ml of methanol. Potassium cyanide (730 mg, 11.2 mmol) and ammonium carbonate (1.08 g, 11.2 mmol) were added. The vial was sealed and the mixture was stirred at 50 C. for 48 h. The mixture was filtered and the filtrate was purified by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min; 0.1% formic acid). Product containing samples were united and the solvents were removed on a rotary evaporator. 195 mg (100% purity, 23% yield) of the title compound were obtained.
(635) LC-MS (Method 7): R.sub.t=1.21 min; MS (ESIpos): m/z=378 [M+H].sup.+
(636) Intermediate 25
Rac-5-(Aminomethyl)-5-[1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-5-Yl]Imidazolidine-2,4-Dione Hydrochloride
(637) ##STR00060##
(638) rac-tert-butyl({2,5-dioxo-4-[1-(2,2,2-trifluoroethyl)-1H-pyrazol-5-yl]imidazolidin-4-yl}methyl)carbamate (195 mg, 517 mol) was dissolved in 2 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (650 l, 4.0 M, 2.6 mmol) was added and the mixture was stirred for 3 h. The solvent was removed on a rotary evaporator. The residue was taken up in dichloromethane, the solvent was removed and the residue was dried in vacuo. 155 mg (96% purity, 92% yield) of the title compound were obtained.
(639) LC-MS (Method 9): R.sub.t=0.23 min; MS (ESIpos): m/z=278 [MHCl+H].sup.+
(640) Intermediate 26
Ent-Tert-Butyl {[4-(4-Methyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(641) ##STR00061##
(642) Enantiomeric separation of rac-tert-butyl {[4-(4-methyl-1,3-thiazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (2.80 g, 8.58 mmol) was done using the following method: Column: Daicel Chiralpak AD 20 m 50050 mm Solvent: 60% CO.sub.2: 40% methanol Flow: 400 ml/min Backpressure: 130 bar Oven temperature: 35 C. UV: 210 nm
(643) Product containing samples were united, the solvents were evaporated and the residue was lyophilized.
(644) Enantiomer 1:
(645) 1.33 g (100% purity, 48% yield)
(646) LC-MS (Method 8): R.sub.t=0.55 min; MS (ESIpos): m/z=327 [M+H].sup.+
(647) Chiral HPLC (Column: Chiralpack AD; solvent: 20% methanol: 80% CO.sub.2; flow: 3 ml/min; UV: 210 nm): R.sub.t=0.938 min, >99.0% ee
(648) Enantiomer 2:
(649) 1.17 g (100% purity, 42% yield)
(650) LC-MS (Method 8): R.sub.t=0.55 min; MS (ESIpos): m/z=327 [M+H].sup.+
(651) HPLC (Column: ChiralpackAD; solvent: 20% methanol: 80% CO.sub.2; flow: 3 ml/min; UV: 210 nm): R.sub.t=2.074 min, >99.0% ee
(652) Intermediate 27
Ent-5-(Aminomethyl)-5-(4-Methyl-1,3-Thiazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride (Enantiomer 2)
(653) ##STR00062##
(654) ent-tert-butyl {[4-(4-methyl-1,3-thiazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (Enantiomer 2) (1.17 g, 3.58 mmol) was dissolved in 18 ml of dichloromethane and treated with 4 N HCl in dioxane (4.5 ml, 4.0 M, 18 mmol). The mixture was stirred at room temperature for 2 h. The precipitate was filtered, washed with dichloromethane and dried in vacuo. 1.01 g (100% purity, 107% yield) of the title compound were obtained.
(655) LC-MS (Method 9): R.sub.t=0.22 min; MS (ESIpos): m/z=227 [MHCl+H].sup.+
(656) Intermediate 28
Rac-Ethyl 5-(2-Methylcyclobutyl)-1,3-Oxazole-4-Carboxylate
(657) ##STR00063##
(658) A solution of 2-methylcyclobutane-1-carboxylic acid (2.30 g, 20.1 mmol) and 1,1-carbonyldiimidazole (3.92 g, 24.2 mmol) in 30 ml of THF was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (2.4 ml, 22 mmol) in 30 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (20 ml, 1.0 M, 20 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 100 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.72 g (91% purity, 37% yield) of the title compound were obtained.
(659) LC-MS (Method 7): R.sub.t=1.79 min; MS (ESIpos): m/z=210 [M+H].sup.+
(660) Intermediate 29
Rac-2-Amino-1-(2-Methylcyclobutyl)Ethanone Hydrochloride
(661) ##STR00064##
(662) rac-ethyl 5-(2-methylcyclobutyl)-1,3-oxazole-4-carboxylate (1.09 g, 65% purity, 3.39 mmol) were taken up in 20 ml of 6 N hydrochloric acid and stirred at 100 C. for 2 h. The solvent was removed on a rotary evaporator and the residue was taken up in dichlorome thane. The solvent was removed and the residue was dried in vacuo. 675 mg (88% purity, 107% yield) of the title compound were obtained.
(663) LC-MS (Method 9): R.sub.t=1.00 min; MS (ESIpos): m/z=128 [MHCl+H].sup.+
(664) Intermediate 30
Rac-Tert-Butyl [2-(2-Methylcyclobutyl)-2-Oxoethyl]Carbamate
(665) ##STR00065##
(666) rac-2-amino-1-(2-methylcyclobutyl)ethanone hydrochloride (675 mg, 4.12 mmol) dissolved in 15 ml of dichloromethane was treated with di-tert-butyl dicarbonate (1.0 ml, 4.5 mmol) and triethylamine (1.7 ml, 12 mmol). The mixture was stirred at room temperature for 4 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 871 g (97% purity, 90% yield) of the title compound were obtained.
(667) GC-MS (Method A): R.sub.t=4.97 min; MS (EI-MS-POS): m/z=171 [MC.sub.4H.sub.8].sup.+
(668) Intermediate 31
Diamix-Tert-Butyl {[4-(2-Methylcyclobutyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(669) ##STR00066##
(670) In a microwave vial rac-tert-butyl [2-(2-methylcyclobutyl)-2-oxoethyl]carbamate (870 mg, 3.83 mmol) was dissolved in 5 ml of methanol. Potassium cyanide (997 mg, 15.3 mmol) and ammonium carbonate (1.47 g, 15.3 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. The mixture was filtered and the filtrate was purified by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 361 mg (100% purity, 32% yield) of the title compound were obtained.
(671) LC-MS (Method 7): R.sub.t=1.40 min; MS (ESIneg): m/z=296 [MH].sup.
(672) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.871 (1.58), 0.882 (1.60), 1.009 (1.88), 1.020 (1.90), 1.363 (16.00), 1.595 (0.45), 2.113 (0.46), 2.128 (0.60), 2.143 (0.49), 3.086 (0.41), 3.124 (0.51), 3.134 (0.49), 7.708 (0.41), 7.736 (0.55).
(673) Intermediate 32
Diamix-5-(Aminomethyl)-5-(2-Methylcyclobutyl)Imidazolidine-2,4-Dione Hydrochloride
(674) ##STR00067##
(675) diamix-tert-butyl {[4-(2-methylcyclobutyl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (360 mg, 1.21 mmol) was dissolved in 6 ml of dichloromethane and treated with 4 N HCl in dioxane (1.5 ml, 4.0 M, 6.1 mmol). The mixture was stirred at room temperature for 2 h. The solvent was removed on a rotary evaporator. The residue was taken up with dichloromethane, the solvent was removed and the residue was dried in vacuo. 294 mg (100% purity, 104% yield) of the title compound were obtained.
(676) LC-MS (Method 9): R.sub.t=0.52 min; MS (ESIpos): m/z=198 [MHCl+H].sup.+
(677) Intermediate 33
Ethyl 5-(1,5-Dimethyl-1H-Pyrazol-4-Yl)-1,3-Oxazole-4-Carboxylate
(678) ##STR00068##
(679) A solution of 1,5-dimethyl-1H-pyrazole-4-carboxylic acid (1.00 g, 7.14 mmol) and 1,1-carbonyldiimidazole (1.39 g, 8.56 mmol) in 11 ml of THF was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (860 l, 7.8 mmol) in 11 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (7.1 ml, 1.0 M, 7.1 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.53 g (75% purity, 69% yield) of the title compound were obtained.
(680) LC-MS (Method 9): R.sub.t=1.05 min; MS (ESIpos): m/z=236 [M+H].sup.+
(681) Intermediate 34
2-Amino-1-(1,5-Dimethyl-1H-Pyrazol-4-Yl)Ethan-1-One-Hydrogen Chloride
(682) ##STR00069##
(683) Ethyl 5-(1,5-dimethyl-1H-pyrazol-4-yl)-1,3-oxazole-4-carboxylate (1.53 g, 75% purity, 4.89 mmol) was taken up in 22 ml of 6 N hydrochloric acid and stirred at 100 C. for 1 h. The solvent was removed on a rotary evaporator and the residue was taken up in DCM/MeOH 20:1. The precipitate was filtered, washed with dichloromethane and dried in vacuo. 762 mg (97% purity, 80% yield) of the title compound were obtained.
(684) LC-MS (Method 9): R.sub.t=0.64 min; MS (ESIpos): m/z=154 [MHCl+H].sup.+
(685) Intermediate 35
Tert-Butyl [2-(1,5-Dimethyl-1H-Pyrazol-4-Yl)-2-Oxoethyl]Carbamate
(686) ##STR00070##
(687) 2-amino-1-(1,5-dimethyl-1H-pyrazol-4-yl)ethan-1-one-hydrogen chloride (762 mg, 4.02 mmol) dissolved in 15 ml of dichloromethane was treated with di-tert-butyl dicarbonate (1.0 ml, 4.4 mmol) and triethylamine (1.7 ml, 12 mmol). The mixture was stirred at room temperature over night. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 980 mg (100% purity, 96% yield) of the title compound were obtained.
(688) LC-MS (Method 9): R.sub.t=1.22 min; MS (ESIpos): m/z=254 [M+H].sup.+
(689) Intermediate 36
Rac-Tert-Butyl {[4-(1,5-Dimethyl-1H-Pyrazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(690) ##STR00071##
(691) In a microwave vial tert-butyl [2-(1,5-dimethyl-1H-pyrazol-4-yl)-2-oxoethyl]carbamate (980 mg, 3.87 mmol) was dissolved in 10 ml of methanol. Potassium cyanide (1.26 g, 19.3 mmol) and ammonium carbonate (1.86 g, 19.3 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. for 4 d. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 281 mg (100% purity, 22% yield) of the title compound were obtained.
(692) LC-MS (Method 8): R.sub.t=0.54 min; MS (ESIpos): m/z=324 [M+H].sup.+
(693) Intermediate 37
Rac-5-(Aminomethyl)-5-(1,5-Dimethyl-1H-Pyrazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(694) ##STR00072##
(695) rac-tert-butyl {[4-(1,5-dimethyl-1H-pyrazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (281 mg, 869 mol) was dissolved in 4.5 ml of dichloromethane and treated with 4 N HCl in dioxane (1.1 ml, 4.0 M, 4.3 mmol). The mixture was stirred at room temperature for 4 h. The precipitate was filtered, washed with dichloromethane and dried in vacuo. 237 mg (97% purity, 102% yield) of the title compound were obtained.
(696) LC-MS (Method 9): R.sub.t=0.24 min; MS (ESIpos): m/z=224 [MHCl+H].sup.+
(697) Intermediate 38
Ethyl 5-(2,4-Dimethyl-1,3-Thiazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(698) ##STR00073##
(699) 2,4-dimethyl-1,3-thiazole-5-carboxylic acid (950 mg, 6.04 mmol) and 1,1-carbonyldiimidazole (1.18 g, 7.25 mmol) in 10 ml of THE was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (730 l, 6.6 mmol) in 10 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (6.0 ml, 1.0 M, 6.0 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 25 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 75 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.06 g (100% purity, 70% yield) of the title compound were obtained.
(700) LC-MS (Method 7): R.sub.t=1.30 min; MS (ESIpos): m/z=253 [M+H].sup.+
(701) Intermediate 39
2-Amino-1-(2,4-Dimethyl-1,3-Thiazol-5-Yl)Ethan-1-One-Hydrogen Chloride
(702) ##STR00074##
(703) Ethyl 5-(2,4-dimethyl-1,3-thiazol-5-yl)-1,3-oxazole-4-carboxylate (1.06 g, 4.20 mmol) were taken up in 20 ml of 6 N hydrochloric acid and stirred 1 h at 100 C. The solvent was removed on a rotary evaporator and the residue was taken up in dichloromethane/methanol 20:1. The solvent was removed and the residue was dried in vacuo. 1.07 g (100% purity, 123% yield) of the title compound were obtained.
(704) LC-MS (Method 9): R.sub.t=0.78 min; MS (ESIpos): m/z=171 [MHCl+H].sup.+
(705) Intermediate 40
Tert-Butyl [2-(2,4-Dimethyl-1,3-Thiazol-5-Yl)-2-Oxoethyl]Carbamate
(706) ##STR00075##
(707) 2-amino-1-(2,4-dimethyl-1,3-thiazol-5-yl)ethan-1-one-hydrogen chloride (1.07 g, 5.18 mmol) dissolved in 20 ml of dichloromethane were treated with di-tert-butyl dicarbonate (1.3 ml, 5.7 mmol) and triethylamine (2.2 ml, 16 mmol). The mixture was stirred at room temperature for 3 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.30 g (100% purity, 93% yield) of the title compound were obtained.
(708) LC-MS (Method 9): R.sub.t=1.37 min; MS (ESIpos): m/z=271 [M+H].sup.+
(709) Intermediate 41
Rac-Tert-Butyl {[4-(2,4-Dimethyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(710) ##STR00076##
(711) In a microwave vial tert-butyl [2-(2,4-dimethyl-1,3-thiazol-5-yl)-2-oxoethyl]carbamate (1.30 g, 4.82 mmol) was dissolved in 10 ml of methanol. Potassium cyanide (1.57 g, 24.1 mmol) and ammonium carbonate (2.31 g, 24.1 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 459 mg (100% purity, 28% yield) of the title compound were obtained.
(712) LC-MS (Method 7): R.sub.t=1.08 min; MS (ESIpos): m/z=341 [M+H].sup.+
(713) Intermediate 42
Rac-5-(Aminomethyl)-5-(2,4-Dimethyl-1,3-Thiazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride
(714) ##STR00077##
(715) rac-tert-butyl {[4-(2,4-dimethyl-1,3-thiazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (459 mg, 1.35 mmol) was dissolved in 7 ml of dichloromethane. 4 M hydrochloride acid in 1,4-dioxane (1.7 ml, 4.0 M, 6.7 mmol) was added and the mixture was stirred f or 2 h. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 404 mg (100% purity, 108% yield) of the title compound were obtained.
(716) LC-MS (Method 9): R.sub.t=0.26 min; MS (ESIpos): m/z=241 [MHCl+H].sup.+
(717) Intermediate 43
(718) ##STR00078##
(719) To a suspension of [4-(trifluoromethyl)phenyl]boronic acid (601 mg, 3.16 mmol) and 2-bromo-3,4-difluorobenzoic acid (500 mg, 2.11 mmol) in 1,4-dioxane (13 ml) was added, under argon, a solution of K3PO4 in water (4.2 ml, 1.5 M, 6.3 mmol), dichlorobis(triphenylphosphin)palladium (II) (148 mg, 211 mol, CAS 13965-03-2) and XPhos (101 mg, 211 mol, CAS 564483-18-7). The reaction mixture was first stirred for 3 h at 80 C., then overnight at RT. The resulting mixture was filtered through celite and the filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (Method 2f). 404 mg (100% purity, 63% yield) of the desired product was obtained
(720) LC-MS (Method 7): R.sub.t=1.98 min; MS (ESIneg): m/z=301 [MH].sup.
(721) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.65), 2.070 (0.85), 2.516 (0.59), 2.519 (0.56), 2.523 (0.49), 2.572 (0.46), 7.561 (12.82), 7.574 (14.36), 7.589 (0.47), 7.600 (2.15), 7.615 (4.15), 7.629 (4.31), 7.644 (2.94), 7.659 (0.51), 7.775 (3.26), 7.777 (3.45), 7.784 (3.80), 7.786 (3.66), 7.790 (3.27), 7.792 (3.21), 7.798 (3.48), 7.801 (3.94), 7.806 (16.00), 7.820 (14.36), 13.054 (0.73).
(722) Intermediate 44
Tert-Butyl (2-Oxopentyl)Carbamate
(723) ##STR00079##
(724) 6.90 mL (14.00 mmol) of propylmagnesium chloride (2M in diethyl ether) was slowly added drop wise at 0 C. to a solution of 1.50 g (6.87 mmol) of tert-butyl {2-[methoxy(methyl)amino]-2-oxoethyl}carbamate in 10 mL of anhydrous tetrahydrofuran under nitrogen atmosphere and the mixture was stirred at room temperature for 10 hours. The reaction was quenched with saturated ammonium chloride (aq.) and the resulting slurry was extracted with ethyl acetate. The combined organic extracts were dried over magnesium sulfate, filtered, concentrated and chromatographed in heptane/ethyl acetate mixtures (potassium permanganate stain required) to afford 0.55 g (40%) of the expected compound as a colourless oil.
(725) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.84 (t, 3H), 1.38 (s, 9H), 1.47 (q, 2H), 2.35 (t, 2H), 3.71 (d, 2H), 7.01 (t, 1H).
(726) LC-MS (Method 3): R.sub.t=0.682 min. MS (Mass method 1): m/z=224 (M+Na)+
(727) Intermediate 45
Rac-Tert-Butyl {[2,5-Dioxo-4-Propylimidazolidin-4-Yl]Methyl}Carbamate
(728) ##STR00080##
(729) To a stirring solution of 3.94 g (41.00 mmol) of ammonium carbonate and 0.73 g (13.70 mmol) of ammonium chloride in 10 mL of water placed into a sealed flask, was added 0.55 g (2.73 mmol) of tert-butyl (2-oxopentyl)carbamate in 10 mL of ethanol. After 15 min, 0.80 g (12.30 mmol) of potassium cyanide was added and the mixture was heated at 60 C. for 16 hours. The organic solvent was removed and the resulting aqueous phase was allowed to stand at 0 C. for 12 hours. A white precipitate appeared after that time, which was collected by filtration giving 0.60 g (81%) of the product as a white crystalline solid. The compound was used as such in the next step.
(730) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.84 (t, 3H), 0.99-1.10 (m, 1H), 1.23-1.33 (m, 1H), 1.36 (s, 9H), 1.40-1.55 (m, 2H), 3.12 (d, 2H), 6.78 (bp, 1H), 7.55 (s, 1H), 10.55 (bp, 1H).
(731) LC-MS (Method 3): R.sub.t=0.513 min. MS (Mass method 1): m/z=272 (M+H).sup.+
(732) Intermediate 46
Rac-5-(Aminomethyl)-5-Propylimidazolidine-2,4-Dione Hydrochloride
(733) ##STR00081##
(734) 2.80 mL (11.00 mmol) of 4M hydrochloric acid in dioxane were added to a solution of 0.60 g (2.21 mmol) of rac-tert-Butyl {[2,5-dioxo-4-propylimidazolidin-4-yl]methyl}carbamate in 20 mL of dichloromethane and the mixture was stirred at room temperature for 72 hours. The resulting precipitate was filtered off and washed with dichloromethane, ethyl acetate and diethyl ether to afford 0.45 g (98%) of the product as a white powder. The compound was used in the next step without further purification.
(735) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.89 (t, 3H), 1.00-1.16 (m, 1H), 1.20-1.37 (m, 1H), 1.50-1.68 (m, 2H), 2.90 (d, 1H), 3.08 (d, 1H), 7.94 (s, 1H), 8.09 (bp, 3H), 10.99 (bp, 1H).
(736) LC-MS (Method 3): R.sub.t=0.122 min. MS (Mass method 1): m/z=172 (MHCl+H).sup.+
(737) Intermediate 47
1-Azido-3,3-Dimethylbutan-2-One
(738) ##STR00082##
(739) 0.78 g (11.98 mmol) of sodium azide were suspended in 30 mL of acetone and 1.65 g (9.21 mmol) of 1-bromopinacolone were added. The resulting mixture was stirred at room temperature for 4 hours. The precipitate was filtered off and discarded and the filtrates were concentrated in vacuo to give 1.15 g (88%) of the product as a pale yellow oil. The compound was used as such in the next step.
(740) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=1.10 (s, 9H), 4.38 (s, 2H).
(741) LC-MS (Method 3): R.sub.t=0.138 min. MS (Mass method 1): m/z=no ionisation
(742) Intermediate 48
Rac-5-(Azidomethyl)-5-Tert-Butylimidazolidine-2,4-Dione
(743) ##STR00083##
(744) To a stirring solution of 25.52 g (0.26 mol) of ammonium carbonate and 3.79 g (0.07 mol) of ammonium chloride in 30 mL of water previously placed in a sealed tube was added a solution of 2.50 g (0.02 mol) of 1-azido-3,3-dimethylbutan-2-one in 30 mL of ethanol. After 15 min of stirring at room temperature, 5.19 g (0.08 mol) of potassium cyanide were added and the flask was sealed and stirred at 60 C. for 16 hours. After that time, the organic solvent was removed and the resulting precipitate was filtered off and washed with water to give 2.40 g (64%) of the product as a light brown solid. The compound was used as such in the next step.
(745) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.93 (s, 9H), 3.65 (dd, 2H), 8.13 (s, 1H), 10.72 (s, 1H).
(746) LC-MS (Method 3): R.sub.t=0.398 min. MS (Mass method 1): m/z=212 (M+H).sup.+
(747) Intermediate 49
Rac-5-(Aminomethyl)-5-Tert-Butylimidazolidine-2,4-Dione
(748) ##STR00084##
(749) 2.40 g (11.40 mmol) of rac-5-(azidomethyl)-5-tert-butylimidazolidine-2,4-dione and 2.98 g (11.40 mmol) of triphenylphosphine were dissolved in 40 mL of tetrahydrofuran and 8 mL of water and the mixture was stirred at 65 C. for 4 h. The solvent was removed and the pure compound was precipitated with dichloromethane/methanol 9:1 to give 1.30 g (61%) of the product as a white powder. The compound was used in the next step without further purification.
(750) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.91 (s, 9H), 1.22 (bp, 2H), 2.73 (d, 1H), 2.93 (d, 1H), 7.59 (s, 1H), 10.39 (bp, 1H).
(751) LC-MS (Method 3): R.sub.t=0.239 min. MS (Mass method 1): m/z=186 (M+H).sup.+
(752) Intermediate 50
Ethyl 5-(Oxan-4-Yl)-1,3-Oxazole-4-Carboxylate
(753) ##STR00085##
(754) Oxane-4-carboxylic acid (500 mg, 3.84 mmol) and 1,1-carbonyldiimidazole (748 mg, 4.61 mmol) in 10 ml of THE was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (460 l, 4.2 mmol) in 10 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (3.8 ml, 1.0 M, 3.8 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature over night. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 25 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 75 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 680 mg (100% purity, 79% yield) of the title compound were obtained.
(755) LC-MS (Method 7): R.sub.t=1.15 min; MS (ESIpos): m/z=226 [M+H].sup.+
(756) Intermediate 51
2-Amino-1-(Oxan-4-Yl)Ethan-1-One-Hydrogen Chloride
(757) ##STR00086##
(758) Ethyl 5-(oxan-4-yl)-1,3-oxazole-4-carboxylate (680 mg, 3.02 mmol) were taken up in 10 ml of 6 N hydrochloric acid and stirred 1 h at 100 C. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 590 mg (109% yield) of the title compound were obtained.
(759) Intermediate 52
Tert-Butyl [2-(Oxan-4-Yl)-2-Oxoethyl]Carbamate
(760) ##STR00087##
2-amino-1-(oxan-4-yl)ethan-1-one-hydrogen chloride (590 mg, 3.28 mmol) dissolved in 11 ml of dichloromethane were treated with di-tert-butyl dicarbonate (910 l, 3.9 mmol) and triethylamine (1.4 ml, 9.9 mmol). The mixture was stirred at room temperature over night. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 780 mg (98% yield) of the title compound were obtained.
Intermediate 53
Rac-Tert-Butyl {[2,5-Dioxo-4-(Tetrahydro-2H-Pyran-4-Yl)Imidazolidin-4-Yl]Methyl}Carbamate
(761) ##STR00088##
(762) In a microwave vial tert-butyl [2-(oxan-4-yl)-2-oxoethyl]carbamate (785 mg, 3.23 mmol) was dissolved in 9 ml of methanol. Potassium cyanide (1.05 g, 16.1 mmol) and ammonium carbonate (1.55 g, 16.1 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by preparative HPLC (Column: Chromatorex C18, 25030 mm 10 m; eluent: A=water, B=acetonitrile; gradient: 0 min 5% B, 9 min 5% B, 24 min 95% B, 27 min 95% B, 29 min 10% B; +0.1% formic acid; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 340 mg (100% purity, 34% yield) of the title compound were obtained.
(763) LC-MS (Method 9): R.sub.t=0.70 min; MS (ESIneg): m/z=312 [MH].sup.
(764) Intermediate 54
Rac-5-(Aminomethyl)-5-(Tetrahydro-2H-Pyran-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(765) ##STR00089##
(766) rac-tert-butyl {[2,5-dioxo-4-(tetrahydro-2H-pyran-4-yl)imidazolidin-4-yl]methyl}carbamate (340 mg, 1.09 mmol) was dissolved in 9 ml of dichloromethane. 4 M Hydrochloride acid in 1,4-dioxane (1.4 ml, 4.0 M, 5.4 mmol) was added and the mixture was stirred for 2 h. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. The residue was taken up in 7 ml of dichloromethane again, 4 M hydrochloride acid in 1,4-dioxane (1.4 ml, 4.0 M, 5.4 mmol) was added and the mixture was stirred for 2 h. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 238 mg (77% purity, 68% yield) of the title compound were obtained.
(767) LC-MS (Method 9): R.sub.t=0.26 min; MS (ESIpos): m/z=214 [MHCl+H].sup.+
(768) Intermediate 55
Ethyl 5-(Pyrazin-2-Yl)-1,3-Oxazole-4-Carboxylate
(769) ##STR00090##
(770) Pyrazine-2-carboxylic acid (1.00 g, 8.06 mmol) and 1,1-carbonyldiimidazole (1.57 g, 9.67 mmol) in 10 ml of THE was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (970 l, 8.9 mmol) in 15 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (8.1 ml, 1.0 M, 8.1 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature overnight. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 750 mg (100% purity, 42% yield) of the title compound were obtained.
(771) LC-MS (Method 7): R.sub.t=0.91 min; MS (ESIpos): m/z=220 [M+H].sup.+
(772) Intermediate 56
2-Amino-1-(Pyrazin-2-Yl)Ethan-1-One-Hydrogen Chloride
(773) ##STR00091##
(774) Ethyl 5-(pyrazin-2-yl)-1,3-oxazole-4-carboxylate (750 mg, 3.42 mmol) were taken up in 18 ml of 6 N hydrochloric acid and stirred 2 h at 100 C. The solvent was removed on a rotary evaporator and the residue was taken up in dichloromethane/methanol 20:1. The solvent was removed and the residue was dried in vacuo. 700 mg (118% yield) of the title compound were obtained.
(775) Intermediate 57
Tert-Butyl [2-Oxo-2-(Pyrazin-2-Yl)Ethyl]Carbamate
(776) ##STR00092##
(777) 2-amino-1-(pyrazin-2-yl)ethan-1-one-hydrogen chloride (700 mg, 4.03 mmol) dissolved in 16 ml of dichloromethane were treated with di-tert-butyl dicarbonate (1.0 ml, 4.4 mmol) and triethylamine (1.7 ml, 12 mmol). The mixture was stirred at room temperature for 2 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 530 mg (55% yield) of the title compound were obtained.
(778) Intermediate 58
Rac-Tert-Butyl {[2,5-Dioxo-4-(Pyrazin-2-Yl)Imidazolidin-4-Yl]Methyl}Carbamate
(779) ##STR00093##
(780) In a microwave vial tert-butyl [2-oxo-2-(pyrazin-2-yl)ethyl]carbamate (530 mg, 2.23 mmol) was dissolved in 6 ml of methanol. Potassium cyanide (727 mg, 11.2 mmol) and ammonium carbonate (1.07 g, 11.2 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 25 g; gradient: Cy/EE-gradient, 12% EE-100% EE; then DCM/MeOH 10:1; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 120 mg (86% purity, 15% yield) of the title compound were obtained.
(781) LC-MS (Method 8): R.sub.t=0.52 min; MS (ESIneg): m/z=306 [MH].sup.
(782) Intermediate 59
Rac-5-(Aminomethyl)-5-(Pyrazin-2-Yl)Imidazolidine-2,4-Dione Hydrochloride
(783) ##STR00094##
(784) rac-tert-butyl {[2,5-dioxo-4-(pyrazin-2-yl)imidazolidin-4-yl]methyl}carbamate (120 mg, 390 mol) was dissolved in 3 ml of dichloromethane. 4 M Hydrochloride acid in 1,4-dioxane (490 l, 4.0 M, 2.0 mmol) was added and the mixture was stirred for 2 h. The solvent was removed on a rotary evaporator and the residue was taken up in dichloromethane. The solvent was removed and the residue was dried in vacuo. 98.0 mg (95% purity, 98% yield) of the title compound were obtained.
(785) LC-MS (Method 9): R.sub.t=0.26 min; MS (ESIneg): m/z=206 [MHCl+H].sup.+
(786) Intermediate 60
Ent-Tert-Butyl {[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(787) ##STR00095##
(788) Enantiomeric separation of rac-tert-butyl {[4-(5-methyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (3.00 g, 9.19 mmol) was done using the following method: Column: Chiralpak AD 20 m 45050 mm Solvent: 60% CO.sub.2: 40% methanol Flow: 400 ml/min Backpressure: 130 bar Oven temperature: 35 C. UV: 210 nm
(789) Product containing samples were united, the solvents were evaporated and the residue was lyophilized.
(790) 1.27 g (100% purity, 42% yield)
(791) LC-MS (Method 9): R.sub.t=0.66 min; MS (ESIneg): m/z=325 [MH].sup.
(792) HPLC (Column: Chriralpack AD-3; solvent: 40% methanol: 60% CO.sub.2; flow: 3 ml/min; UV: 210 nm): R.sub.t=1.037 min, 100.0% ee
(793) Intermediate 61
Ent-5-(Aminomethyl)-5-(5-Methyl-1,3-Thiazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(794) ##STR00096##
(795) ent-tert-butyl {[4-(5-methyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (1.27 g, 3.89 mmol) was dissolved in 20 ml of dichloromethane and treated with 4 N HCl in dioxane (4.9 ml, 4.0 M, 19 mmol). The mixture was stirred at room temperature for 2 h. The precipitate was filtered, washed with dichloromethane and dried in vacuo. 1.30 g (100% purity, 128% yield) of the title compound were obtained.
(796) LC-MS (Method 9): R.sub.t=0.23 min; MS (ESIpos): m/z=227 [MHCl+H].sup.+
(797) Intermediate 62
Ethyl 5-(4-Methyl-1,2,5-Oxadiazol-3-Yl)-1,3-Oxazole-4-Carboxylate
(798) ##STR00097##
(799) 4-methyl-1,2,5-oxadiazole-3-carboxylic acid (1.00 g, 7.81 mmol) and 1,1-carbonyldiimidazole (1.52 g, 9.37 mmol) in 10 ml of THE was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (940 l, 8.6 mmol) in 10 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (7.8 ml, 1.0 M, 7.8 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 822 mg (100% purity, 47% yield) of the title compound were obtained.
(800) LC-MS (Method 7): R.sub.t=1.40 min; MS (ESIpos): m/z=224 [M+H].sup.+
(801) Intermediate 63
2-Amino-1-(4-Methyl-1,2,5-Oxadiazol-3-Yl)Ethan-1-One Hydrogen Chloride
(802) ##STR00098##
(803) Ethyl 5-(4-methyl-1,2,5-oxadiazol-3-yl)-1,3-oxazole-4-carboxylate (822 mg, 3.68 mmol) were taken up in 20 ml of 6 N hydrochloric acid and stirred 2 h at 100 C. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 689 mg (100% purity, 105% yield) of the title compound were obtained.
(804) LC-MS (Method 9): R.sub.t=0.78 min; MS (ESIpos): m/z=142 [M+HHCl].sup.+
(805) Intermediate 64
Tert-Butyl [2-(4-Methyl-1,2,5-Oxadiazol-3-Yl)-2-Oxoethyl]Carbamate
(806) ##STR00099##
(807) 2-amino-1-(4-methyl-1,2,5-oxadiazol-3-yl)ethan-1-one hydrogen chloride (689 mg, 3.88 mmol) dissolved in 15 ml of dichloromethane were treated with di-tert-butyl dicarbonate (980 l, 4.3 mmol) and triethylamine (1.6 ml, 12 mmol). The mixture was stirred at room temperature for 2 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.01 g (108% yield) of the title compound were obtained.
(808) Intermediate 65
Rac-Tert-Butyl {[4-(4-Methyl-1,2,5-Oxadiazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(809) ##STR00100##
(810) In a microwave vial tert-butyl [2-(4-methyl-1,2,5-oxadiazol-3-yl)-2-oxoethyl]carbamate (1.01 g, 4.19 mmol) was dissolved in 20 ml of methanol. Potassium cyanide (1.36 g, 20.9 mmol) and ammonium carbonate (2.01 g, 20.9 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by preparative HPLC (column: Chromatorex C18 10 m 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 97.0 mg (82% purity, 6% yield) of the title compound were obtained.
(811) LC-MS (Method 7): R.sub.t=1.21 min; MS (ESIneg): m/z=310 [MH].sup.
(812) Intermediate 66
Rac-5-(Aminomethyl)-5-(4-Methyl-1,2,5-Oxadiazol-3-Yl)Imidazolidine-2,4-Dione Hydrochloride
(813) ##STR00101##
(814) rac-tert-butyl {[4-(4-methyl-1,2,5-oxadiazol-3-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (97.0 mg, 82% purity, 256 mol) was dissolved in 2 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (320 l, 4.0 M, 1.3 mmol) was added and the mixture was stirred over night. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 80.0 mg (94% purity, 119% yield) of the title compound were obtained.
(815) LC-MS (Method 9): R.sub.t=0.23 min; MS (ESIpos): m/z=212 [M+HHCl].sup.+
(816) Intermediate 67
Ethyl 5-(1,4-Dimethyl-1H-Pyrazol-3-Yl)-1,3-Oxazole-4-Carboxylate
(817) ##STR00102##
(818) 1,4-dimethyl-1H-pyrazole-3-carboxylic acid (1.00 g, 7.14 mmol) and 1,1-carbonyldiimidazole (1.39 g, 8.56 mmol) in 10 ml of THE was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (970 l, 8.9 mmol) in 10 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (7.1 ml, 1.0 M, 7.1 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.31 g (98% purity, 76% yield) of the title compound were obtained.
(819) LC-MS (Method 7): R.sub.t=1.12 min; MS (ESIpos): m/z=236 [M+H].sup.+
(820) Intermediate 68
2-Amino-1-(1,4-Dimethyl-1H-Pyrazol-3-Yl)Ethan-1-One Hydrogen Chloride
(821) ##STR00103##
(822) Ethyl 5-(1,4-dimethyl-1H-pyrazol-3-yl)-1,3-oxazole-4-carboxylate (1.31 g, 5.56 mmol) was taken up in 30 ml of 6 N hydrochloric acid and stirred 2 h at 100 C. The solvent was removed on a rotary evaporator and the residue was taken up in dichloromethane/methanol 20:1. The solvent was removed and the residue was dried in vacuo. 1.07 g (90% purity, 91% yield) of the title compound were obtained.
(823) LC-MS (Method 9): R.sub.t=0.81 min; MS (ESIpos): m/z=154 [M+HHCl].sup.+
(824) Intermediate 69
Tert-Butyl [2-(1,4-Dimethyl-1H-Pyrazol-3-Yl)-2-Oxoethyl]Carbamate
(825) ##STR00104##
(826) 2-amino-1-(1,4-dimethyl-1H-pyrazol-3-yl)ethan-1-one-hydrogen chloride (1.07 g, 5.66 mmol) dissolved in 20 ml of dichloromethane was treated with di-tert-butyl dicarbonate (1.4 ml, 6.2 mmol) and triethylamine (2.4 ml, 17 mmol). The mixture was stirred at room temperature for 2 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.53 g (92% purity, 98% yield) of the title compound were obtained.
(827) LC-MS (Method 7): R.sub.t=1.52 min; MS (ESIpos): m/z=198 [M+HC.sub.4H.sub.8].sup.+
(828) Intermediate 70
Rac-Tert-Butyl {[4-(1,4-Dimethyl-1H-Pyrazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(829) ##STR00105##
(830) In a microwave vial tert-butyl [2-(1,4-dimethyl-1H-pyrazol-3-yl)-2-oxoethyl]carbamate (1.53 g, 92% purity, 5.54 mmol) was dissolved in 30 ml of methanol. Potassium cyanide (1.80 g, 27.7 mmol) and ammonium carbonate (2.66 g, 27.7 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 747 mg (100% purity, 42% yield) of the title compound were obtained.
(831) LC-MS (Method 7): R.sub.t=1.02 min; MS (ESIneg): m/z=322 [MH].sup.
(832) Intermediate 71
Rac-5-(Aminomethyl)-5-(1,4-Dimethyl-1H-Pyrazol-3-Yl)Imidazolidine-2,4-Dione Hydrochloride
(833) ##STR00106##
(834) rac-tert-butyl {[4-(1,4-dimethyl-1H-pyrazol-3-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (747 mg, 2.31 mmol) was dissolved in 12 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (2.9 ml, 4.0 M, 12 mmol) was added and the mixture was stirred for 2 h. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 552 mg (99% purity, 91% yield) of the title compound were obtained.
(835) LC-MS (Method 9): R.sub.t=0.24 min; MS (ESIpos): m/z=224 [M+HHCl].sup.+
(836) Intermediate 72
Ethyl 5-(1-Cyclopropyl-1H-Pyrazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(837) ##STR00107##
(838) 1-cyclopropyl-1H-pyrazole-5-carboxylic acid (1.00 g, 6.57 mmol) and 1,1-carbonyldiimidazole (1.28 g, 7.89 mmol) in 11 ml of THE were stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (790 l, 7.2 mmol) in 11 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (6.6 ml, 1.0 M, 6.6 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 25 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 75 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 929 mg (100% purity, 57% yield) of the title compound were obtained.
(839) LC-MS (Method 7): R.sub.t=1.29 min; MS (ESIpos): m/z=248 [M+H].sup.+
(840) Intermediate 73
2-Amino-1-(1-Cyclopropyl-1H-Pyrazol-5-Yl)Ethan-1-One Hydrogen Chloride
(841) ##STR00108##
(842) Ethyl 5-(1-cyclopropyl-1H-pyrazol-5-yl)-1,3-oxazole-4-carboxylate (929 mg, 3.76 mmol) was taken up in 18 ml of 6 N hydrochloric acid and stirred 1 h at 100 C. The solvent was removed on a rotary evaporator and the residue was taken up in dichloromethane/methanol 20:1. The solvent was removed and the residue was dried in vacuo. 886 mg (79% purity, 93% yield) of the title compound were obtained.
(843) LC-MS (Method 9): R.sub.t=0.85 min; MS (ESIneg): m/z=164 [MHHCl].sup.
(844) Intermediate 74
Tert-Butyl [2-(1-Cyclopropyl-1H-Pyrazol-5-Yl)-2-Oxoethyl]Carbamate
(845) ##STR00109##
(846) 2-amino-1-(1-cyclopropyl-1H-pyrazol-5-yl)ethan-1-one hydrogen chloride (886 mg, 79% purity, 3.47 mmol) dissolved in 15 ml of dichloromethane was treated with di-tert-butyl dicarbonate (880 l, 3.8 mmol) and triethylamine (1.5 ml, 10 mmol). The mixture was stirred at room temperature for 3 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 770 mg (78% purity, 65% yield) of the title compound were obtained.
(847) LC-MS (Method 9): R.sub.t=1.46 min; MS (ESIpos): m/z=266 [M+H].sup.+
(848) Intermediate 75
Rac-Tert-Butyl {[4-(1-Cyclopropyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(849) ##STR00110##
(850) In a microwave vial tert-butyl [2-(1-cyclopropyl-1H-pyrazol-5-yl)-2-oxoethyl]carbamate (770 mg, 2.90 mmol) was dissolved in 6 ml of methanol. Potassium cyanide (945 mg, 14.5 mmol) and ammonium carbonate (1.39 g, 14.5 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; then DCM/MeOH 20:1; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 236 mg (86% purity, 21% yield) of the title compound were obtained.
(851) LC-MS (Method 7): R.sub.t=1.03 min; MS (ESIpos): m/z=336 [M+H].sup.+
(852) Intermediate 76
Rac-5-(Aminomethyl)-5-(1-Cyclopropyl-1H-Pyrazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride
(853) ##STR00111##
(854) rac-tert-butyl {[4-(1-cyclopropyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (236 mg, 704 mol) was dissolved in 4 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (880 l, 4.0 M, 3.5 mmol) was added and the mixture was stirred for 2 h. The solvent was removed on a rotary evaporator and the residue was taken up in dichloromethane. The solvent was removed and the residue was dried in vacuo. 208 mg (86% purity, 93% yield) of the title compound were obtained.
(855) LC-MS (Method 9): R.sub.t=0.26 min; MS (ESIpos): m/z=236 [M+HHCl].sup.+
(856) Intermediate 77
Ethyl 5-(3-Methyl-1,2-Oxazol-4-Yl)-1,3-Oxazole-4-Carboxylate
(857) ##STR00112##
(858) 3-methyl-1,2-oxazole-4-carboxylic acid (1.10 g, 8.65 mmol) and 1,1-carbonyldiimidazole (1.68 g, 10.4 mmol) in 11 ml of THF were stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (1.0 ml, 9.5 mmol) in 11 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (8.7 ml, 1.0 M, 8.7 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 813 mg (100% purity, 42% yield) of the title compound were obtained.
(859) LC-MS (Method 9): R.sub.t=1.24 min; MS (ESIpos): m/z=223 [M+H].sup.+
(860) Intermediate 78
2-Amino-1-(3-Methyl-1,2-Oxazol-4-Yl)Ethan-1-One Hydrogen Chloride
(861) ##STR00113##
(862) Ethyl 5-(3-methyl-1,2-oxazol-4-yl)-1,3-oxazole-4-carboxylate (813 mg, 3.66 mmol) was taken up in 17 ml of 6 N hydrochloric acid and stirred 1 h at 100 C. The solvent was removed on a rotary evaporator and the residue was taken up in dichloromethane/methanol 20:1. The solvent was removed and the residue was dried in vacuo. 653 mg (97% purity, 98% yield) of the title compound were obtained.
(863) LC-MS (Method 9): R.sub.t=0.63 min; MS (ESIpos): m/z=141 [M+HHCl].sup.+
(864) Intermediate 79
Tert-Butyl [2-(3-Methyl-1,2-Oxazol-4-Yl)-2-Oxoethyl]Carbamate
(865) ##STR00114##
(866) 2-amino-1-(3-methyl-1,2-oxazol-4-yl)ethan-1-one hydrogen chloride (653 mg, 3.70 mmol) dissolved in 14 ml of dichloromethane was treated with di-tert-butyl dicarbonate (930 l, 4.1 mmol) and triethylamine (1.5 ml, 11 mmol). The mixture was stirred at room temperature over night. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 807 mg (100% purity, 91% yield) of the title compound were obtained.
(867) LC-MS (Method 7): R.sub.t=140.00 min; MS (ESIneg): m/z=285 [MH+CHOOH].sup.
(868) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.280 (0.67), 1.367 (0.73), 1.390 (16.00), 1.469 (13.29), 2.391 (6.59), 3.266 (0.44), 4.207 (1.75), 4.216 (1.73), 5.746 (1.30), 7.122 (0.57), 9.763 (2.49).
(869) Intermediate 80
Rac-Tert-Butyl {[4-(3-Methyl-1,2-Oxazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(870) ##STR00115##
(871) In a microwave vial tert-butyl [2-(3-methyl-1,2-oxazol-4-yl)-2-oxoethyl]carbamate (807 mg, 3.36 mmol) was dissolved in 10 ml of methanol. Potassium cyanide (1.09 g, 16.8 mmol) and ammonium carbonate (1.61 g, 16.8 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. The solvent was removed on a rotary evaporator. The residue was treated with dichloromethane and the precipitate formed was filtered off. The filtrate was concentrated and the crude product was purified by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 5% B; 3 min 5% B; 20 min 50% B; 23 min 100% B; 26 min 5% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 358 mg (100% purity, 34% yield) of the title compound were obtained.
(872) LC-MS (Method 7): R.sub.t=1.02 min; MS (ESIneg): m/z=309 [MH].sup.
(873) Intermediate 81
Rac-5-(Aminomethyl)-5-(3-Methyl-1,2-Oxazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(874) ##STR00116##
(875) rac-tert-butyl {[4-(3-methyl-1,2-oxazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (358 mg, 1.15 mmol) was dissolved in 6 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (1.4 ml, 4.0 M, 5.8 mmol) was added and the mixture was stirred over night. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 274 mg (100% purity, 96% yield) of the title compound were obtained.
(876) LC-MS (Method 9): R.sub.t=0.22 min; MS (ESIpos): m/z=211 [M+HHCl].sup.+
(877) Intermediate 82
Ethyl 5-(Pyridazin-3-Yl)-1,3-Oxazole-4-Carboxylate
(878) ##STR00117##
(879) Pyridazine-3-carboxylic acid (1.00 g, 8.06 mmol) and 1,1-carbonyldiimidazole (1.57 g, 9.67 mmol) in 10 ml of THE were stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (970 l, 8.9 mmol) in 15 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (8.1 ml, 1.0 M, 8.1 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature over night. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 940 mg (70% purity, 37% yield) of the title compound were obtained.
(880) LC-MS (Method 12): R.sub.t=1.05 min; MS (ESIpos): m/z=220 [M+H].sup.+
(881) Intermediate 83
2-Amino-1-(Pyridazin-3-Yl)Ethan-1-One Hydrogen Chloride
(882) ##STR00118##
(883) Ethyl 5-(pyridazin-3-yl)-1,3-oxazole-4-carboxylate (940 mg, 4.29 mmol) was taken up in 23 ml of 6 N hydrochloric acid and stirred 2 h at 100 C. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 800 mg (107% yield) of the title compound were obtained.
(884) Intermediate 84
Tert-Butyl [2-Oxo-2-(Pyridazin-3-Yl)Ethyl]Carbamate
(885) ##STR00119##
(886) 2-amino-1-(pyridazin-3-yl)ethan-1-one hydrogen chloride (800 mg, 4.61 mmol) dissolved in 18 ml of dichloromethane was treated with di-tert-butyl dicarbonate (1.2 ml, 5.1 mmol) and triethylamine (1.9 ml, 14 mmol). The mixture was stirred at room temperature for 2 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 612 mg (56% yield) of the title compound were obtained.
(887) Intermediate 85
Rac-Tert-Butyl {[2,5-Dioxo-4-(Pyridazin-3-Yl)Imidazolidin-4-Yl]Methyl}Carbamate
(888) ##STR00120##
(889) In a microwave vial tert-butyl [2-oxo-2-(pyridazin-3-yl)ethyl]carbamate (612 mg, 2.58 mmol) was dissolved in 7 ml of methanol. Potassium cyanide (840 mg, 12.9 mmol) and ammonium carbonate (1.24 g, 12.9 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. for 48 h. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage IsoleraOne; column: Biotage SNAP Ultra 25 g; gradient: DCM/MeOH-gradient, 10% MeOH-40% MeOH; flow: 75 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 57.0 mg (60% purity, 4% yield) of the title compound were obtained.
(890) LC-MS (Method 9): R.sub.t=0.29 min, MS (ESIpos): m/z=308 [M+H].sup.+
(891) Intermediate 86
Rac-5-(Aminomethyl)-5-(Pyridazin-3-Yl)Imidazolidine-2,4-Dione Hydrochloride
(892) ##STR00121##
(893) rac-tert-butyl {[2,5-dioxo-4-(pyridazin-3-yl)imidazolidin-4-yl]methyl}carbamate (58.0 mg, 189 mol) was dissolved in 2 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (240 l, 4.0 M, 940 mol) was added and the mixture was stirred over night. The solvent was removed on a rotary evaporator and the residue was taken up in dichloromethane. The solvent was removed and the residue was dried in vacuo. 57 mg (124% yield) of the title compound were obtained.
(894) Intermediate 87
Ethyl 4-Methyl[5,5-Bi-1,3-Oxazole]-4-Carboxylate
(895) ##STR00122##
(896) 4-methyl-1,3-oxazole-5-carboxylic acid (1.00 g, 7.87 mmol) and 1,1-carbonyldiimidazole (1.53 g, 9.44 mmol) in 10 ml of THF were stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (950 l, 8.7 mmol) in 10 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (7.9 ml, 1.0 M, 7.9 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.26 g (100% purity, 72% yield) of the title compound were obtained.
(897) LC-MS (Method 7): R.sub.t=1.05 min; MS (ESIpos): m/z=223 [M+H].sup.+
(898) Intermediate 88
2-Amino-1-(4-Methyl-1,3-Oxazol-5-Yl)Ethan-1-One Hydrogen Chloride
(899) ##STR00123##
(900) Ethyl 4-methyl[5,5-bi-1,3-oxazole]-4-carboxylate (1.26 g, 5.69 mmol) was taken up in 30 ml of 6 N hydrochloric acid and stirred 2 h at 100 C. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 1.14 g (113% yield) of the title compound were obtained.
(901) Intermediate 89
Tert-Butyl [2-(4-Methyl-1,3-Oxazol-5-Yl)-2-Oxoethyl]Carbamate
(902) ##STR00124##
(903) 2-amino-1-(4-methyl-1,3-oxazol-5-yl)ethan-1-one hydrogen chloride (1.14 g, 6.46 mmol) dissolved in 30 ml of dichloromethane was treated with di-tert-butyl dicarbonate (1.6 ml, 7.1 mmol) and triethylamine (2.7 ml, 19 mmol). The mixture was stirred at room temperature over night. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 684 mg (44% yield) of the title compound were obtained.
(904) Intermediate 90
Rac-Tert-Butyl {[4-(4-Methyl-1,3-Oxazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(905) ##STR00125##
(906) In a microwave vial tert-butyl [2-(4-methyl-1,3-oxazol-5-yl)-2-oxoethyl]carbamate (383 mg, 1.59 mmol) was dissolved in 10 ml of methanol. Potassium cyanide (519 mg, 7.97 mmol) and ammonium carbonate (766 mg, 7.97 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. The solvent was removed on a rotary evaporator. The crude product was purified by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 5% B; 3 min 5% B; 20 min 50% B; 23 min 100% B; 26 min 5% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 8.00 mg (100% purity, 2% yield) of the title compound were obtained.
(907) LC-MS (Method 7): R.sub.t=0.92 min; MS (ESIpos): m/z=311 [M+H].sup.+
(908) Intermediate 91
Rac-5-(Aminomethyl)-5-(4-Methyl-1,3-Oxazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride
(909) ##STR00126##
(910) rac-tert-butyl {[4-(4-methyl-1,3-oxazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (8.00 mg, 25.8 mol) was dissolved in 0.5 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (32 l, 4.0 M, 130 mol) was added and the mixture was stirred over night. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 8.00 mg (81% purity, 102% yield) of the title compound were obtained.
(911) LC-MS (Method 9): R.sub.t=0.23 min; MS (ESIpos): m/z=211 [M+HHCl].sup.+
(912) Intermediate 92
Ethyl 5-(4-Methyl-1,2-Oxazol-3-Yl)-1,3-Oxazole-4-Carboxylate
(913) ##STR00127##
(914) 4-methyl-1,2-oxazole-3-carboxylic acid (1.00 g, 7.87 mmol) and 1,1-carbonyldiimidazole (1.53 g, 9.44 mmol) in 10 ml of THF were stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (950 l, 8.7 mmol) in 10 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (7.9 ml, 1.0 M, 7.9 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.21 g (100% purity, 69% yield) of the title compound were obtained.
(915) LC-MS (Method 7): R.sub.t=1.22 min; MS (ESIpos): m/z=223 [M+H].sup.+
(916) Intermediate 93
2-Amino-1-(4-Methyl-1,2-Oxazol-3-Yl)Ethan-1-One Hydrogen Chloride
(917) ##STR00128##
(918) Ethyl 5-(4-methyl-1,2-oxazol-3-yl)-1,3-oxazole-4-carboxylate (1.21 g, 5.45 mmol) were taken up in 32 ml of 6 N hydrochloric acid and stirred 2 h at 100 C. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 1.08 g (62% purity, 70% yield) of the title compound were obtained.
(919) LC-MS (Method 9): R.sub.t=0.77 min; MS (ESIpos): m/z=141 [M+HHCl].sup.+
(920) Intermediate 94
Tert-Butyl [2-(4-Methyl-1,2-Oxazol-3-Yl)-2-Oxoethyl]Carbamate
(921) ##STR00129##
(922) 2-amino-1-(4-methyl-1,2-oxazol-3-yl)ethan-1-one hydrogen chloride (1.08 g, 62% purity, 3.80 mmol) dissolved in 20 ml of dichloromethane was treated with di-tert-butyl dicarbonate (960 l, 4.2 mmol) and triethylamine (1.6 ml, 11 mmol). The mixture was stirred at room temperature for 4 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.49 g (42% purity, 69% yield) of the title compound were obtained.
(923) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=263 [M+Na].sup.+
(924) Intermediate 95
Rac-Tert-Butyl {[4-(4-Methyl-1,2-Oxazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(925) ##STR00130##
(926) In a microwave vial tert-butyl [2-(4-methyl-1,2-oxazol-3-yl)-2-oxoethyl]carbamate (1.49 g, 42% purity, 2.60 mmol) was dissolved in 15 ml of methanol. Potassium cyanide (848 mg, 13.0 mmol) and ammonium carbonate (1.25 g, 13.0 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. for 48 h. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 20% MeOH-20% MeOH; flow: 10 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 184 mg (100% purity, 23% yield) of the title compound were obtained.
(927) LC-MS (Method 7): R.sub.t=1.10 min; MS (ESIneg): m/z=309 [MH].sup.
(928) Intermediate 96
Rac-5-(Aminomethyl)-5-(4-Methyl-1,2-Oxazol-3-Yl)Imidazolidine-2,4-Dione Hydrochloride
(929) ##STR00131##
(930) rac-tert-butyl {[4-(4-methyl-1,2-oxazol-3-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (184 mg, 593 mol) was dissolved in 3 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (740 l, 4.0 M, 3.0 mmol) was added and the mixture was stirred for 6 h. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 86.0 mg (98% purity, 58% yield) of the title compound were obtained.
(931) LC-MS (Method 9): R.sub.t=0.22 min; MS (ESIpos): m/z=211 [M+HHCl].sup.+
(932) Intermediate 97
Ethyl 5-(3-Methyl-1,2-Thiazol-4-Yl)-1,3-Oxazole-4-Carboxylate
(933) ##STR00132##
(934) 3-methyl-1,2-thiazole-4-carboxylic acid (1.00 g, 6.98 mmol) dissolved in 10 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.36 g, 8.38 mmol) and stirred at room temperature. After 2 h ethyl isocyanoacetate (840 l, 7.7 mmol), dissolved in 10 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (7.0 ml, 1.0 M, 7.0 mmol) were added at 0 C. The mixture was allowed to warm to room temperature and stirred for 1 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered, Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.28 g (99% purity, 76% yield) of the title compound were obtained.
(935) LC-MS (Method 7): R.sub.t=1.32 min; MS (ESIpos): m/z=239 [M+H].sup.+
(936) Intermediate 98
2-Amino-1-(3-Methyl-1,2-Thiazol-4-Yl)Ethan-1-One-Hydrogen Chloride
(937) ##STR00133##
(938) Ethyl 5-(3-methyl-1,2-thiazol-4-yl)-1,3-oxazole-4-carboxylate (1.28 g, 5.36 mmol) was taken up in 30 ml of 6 N hydrochloric acid and stirred at 100 C. After 2 h the solvent was removed on a rotary evaporator and the residue was treated with DCM. The solvent was removed and the residue was dried in vacuo. 1.27 g (85% purity, 105% yield) of the title compound were obtained.
(939) LC-MS (Method 9): R.sub.t=0.74 min; MS (ESIpos): m/z=157 [M+HHCl].sup.+
(940) Intermediate 99
Tert-Butyl [2-(3-Methyl-1,2-Thiazol-4-Yl)-2-Oxoethyl]Carbamate
(941) ##STR00134##
(942) 2-amino-1-(3-methyl-1,2-thiazol-4-yl)ethan-1-one-hydrogen chloride (1.27 g, 6.59 mmol) dissolved in 30 ml of dichloromethane was treated with di-tert-butyl dicarbonate (1.7 ml, 7.3 mmol) and triethylamine (2.8 ml, 20 mmol). The mixture was stirred at room temperature. After 2 h the solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.86 g (79% purity, 87% yield) of the title compound were obtained.
(943) LC-MS (Method 8): R.sub.t=0.79 min; MS (ESIpos): m/z=257 [M+H].sup.+
(944) Intermediate 100
Rac-Tert-Butyl {[4-(3-Methyl-1,2-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(945) ##STR00135##
(946) In a microwave vial tert-butyl [2-(3-methyl-1,2-thiazol-4-yl)-2-oxoethyl]carbamate (1.86 g, 78% purity, 5.67 mmol) was dissolved in 20 ml of methanol. Potassium cyanide (1.85 g, 28.4 mmol) and ammonium carbonate (2.73 g, 28.4 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 739 mg (100% purity, 40% yield) of the title compound were obtained.
(947) LC-MS (Method 7): R.sub.t=1.06 min; MS (ESIpos): m/z=327 [M+H].sup.+
(948) Intermediate 101
Rac-5-(Aminomethyl)-5-(3-Methyl-1,2-Thiazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(949) ##STR00136##
(950) rac-tert-butyl {[4-(3-methyl-1,2-thiazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (739 mg, 2.26 mmol) was dissolved in 20 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (2.8 ml, 4.0 M, 11 mmol) was added and the mixture was stirred for 5 h. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 670 mg (100% purity, 113% yield) of the title compound were obtained.
(951) LC-MS (Method 9): R.sub.t=0.24 min; MS (ESIpos): m/z=227 [M+HHCl].sup.+
(952) Intermediate 102
Ethyl 5-(4-Methyl-1,2,5-Thiadiazol-3-Yl)-1,3-Oxazole-4-Carboxylate
(953) ##STR00137##
(954) 4-methyl-1,2,5-thiadiazole-3-carboxylic acid (1.00 g, 6.94 mmol) dissolved in 10 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.35 g, 8.32 mmol) and stirred at room temperature. After 2 h ethyl isocyanoacetate (830 l, 7.6 mmol), dissolved in 10 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (6.9 ml, 1.0 M, 6.9 mmol) were added at 0 C. The mixture was allowed to warm to room temperature and stirred for 1 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered, Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.31 g (100% purity, 79% yield) of the title compound were obtained.
(955) LC-MS (Method 7): R.sub.t=1.39 min; MS (ESIpos): m/z=240 [M+H].sup.+
(956) Intermediate 103
2-Amino-1-(4-Methyl-1,2,5-Thiadiazol-3-Yl)Ethan-1-One-Hydrogen Chloride
(957) ##STR00138##
(958) Ethyl 5-(4-methyl-1,2,5-thiadiazol-3-yl)-1,3-oxazole-4-carboxylate (1.31 g, 5.46 mmol) was taken up in 30 ml of 6 N hydrochloric acid and stirred at 100 C. After 2 h the solvent was removed on a rotary evaporator and the residue was treated with DCM. The solvent was removed and the residue was dried in vacuo. 1.03 g (100% purity, 98% yield) of the title compound were obtained.
(959) LC-MS (Method 9): R.sub.t=0.83 min; MS (ESIpos): m/z=158 [M+HHCl].sup.+
(960) Intermediate 104
Tert-Butyl [2-(4-Methyl-1,2,5-Thiadiazol-3-Yl)-2-Oxoethyl]Carbamate
(961) ##STR00139##
(962) 2-amino-1-(4-methyl-1,2,5-thiadiazol-3-yl)ethan-1-one-hydrogen chloride (1.04 g, 5.37 mmol) dissolved in 25 ml of dichloromethane was treated with di-tert-butyl dicarbonate (1.4 ml, 5.9 mmol) and triethylamine (2.2 ml, 16 mmol). The mixture was stirred at room temperature. After 2 h the solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.59 g (100% purity, 115% yield) of the title compound were obtained.
(963) LC-MS (Method 7): R.sub.t=1.71 min; MS (ESIpos): m/z=202 [M+HC4H8].sup.+
(964) Intermediate 105
Rac-Tert-Butyl {[4-(4-Methyl-1,2,5-Thiadiazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(965) ##STR00140##
(966) In a microwave vial tert-butyl [2-(4-methyl-1,2,5-thiadiazol-3-yl)-2-oxoethyl]carbamate (1.59 g, 6.19 mmol) was dissolved in 20 ml of methanol. Potassium cyanide (2.01 g, 30.9 mmol) and ammonium carbonate (2.97 g, 30.9 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.12 g (100% purity, 55% yield) of the title compound were obtained.
(967) LC-MS (Method 7): R.sub.t=1.17 min; MS (ESIneg): m/z=326 [MH].sup.
(968) Intermediate 106
Rac-5-(Aminomethyl)-5-(4-Methyl-1,2,5-Thiadiazol-3-Yl)Imidazolidine-2,4-Dione Hydrochloride
(969) ##STR00141##
(970) rac-tert-butyl {[4-(4-methyl-1,2,5-thiadiazol-3-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (1.12 g, 3.42 mmol) was dissolved in 30 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (4.3 ml, 4.0 M, 17 mmol) was added and the mixture was stirred over night. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 928 mg (100% purity, 103% yield) of the title compound were obtained.
(971) LC-MS (Method 9): R.sub.t=0.64 min; MS (ESIpos): m/z=228 [M+HHCl].sup.+
(972) Intermediate 107
Ethyl 5-(1,4-Dimethyl-1H-Pyrazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(973) ##STR00142##
(974) 1,4-dimethyl-1H-pyrazole-5-carboxylic acid (1.00 g, 7.14 mmol) dissolved in 10 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.39 g, 8.56 mmol) and stirred at room temperature. After 2 h ethyl isocyanoacetate (860 l, 7.8 mmol), dissolved in 10 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (7.1 ml, 1.0 M, 7.1 mmol) were added at 0 C. The mixture was allowed to warm to room temperature and stirred for 1 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered, Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.14 g (100% purity, 68% yield) of the title compound were obtained.
(975) LC-MS (Method 7): R.sub.t=1.19 min; MS (ESIpos): m/z=236 [M+H].sup.+
(976) Intermediate 108
2-Amino-1-(1,4-Dimethyl-1H-Pyrazol-5-Yl)Ethan-1-One-Hydrogen Chloride
(977) ##STR00143##
(978) Ethyl 5-(1,4-dimethyl-1H-pyrazol-5-yl)-1,3-oxazole-4-carboxylate (1.14 g, 4.85 mmol) was taken up in 25 ml of 6 N hydrochloric acid and stirred at 100 C. After 2 h the solvent was removed on a rotary evaporator and the residue was treated with DCM. The solvent was removed an the residue was dried in vacuo. 1.14 g (57% purity, 71% yield) of the title compound were obtained.
(979) LC-MS (Method 9): R.sub.t=0.75 min; MS (ESIpos): m/z=154 [M+HHCl].sup.+
(980) Intermediate 109
Tert-Butyl [2-(1,4-Dimethyl-1H-Pyrazol-5-Yl)-2-Oxoethyl]Carbamate
(981) ##STR00144##
(982) 2-amino-1-(1,4-dimethyl-1H-pyrazol-5-yl)ethan-1-one hydrogen chloride (1.14 g, 57% purity, 3.43 mmol) dissolved in 20 ml of dichloromethane was treated with di-tert-butyl dicarbonate (870 l, 3.8 mmol) and triethylamine (1.4 ml, 10 mmol). The mixture was stirred at room temperature. After 2 h the solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.06 g (71% purity, 86% yield) of the title compound were obtained.
(983) LC-MS (Method 7): R.sub.t=1.50 min; MS (ESIpos): m/z=254 [M+H].sup.+
(984) Intermediate 110
Rac-Tert-Butyl {[4-(1,4-Dimethyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(985) ##STR00145##
(986) In a microwave vial tert-butyl [2-(1,4-dimethyl-1H-pyrazol-5-yl)-2-oxoethyl]carbamate (1.06 g, 70% purity, 2.92 mmol) was dissolved in 15 ml of methanol. Potassium cyanide (950 mg, 14.6 mmol) and ammonium carbonate (1.40 g, 14.6 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. for 3 d. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 465 mg (73% purity, 36% yield) of the title compound were obtained.
(987) LC-MS (Method 7): R.sub.t=1.05 min; MS (ESIpos): m/z=324 [M+H].sup.+
(988) Intermediate 111
Rac-5-(Aminomethyl)-5-(1,4-Dimethyl-1H-Pyrazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride
(989) ##STR00146##
(990) rac-tert-butyl {[4-(1,4-dimethyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (465 mg, 72% purity, 1.04 mmol) was dissolved in 10 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (1.3 ml, 4.0 M, 5.2 mmol) was added and the mixture was stirred for 2 h. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 223 mg (86% purity, 71% yield) of the title compound were obtained.
(991) LC-MS (Method 9): R.sub.t=0.24 min; MS (ESIpos): m/z=224 [M+HHCl].sup.+
(992) Intermediate 112
Ethyl 5-(1,3-Dimethyl-1H-Pyrazol-4-Yl)-1,3-Oxazole-4-Carboxylate
(993) ##STR00147##
(994) 1,3-dimethyl-1H-pyrazole-4-carboxylic acid (1.00 g, 7.14 mmol) dissolved in 10 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.39 g, 8.56 mmol) and stirred at room temperature. After 2 h ethyl isocyanoacetate (860 l, 7.8 mmol), dissolved in 10 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (7.1 ml, 1.0 M, 7.1 mmol) were added at 0 C. The mixture was allowed to warm to room temperature and stirred for 1 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered, Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.30 g (100% purity, 77% yield) of the title compound were obtained.
(995) LC-MS (Method 7): R.sub.t=1.16 min; MS (ESIpos): m/z=236 [M+H].sup.+
(996) Intermediate 113
2-Amino-1-(1,3-Dimethyl-1H-Pyrazol-4-Yl)Ethan-1-One Hydrogen Chloride
(997) ##STR00148##
(998) Ethyl 5-(1,3-dimethyl-1H-pyrazol-4-yl)-1,3-oxazole-4-carboxylate (1.30 g, 5.51 mmol) was taken up in 30 ml of 6 N hydrochloric acid and stirred at 100 C. After 2 h the solvent was removed on a rotary evaporator and the residue was treated with DCM. The solvent was removed and the residue was dried in vacuo. 1.44 g (100% purity, 138% yield) of the title compound were obtained.
(999) LC-MS (Method 9): R.sub.t=0.63 min; MS (ESIpos): m/z=154 [M+HHCl].sup.+
(1000) Intermediate 114
Tert-Butyl [2-(1,3-Dimethyl-1H-Pyrazol-4-Yl)-2-Oxoethyl]Carbamate
(1001) ##STR00149##
(1002) 2-amino-1-(1,3-dimethyl-1H-pyrazol-4-yl)ethan-1-one-hydrogen chloride (1.44 g, 7.59 mmol) dissolved in 35 ml of dichloromethane was treated with di-tert-butyl dicarbonate (1.9 ml, 8.4 mmol) and triethylamine (3.2 ml, 23 mmol). The mixture was stirred at room temperature. After 2 h the solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.75 g (100% purity, 91% yield) of the title compound were obtained.
(1003) LC-MS (Method 7): R.sub.t=1.28 min; MS (ESIpos): m/z=254 [M+H].sup.+
(1004) Intermediate 115
Rac-Tert-Butyl {[4-(1,3-Dimethyl-1H-Pyrazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1005) ##STR00150##
(1006) In a microwave vial tert-butyl [2-(1,3-dimethyl-1H-pyrazol-4-yl)-2-oxoethyl]carbamate (1.75 g, 6.91 mmol) was dissolved in 20 ml of methanol. Potassium cyanide (2.25 g, 34.6 mmol) and ammonium carbonate (3.32 g, 34.6 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. for 48 h. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 667 mg (100% purity, 30% yield) of the title compound were obtained.
(1007) LC-MS (Method 7): R.sub.t=0.93 min; MS (ESIpos): m/z=324 [M+H].sup.+
(1008) Intermediate 116
Rac-5-(Aminomethyl)-5-(1,3-Dimethyl-1H-Pyrazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1009) ##STR00151##
(1010) rac-tert-butyl {[4-(1,3-dimethyl-1H-pyrazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (667 mg, 2.06 mmol) was dissolved in 20 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (2.6 ml, 4.0 M, 10 mmol) was added and the mixture was stirred over night. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 660 mg (98% purity, 121% yield) of the title compound were obtained.
(1011) LC-MS (Method 9): R.sub.t=0.24 min; MS (ESIpos): m/z=224 [M+HHCl].sup.+
(1012) Intermediate 117
Ethyl 5-(4-Methyl-1,2-Oxazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(1013) ##STR00152##
(1014) 4-methyl-1,2-oxazole-5-carboxylic acid (1.00 g, 7.87 mmol) dissolved in 10 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.53 g, 9.44 mmol) and stirred at room temperature. After 2 h ethyl isocyanoacetate (950 l, 8.7 mmol), dissolved in 10 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (7.9 ml, 1.0 M, 7.9 mmol) were added at 0 C. The mixture was allowed to warm to room temperature and stirred for 1 h. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered, Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.28 g (100% purity, 73% yield) of the title compound were obtained.
(1015) LC-MS (Method 7): R.sub.t=1.25 min; MS (ESIpos): m/z=223 [M+H].sup.+
(1016) Intermediate 118
2-Amino-1-(4-Methyl-1,2-Oxazol-5-Yl)Ethan-1-One Hydrogen Chloride
(1017) ##STR00153##
(1018) Ethyl 5-(4-methyl-1,2-oxazol-5-yl)-1,3-oxazole-4-carboxylate (1.28 g, 5.75 mmol) was taken up in 30 ml of 6 N hydrochloric acid and stirred at 100 C. After 2 h the solvent was removed on a rotary evaporator and the residue was treated with DCM. The solvent was removed and the residue was dried in vacuo. 1.11 g (100% purity, 109% yield) of the title compound were obtained.
(1019) LC-MS (Method 9): R.sub.t=0.68 min, MS (ESIpos): m/z=141 [M+HHCl].sup.+
(1020) Intermediate 119
Tert-Butyl [2-(4-Methyl-1,2-Oxazol-5-Yl)-2-Oxoethyl]Carbamate
(1021) ##STR00154##
(1022) 2-amino-1-(4-methyl-1,2-oxazol-5-yl)ethan-1-one-hydrogen chloride (1.11 g, 6.26 mmol) dissolved in 30 ml of dichloromethane was treated with di-tert-butyl dicarbonate (1.6 ml, 6.9 mmol) and triethylamine (2.6 ml, 19 mmol). The mixture was stirred at room temperature. After 2 h the solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.45 g (96% yield) of the title compound were obtained.
(1023) Intermediate 120
Rac-Tert-Butyl {[4-(4-Methyl-1,2-Oxazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1024) ##STR00155##
(1025) In a microwave vial tert-butyl [2-(4-methyl-1,2-oxazol-5-yl)-2-oxoethyl]carbamate (1.45 g, 6.03 mmol) was dissolved in 20 ml of methanol. Potassium cyanide (1.96 g, 30.2 mmol) and ammonium carbonate (2.90 g, 30.2 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. over night. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 612 mg (100% purity, 33% yield) of the title compound were obtained.
(1026) LC-MS (Method 7): R.sub.t=1.06 min; MS (ESIneg): m/z=309 [MH].sup.
(1027) Intermediate 121
Rac-5-(Aminomethyl)-5-(4-Methyl-1,2-Oxazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1028) ##STR00156##
(1029) rac-tert-butyl {[4-(4-methyl-1,2-oxazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (612 mg, 1.97 mmol) was dissolved in 17 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (2.5 ml, 4.0 M, 9.9 mmol) was added and the mixture was stirred over night. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 447 mg (95% purity, 87% yield) of the title compound were obtained.
(1030) LC-MS (Method 9): R.sub.t=0.22 min; MS (ESIpos): m/z=211 [M+HHCl].sup.+
(1031) Intermediate 122
Ethyl 5-(3-Methylbutyl)-1,3-Oxazole-4-Carboxylate
(1032) ##STR00157##
(1033) 4-methylpentanoic acid (1.00 g, 8.61 mmol) dissolved in 10 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.68 g, 10.3 mmol) and stirred at room temperature. After 2 h ethyl isocyanoacetate (1.0 ml, 9.5 mmol), dissolved in 10 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (8.6 ml, 1.0 M, 8.6 mmol) were added at 0 C. The mixture was allowed to warm to room temperature and stirred over night. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered, Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 6% EE-50% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 970 mg (100% purity, 53% yield) of the title compound were obtained.
(1034) LC-MS (Method 8): R.sub.t=0.99 min; MS (ESIpos): m/z=212 [M+H].sup.+
(1035) Intermediate 123
1-Amino-5-Methylhexan-2-One-Hydrogen Chloride
(1036) ##STR00158##
(1037) Ethyl 5-(3-methylbutyl)-1,3-oxazole-4-carboxylate (970 mg, 4.59 mmol) was taken up in 16 ml of 6 N hydrochloric acid and stirred at 100 C. After 2 h the solvent was removed on a rotary evaporator and the residue was dried in vacuo. 570 mg (75% yield) of the title compound were obtained.
(1038) Intermediate 124
Tert-Butyl (5-Methyl-2-Oxohexyl)Carbamate
(1039) ##STR00159##
(1040) 1-amino-5-methylhexan-2-one-hydrogen chloride (700 mg, 4.23 mmol) dissolved in 15 ml of dichloromethane was treated with di-tert-butyl dicarbonate (1.2 ml, 5.1 mmol) and triethylamine (1.8 ml, 13 mmol). The mixture was stirred at room temperature over night. After that time the solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 863 mg (89% yield) of the title compound were obtained.
(1041) Intermediate 125
Rac-Tert-Butyl {[4-(3-Methylbutyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1042) ##STR00160##
(1043) In a microwave vial ammonium carbonate (3.62 g, 37.6 mmol) and ammonium chloride (805 mg, 15.1 mmol) were dissolved in 6.5 ml of water. tert-butyl (5-methyl-2-oxohexyl)carbamate (863 mg, 3.76 mmol) dissolved in 6.5 ml of ethanol was added and the mixture was stirred at room temperature for 15 min. After that time potassium cyanide (1.10 g, 16.9 mmol) was added and the vial was sealed. The mixture was stirred at 60 C. over night. The solvent was removed on a rotary evaporator. The residue was taken up with water and extracted three times with ethyl acetate. The organic layer was washed with saturated aqueous sodium chloride solution, dried over sodium sulfate, filtered and the solvent was evaporated on a rotary evaporator. 790 mg (76% purity, 53% yield) of the title compound were obtained.
(1044) LC-MS (Method 7): R.sub.t=1.46 min; MS (ESIneg): m/z=298 [MH].sup.
(1045) Intermediate 126
Rac-5-(Aminomethyl)-5-(3-Methylbutyl)Imidazolidine-2,4-Dione Hydrochloride
(1046) ##STR00161##
(1047) rac-tert-butyl {[4-(3-methylbutyl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (790 mg, 78% purity, 2.06 mmol) was dissolved in 40 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (2.6 ml, 4.0 M, 10 mmol) was added and the mixture was stirred over night. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 663 mg (90% purity, 123% yield) of the title compound were obtained.
(1048) LC-MS (Method 9): R.sub.t=0.76 min; MS (ESIpos): m/z=200 [M+HHCl].sup.+
(1049) Intermediate 127
Rac-Ethyl 5-Sec-Butyl-1,3-Oxazole-4-Carboxylate
(1050) ##STR00162##
(1051) A solution of rac-2-methylbutanoic acid (1.1 ml, 9.8 mmol) and 1,1-carbonyldiimidazole (1.91 g, 11.7 mmol) in 10 ml of THE was stirred for 3 h at room temperature. After that time, a solution of ethyl isocyanoacetate (1.2 ml, 11 mmol) in 10 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (9.8 ml, 1.0 M, 9.8 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 3 h. The reaction was concentrated in vacuo and extracted with ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 8% EE-66% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 446 mg (97% purity, 22% yield) of the title compound were obtained.
(1052) LC-MS (Method 7): R.sub.t=1.70 min; MS (ESIpos): m/z=198 [M+H].sup.+
(1053) Intermediate 128
Rac-1-Amino-3-Methylpentan-2-One Hydrochloride
(1054) ##STR00163##
(1055) rac-ethyl 5-sec-butyl-1,3-oxazole-4-carboxylate (446 mg, 2.26 mmol) were taken up in 7.5 ml of 6 N hydrochloric acid and stirred at 100 C. over night. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 372 mg (108% yield) of the title compound were obtained.
(1056) Intermediate 129
Rac-Tert-Butyl (3-Methyl-2-Oxopentyl)Carbamate
(1057) ##STR00164##
(1058) rac-1-amino-3-methylpentan-2-one hydrochloride (372 mg, 2.45 mmol) dissolved in 15 ml of dichloromethane were treated with di-tert-butyl dicarbonate (620 l, 2.7 mmol) and triethylamine (1.0 ml, 7.4 mmol). The mixture was stirred at room temperature overnight. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 480 mg (100% purity, 91% yield) of the title compound were obtained.
(1059) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.786 (2.10), 0.804 (4.90), 0.823 (2.39), 0.958 (3.46), 0.975 (3.56), 1.290 (0.48), 1.308 (0.75), 1.324 (1.46), 1.343 (0.69), 1.366 (2.11), 1.377 (16.00), 1.468 (1.14), 1.532 (0.41), 1.550 (0.50), 1.567 (0.50), 1.584 (0.41), 2.519 (0.94), 3.778 (0.94), 3.789 (1.12), 3.793 (1.06), 3.804 (0.89), 6.977 (0.42).
(1060) Intermediate 130
Diamix-Tert-Butyl [(4-Sec-Butyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]Carbamate
(1061) ##STR00165##
(1062) In a microwave vial rac-tert-butyl (3-methyl-2-oxopentyl)carbamate (480 mg, 2.23 mmol) was dissolved in 4 ml of methanol. Potassium cyanide (581 mg, 8.92 mmol) and ammonium carbonate (857 mg, 8.92 mmol) were added. The vial was sealed and the mixture was stirred at 40 C. over night. The mixture was filtered an the filtrate was purified by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min; 0.1% formic acid). Product containing samples were united and the solvents were removed on a rotary evaporator. 237 mg (100% purity, 37% yield) of the title compound were obtained.
(1063) LC-MS (Method 7): R.sub.t=1.27 min; MS (ESIneg): m/z=284 [MH].sup.
(1064) LC-MS (Method 8): R.sub.t=0.74 min; MS (ESIneg): m/z=284 [MH].sup.
(1065) Intermediate 131
Diamix-5-(Aminomethyl)-5-Sec-Butylimidazolidine-2,4-Dione Hydrochloride
(1066) ##STR00166##
(1067) diamix-tert-butyl [(4-sec-butyl-2,5-dioxoimidazolidin-4-yl)methyl]carbamate (235 mg, 824 mol) was dissolved in 3 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (1.0 ml, 4.0 M, 4.1 mmol) was added and the mixture was stirred for 4 h. The solvent was removed on a rotary evaporator. The residue was taken up in dichloromethane, the precipitate was filtered off, washed with dichloromethane and dried in vacuo. 155 mg (100% purity, 85% yield) of the title compound were obtained.
(1068) LC-MS (Method 9): R.sub.t=0.36 min; MS (ESIpos): m/z=186 [MHCl+H].sup.+
(1069) Intermediate 132
Tert-Butyl {2-[Methoxy(Methyl)Amino]-2-Oxoethyl}Carbamate
(1070) ##STR00167##
(1071) 7.30 mL (56.00 mmol) of isobutyl chloroformate was added to a solution of 6.53 g (37.30 mmol) of N-BOC-glycine and 8.20 mL (75.00 mmol) of 4-methylmorpholine in 100 mL of dichloromethane at 15 C. and the mixture was stirred for 1 hour. Then 4.00 g (41.00 mmol) of N,O-dimethylhydroxiamine hydrochloride in 20 mL of dichloromethane was added to the solution at 15 C. and the reaction was further stirred at room temperature for 2 hours. The mixture was quenched with water and extracted with dichloromethane. The combined organic layers were dried over magnesium sulfate, filtered and concentrated. The corresponding residue was purified by flash chromatography on silica gel eluting with dichloromethane/methanol mixtures to afford 4.62 g (57%) of the product as a white powder.
(1072) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=137 (s, 9H), 3.08 (s, 3H), 3.67 (s, 3H), 3.82 (d, 2H), 6.82 (bp, 1H).
(1073) LC-MS (Method 3): R.sub.t=0.499 min. MS (Mass method 1): m/z=163 (MtBu+H).sup.+
(1074) Intermediate 133
Tert-Butyl (2-Cyclopentyl-2-Oxoethyl)Carbamate
(1075) ##STR00168##
(1076) To a solution of 2.20 g (10.10 mmol) of tert-butyl {2-[methoxy(methyl)amino]-2-oxoethyl}carbamate in 10 mL of anhydrous tetrahydrofuran under inert atmosphere at 0 C. was added dropwise 13.00 mL (25.00 mmol) of cyclopentylmagnesium chloride solution (2M in tetrahydrofuran) and the reaction was stirred at room temperature for 12 hours. The solvent was partially removed and the mixture was diluted with ethyl acetate and quenched with saturated ammonium chloride (aq.). The organic layer was isolated, dried over magnesium sulfate, filtered and concentrated to afford a residue, which was purified by flash column chromatography on silica gel eluting with heptane/ethyl acetate to give 0.58 g (25%) of the product as a yellowish oil.
(1077) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=1.37 (s, 9H), 1.49-1.67 (m, 6H), 1.68-1.84 (m, 2H), 2.85-3.00 (m, 1H), 3.80 (d, 2H), 6.98 (t, 1H).
(1078) LC-MS (Method 3): R.sub.t=0.795 min. MS (Mass method 1): m/z=172 (MtBu+H).sup.+
(1079) Intermediate 134
Rac-Tert-Butyl {[4-Cyclopentyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1080) ##STR00169##
(1081) A solution of 0.58 g (2.56 mmol) of tert-butyl (2-cyclopentyl-2-oxoethyl)carbamate in 5 mL of ethanol was added to another solution of 0.33 g (5.12 mmol) of potassium cyanide and 2.46 g (25.60 mmol) of ammonium carbonate in 5 mL of water into a pressure flask, the container was sealed and the mixture was stirred at 60 C. for 12 hours. The ethanol was removed under reduced pressure and the resulting precipitate was collected by filtration, washed with water and dried in vacuo to give 0.46 g (60%) of the product as white solid.
(1082) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=1.09-1.31 (m, 2H), 1.36 (s, 9H), 1.40-1.60 (m, 5H), 1.61-1.75 (m, 1H), 2.01-2.16 (m, 1H), 3.20-3.25 (m, 2H), 6.74 (t, 1H), 7.61 (s, 1H), 10.53 (bp, 1H).
(1083) LC-MS (Method 3): R.sub.t=0.601 min. MS (Mass method 1): m/z=320 (M+Na)+
(1084) Intermediate 135
Rac-5-(Aminomethyl)-5-Cyclopentylimidazolidine-2,4-Dione Hydrochloride
(1085) ##STR00170##
(1086) 1.90 mL (7.70 mmol) of 4N hydrochloric acid in dioxane were added to a solution of 0.46 g (1.55 mmol) of rac-tert-Butyl {[4-cyclopentyl-2,5-dioxoimidazolidin-4-yl]methyl}carbamate in 10 mL of dichloromethane and the mixture was allowed to stir at room temperature for 16 hours. The resulting precipitate was collected by filtration and washed with dichloromethane, ethyl acetate and diethyl ether to give 0.32 g (88%) of the product as a yellow sticky solid. The compound was used as such in the next step.
(1087) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=1.13-1.38 (m, 2H), 1.40-1.63 (m, 5H), 1.65-1.77 (m, 1H), 2.10-2.25 (m, 1H), 2.95 (d, 1H), 3.12 (d, 1H), 8.09 (s, 1H), 8.20 (bp, 3H), 10.99 (bp, 1H).
(1088) LC-MS (Method 1): R.sub.t=0.801 min. MS (Mass method 1): m/z=198 (M+H).sup.+
(1089) Intermediate 136
4-Chloro-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzoic Acid
(1090) ##STR00171##
(1091) 2-borono-4-chlorobenzoic acid (250 mg, 1.25 mmol) and 5-bromo-2-(trifluoromethyl)pyridine (352 mg, 1.56 mmol) dissolved in 7 ml 1,2-dimethoxethane were treated with sodium carbonate in water (3.1 ml, 2.0 M, 6.2 mmol). The mixture was degassed with argon. Then tetrakis(triphenylphosphine)palladium(0) (72.1 mg, 62.4 mol) was added and the mixture was stirred at 80 C. over night. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 47.0 mg (100% purity, 12% yield) of the title compound were obtained.
(1092) LC-MS (Method 7): R.sub.t=1.87 min; MS (ESIpos): m/z=302 [M+H].sup.+
(1093) Intermediate 137
3,4-Difluoro-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzoic Acid
(1094) ##STR00172##
(1095) 3,4-difluoro-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoic acid (250 mg, 880 mol) and 5-bromo-2-(trifluoromethyl)pyridine (249 mg, 1.10 mmol) dissolved in 5 ml 1,2-dimethoxethane were treated with sodium carbonate in water (2.2 ml, 2.0 M, 4.4 mmol). The mixture was degassed with argon. Then tetrakis(triphenylphosphine)palladium(0) (50.8 mg, 44.0 mol) was added and the mixture was stirred at 80 C. over night. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 21.0 mg (100% purity, 8% yield) of the title compound were obtained.
(1096) LC-MS (Method 7): R.sub.t=1.74 min; MS (ESIpos): m/z=304 [M+H].sup.+
(1097) Intermediate 138
Ethyl 5-Ethyl-1,3-Oxazole-4-Carboxylate
(1098) ##STR00173##
(1099) Propanoic acid (1.00 g, 13.5 mmol) dissolved in 15 ml of THF was treated with 1,1,-carbonyl-diimidazole (2.63 g, 16.2 mmol) and stirred at room temperature. After 2 h ethyl isocyanoacetate (1.6 ml, 15 mmol), dissolved in 10 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (13 ml, 1.0 M, 13 mmol) were added at 0 C. The mixture was allowed to warm to room temperature and stirred over night. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered, Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 8% EE-80% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.40 g (97% purity, 59% yield) of the title compound were obtained.
(1100) LC-MS (Method 7): R.sub.t=1.30 min; MS (ESIpos): m/z=170 [M+H].sup.+
(1101) Intermediate 139
1-Aminobutan-2-One Hydrogen Chloride
(1102) ##STR00174##
(1103) Ethyl 5-ethyl-1,3-oxazole-4-carboxylate (1.40 g, 8.28 mmol) was taken up in 28 ml of 6 N hydrochloric acid and stirred at 100 C. After 4 h the solvent was removed on a rotary evaporator and the residue was dried in vacuo. 0.99 g (97% yield) of the title compound were obtained.
(1104) Intermediate 140
Tert-Butyl (2-Oxobutyl)Carbamate
(1105) ##STR00175##
(1106) 1-aminobutan-2-one-hydrogen chloride (990 mg, 8.01 mmol) dissolved in 30 ml of dichloromethane was treated with di-tert-butyl dicarbonate (2.0 ml, 8.8 mmol) and triethylamine (3.3 ml, 24 mmol). The mixture was stirred at room temperature over night. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 1.2 g (80% yield) of the title compound were obtained.
(1107) Intermediate 141
Rac-Tert-Butyl [(4-Ethyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]Carbamate
(1108) ##STR00176##
(1109) Ammonium carbonate (6.16 g, 64.1 mmol) and ammonium chloride (1.37 g, 25.6 mmol) were dissolved in 10 ml of water. Tert-butyl (2-oxobutyl)carbamate (1.20 g, 6.41 mmol), dissolved in 10 ml of ethanol was added and the mixture was stirred for 15 min at room temperature. Then potassium cyanide (1.88 g, 28.8 mmol) was added, the vial was sealed and the mixture was stirred at 80 C. over night. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and concentrated on a rotary evaporator. 1.17 g (100% purity, 71% yield) of the title compound were obtained.
(1110) LC-MS (Method 7): R.sub.t=0.96 min; MS (ESIneg): m/z=256 [MH].sup.
(1111) Intermediate 142
Rac-5-(Aminomethyl)-5-Ethylimidazolidine-2,4-Dione Hydrochloride
(1112) ##STR00177##
(1113) rac-tert-butyl [(4-ethyl-2,5-dioxoimidazolidin-4-yl)methyl]carbamate (1.17 g, 4.55 mmol) was dissolved in 26 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (5.7 ml, 4.0 M, 23 mmol) was added and the mixture was stirred for 2 h. The solvent was removed on a rotary evaporator and the residue was taken up in dichloromethane. The solvent was removed and the residue was dried in vacuo. 1.00 g (95% purity, 108% yield) of the title compound were obtained.
(1114) LC-MS (Method 9): R.sub.t=0.25 min; MS (ESIpos): m/z=158 [M+HHCl].sup.+
(1115) Intermediate 143
2-[4-(Trifluoromethyl)Phenyl]Pyridine-3-Carboxylic Acid
(1116) ##STR00178##
(1117) [4-(trifluoromethyl)phenyl]boronic acid (250 mg, 1.32 mmol) and 2-bromopyridine-3-carboxylic acid (332 mg, 1.65 mmol) dissolved in 7.5 ml 1,2-dimethoxethane were treated with sodium carbonate in water (3.3 ml, 2.0 M, 6.6 mmol). The mixture was degassed with argon. Then tetrakis(triphenylphosphine)palladium(0) (76.1 mg, 65.8 mol) was added and the mixture was stirred at 80 C. over night. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 20.0 mg (70% purity, 4% yield) of the title compound were obtained.
(1118) LC-MS (Method 7): R.sub.t=1.34 min; MS (ESIpos): m/z=268 [M+H].sup.+
(1119) Intermediate 144
3-[4-(Trifluoromethyl)Phenyl]Pyridine-4-Carboxylic Acid
(1120) ##STR00179##
(1121) [4-(trifluoromethyl)phenyl]boronic acid (250 mg, 1.32 mmol) and 3-bromopyridine-4-carboxylic acid (332 mg, 1.65 mmol) dissolved in 7.5 ml 1,2-dimethoxethane were treated with sodium carbonate in water (3.3 ml, 2.0 M, 6.6 mmol). The mixture was degassed with argon. Then tetrakis(triphenylphosphine)palladium(0) (76.1 mg, 65.8 mol) was added and the mixture was stirred at 80 C. over night. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 5% B; 3 min 5% B; 20 min 50% B; 23 min 100% B; 26 min 5% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 47.0 mg (100% purity, 13% yield) of the title compound were obtained.
(1122) LC-MS (Method 7): R.sub.t=1.00 min; MS (ESIpos): m/z=268 [M+H].sup.+
(1123) Intermediate 145
2-[5-(Trifluoromethyl)Pyridin-2-Yl]Benzoic Acid
(1124) ##STR00180##
(1125) 2-boronobenzoic acid (250 mg, 1.51 mmol) and 2-bromo-5-(trifluoromethyl)pyridine (426 mg, 1.88 mmol) dissolved in 7.5 ml 1,2-dimethoxethane were treated with sodium carbonate in water (3.8 ml, 2.0 M, 7.5 mmol). The mixture was degassed with argon. Then tetrakis(triphenylphosphine)palladium(0) (87.0 mg, 75.3 mol) was added and the mixture was stirred at 80 C. over night. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 27.0 mg (75% purity, 5% yield) of the title compound were obtained.
(1126) LC-MS (Method 7): R.sub.t=1.52 min; MS (ESIpos): m/z=268 [M+H].sup.+
(1127) Intermediate 146
4-Chloro-5-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1128) ##STR00181##
(1129) 2-borono-4-(trifluoromethyl)benzoic acid (250 mg, 1.07 mmol) and 1-bromo-4-chlorobenzene (256 mg, 1.34 mmol) dissolved in 6 ml 1,2-dimethoxethane were treated with sodium carbonate in water (2.7 ml, 2.0 M, 5.3 mmol). The mixture was degassed with argon. Then tetrakis(triphenylphosphine)palladium(0) (61.7 mg, 53.4 mol) was added and the mixture was stirred at 80 C. over night. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 129 mg (100% purity, 40% yield) of the title compound were obtained.
(1130) LC-MS (Method 7): R.sub.t=2.03 min; MS (ESIneg): m/z=299 [MH].sup.
(1131) Intermediate 147
2-(4-Chlorophenyl)Pyridine-3-Carboxylic Acid
(1132) ##STR00182##
(1133) (4-chlorophenyl)boronic acid (250 mg, 1.60 mmol) and 2-bromopyridine-3-carboxylic acid (404 mg, 2.00 mmol) dissolved in 9.1 ml 1,2-dimethoxethane were treated with sodium carbonate in water (4.0 ml, 2.0 M, 8.0 mmol). The mixture was degassed with argon. Then tetrakis(triphenylphosphine)palladium(0) (61.7 mg, 53.4 mol) was added and the mixture was stirred at 80 C. over night. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 500 mg (70% purity, 94% yield) of the title compound were obtained.
(1134) LC-MS (Method 7): R.sub.t=1.03 min; MS (ESIpos): m/z=234 [M+H].sup.+
(1135) Intermediate 148
Ethyl 5-[1-(2,2,2-Trifluoroethyl)-1H-Imidazol-5-Yl]-1,3-Oxazole-4-Carboxylate
(1136) ##STR00183##
(1137) 1-(2,2,2-trifluoroethyl)-1H-imidazole-5-carboxylic acid (1.00 g, 5.15 mmol) and 1,1-carbonyldiimidazole (1.00 g, 6.18 mmol) in 11 ml of THF was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (620 l, 5.7 mmol) in 11 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (5.2 ml, 1.0 M, 5.2 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 16% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 724 mg (100% purity, 49% yield) of the title compound were obtained.
(1138) LC-MS (Method 7): R.sub.t=1.10 min; MS (ESIpos): m/z=290 [M+H].sup.+
(1139) Intermediate 149
2-Amino-1-[1-(2,2,2-Trifluoroethyl)-1H-Imidazol-5-Yl]Ethan-1-One Hydrogen Chloride
(1140) ##STR00184##
(1141) Ethyl 5-[1-(2,2,2-trifluoroethyl)-1H-imidazol-5-yl]-1,3-oxazole-4-carboxylate (724 mg, 2.50 mmol) was treated with 12 ml of 6 N hydrochloric acid and stirred for 2 h at 100 C. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 670 mg (100% purity, 110% yield) of the title compound were obtained.
(1142) LC-MS (Method 9): R.sub.t=0.82 min; MS (ESIpos): m/z=208 [M+HHCl].sup.+
(1143) Intermediate 150
N-{2-Oxo-2-[1-(2,2,2-Trifluoroethyl)-1H-Imidazol-5-Yl]Ethyl}-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(1144) ##STR00185##
(1145) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (109 mg, 410 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (210 l, 1.2 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (102 mg, 534 mol), 1H-benzotriazol-1-ol hydrate (81.7 mg, 534 mol) and 2-amino-1-[1-(2,2,2-trifluoroethyl)-1H-imidazol-5-yl]ethan-1-one hydrogen chloride (100 mg, 410 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). After lyophilization, 249 mg (100% purity, 133% yield) of the title compound were obtained.
(1146) LC-MS (Method 8): R.sub.t=0.99 min; MS (ESIpos): m/z=456 [M+H].sup.+
(1147) Intermediate 151
5-Chloro-6-Fluoro-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1148) ##STR00186##
(1149) [4-(trifluoromethyl)phenyl]boronic acid (250 mg, 1.32 mmol) and 2-bromo-4-chloro-3-fluorobenzoic acid (417 mg, 1.65 mmol) dissolved in 7.5 ml 1,2-dimethoxethane were treated with sodium carbonate in water (3.3 ml, 2.0 M, 6.6 mmol). The mixture was degassed with argon. Then tetrakis(triphenylphosphine)palladium(0) (76.1 mg, 65.8 mol) was added and the mixture was stirred at 80 C. over night. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile: gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 598 mg (68% purity, 97% yield) of the title compound were obtained.
(1150) LC-MS (Method 7): R.sub.t=2.06 min; MS (ESIneg): m/z=317 [MH].sup.
(1151) Intermediate 152
Methyl 5-(Trifluoromethoxy)-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylate
(1152) ##STR00187##
(1153) [2-(methoxycarbonyl)-5-(trifluoromethoxy)phenyl]boronic acid (250 mg, 947 mol) and 1-bromo-4-(trifluoromethyl)benzene (170 l, 1.2 mmol) dissolved in 5 ml 1,2-dimethoxethane were treated with sodium carbonate in water (2.4 ml, 2.0 M, 4.7 mmol). The mixture was degassed with argon. Then tetrakis(triphenylphosphine)palladium(0) (54.7 mg, 47.4 mol) was added and the mixture was stirred at 80 C. over night. Water was added at room temperature and the reaction mixture was extracted with ethyl acetate. The combined organic layers were washed with brine, dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 273 mg of a mixture which contains the title compound and the corresponding acid were obtained. The mixture was used as such in the following reaction.
(1154) Intermediate 153
5-(Trifluoromethoxy)-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1155) ##STR00188##
(1156) A mixture of methyl 5-(trifluoromethoxy)-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylate and 5-(trifluoromethoxy)-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (273 mg) was dissolved in 5 ml THF, treated with lithium hydroxide solution (750 l, 1.0 M, 750 mol), and the mixture was stirred at room temperature overnight. The solvent was removed on a rotary evaporator and the residue was acidified with 2N aqueous hydrochloric acid. The precipitate was filtered off, washed with water and dried in vacuo. 159 mg (82% purity) of the title compound were obtained.
(1157) LC-MS (Method 7): R.sub.t=2.15 min, MS (ESIneg): m/z=349 [MH].sup.
(1158) Intermediate 154
Rac-Tert-Butyl [(4-Methyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]Carbamate
(1159) ##STR00189##
(1160) The reaction was performed in 2 Microwave Vials. To a solution of 1.85 g (34.6 mmol) of ammonium chloride and 12.5 g (130 mmol) of ammonium carbonate in 7.5 mL of water was added a solution of 1.50 g (8.66 mmol) of tert-butyl (2-oxopropyl)carbamate in 7.5 ml ethanol. The reaction mixture was stirred 15 minutes at room temperature and then 2.54 g (39.0 mmol) of potassium cyanide were added into the mixture and the vials were sealed. The mixture was stirred at 65 C. for 24 hours. After that time, the solvent was partially removed and the mixture was solved in water and extracted with ethyl acetate. The resulting organic phase was washed with Brine, filtered over an hydrophobic filter and evaporated under vacuo to give 1.69 g (79%) of the product which was used as such in the next step.
(1161) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.42), 0.008 (0.40), 1.186 (4.35), 1.371 (16.00), 3.129 (0.51), 3.145 (0.48), 7.626 (0.69).
(1162) LC-MS (Method 7): R.sub.t=0.85 min; MS (ESIneg): m/z=242 [MH].sup.
(1163) Intermediate 155
Rac-5-(Aminomethyl)-5-Methylimidazolidine-2,4-Dione-Hydrogen Chloride
(1164) ##STR00190##
(1165) 1.70 g (6.95 mmol) of rac-tert-butyl [(4-methyl-2,5-dioxoimidazolidin-4-yl)methyl]carbamate was dissolved in 25 mL of dioxane and 26.05 mL (104.21 mmol) of 4M hydrochloric acid in dioxane were added and the resulting suspension was stirred at room temperature for 16 hours. After that time, the solvent was evaporated and dried under vacuo to give 1.18 g (100%) of the product. The compound was used as such in the next step.
(1166) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.343 (16.00), 2.908 (0.74), 2.942 (1.07), 3.074 (1.08), 3.107 (0.75), 8.012 (1.56), 8.215 (1.60), 10.948 (1.58).
(1167) LC-MS (Method 9): R.sub.t=0.25 min; MS (ESIpos): m/z=144 [M+HHCl].sup.+
(1168) Intermediate 156
Ethyl 5-(4-Methyl-1,2-Thiazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(1169) ##STR00191##
(1170) A solution of 4-methyl-1,2-thiazole-5-carboxylic acid (1.00 g, 6.98 mmol) and 1,1-carbonyldiimidazole (1.36 g, 8.38 mmol) in 11 ml of THF was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (840 l, 7.7 mmol) in 11 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (7.0 ml, 1.0 M, 7.0 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted with ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 975 mg (100% purity, 59% yield) of the title compound were obtained.
(1171) LC-MS (Method 7): R.sub.t=1.44 min; MS (ESIpos): m/z=239 [M+H].sup.+
(1172) Intermediate 157
2-Amino-1-(4-Methyl-1,2-Thiazol-5-Yl)Ethan-1-One Hydrogen Chloride
(1173) ##STR00192##
(1174) Ethyl 5-(4-methyl-1,2-thiazol-5-yl)-1,3-oxazole-4-carboxylate (975 mg, 4.09 mmol) was taken up in 20 ml of 6 N hydrochloric acid and stirred at 100 C. for 1 h. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 897 mg (100% purity, 114% yield) of the title compound were obtained.
(1175) LC-MS (Method 9): R.sub.t=0.80 min; MS (ESIpos): m/z=157 [MHCl+H].sup.+
(1176) Intermediate 158
N-[2-(4-Methyl-1,2-Thiazol-5-Yl)-2-Oxoethyl]-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(1177) ##STR00193##
(1178) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (207 mg, 779 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (380 l, 2.2 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (194 mg, 1.01 mmol), 1H-benzotriazol-1-ol hydrate (155 mg, 1.01 mmol) and 2-amino-1-(4-methyl-1,2-thiazol-5-yl)ethan-1-one-hydrogenchloride (150 mg, 779 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). After lyophilization, 18.0 mg (96% purity, 5% yield) of the title compound were obtained.
(1179) LC-MS (Method 7): R.sub.t=2.01 min; MS (ESIpos): m/z=405 [M+H].sup.+
(1180) Intermediate 159
Ethyl 5-[5-Methyl-1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-4-Yl]-1,3-Oxazole-4-Carboxylate
(1181) ##STR00194##
(1182) A solution of 5-methyl-1-(2,2,2-trifluoroethyl)-1H-pyrazole-4-carboxylic acid (600 mg, 2.88 mmol) and 1,1-carbonyldiimidazole (561 mg, 3.46 mmol) in 11 ml of THE was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (350 l, 3.2 mmol) in 11 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (2.9 ml, 1.0 M, 2.9 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted with ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 600 mg (100% purity, 69% yield) of the title compound were obtained.
(1183) LC-MS (Method 7): R.sub.t=1.44 min; MS (ESIpos): m/z=304 [M+H].sup.+
(1184) Intermediate 160
2-Amino-1-[5-Methyl-1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-4-Yl]Ethan-1-One Hydrochloride
(1185) ##STR00195##
(1186) Ethyl 5-[5-methyl-1-(2,2,2-trifluoroethyl)-1H-pyrazol-4-yl]-1,3-oxazole-4-carboxylate (600 mg, 1.98 mmol) was taken up in 10 ml of 6 N hydrochloric acid and stirred at 100 C. for 1 h. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 507 mg (88% purity, 87% yield) of the title compound were obtained.
(1187) LC-MS (Method 9): R.sub.t=0.93 min, MS (ESIpos): m/z=222 [MHCl+H].sup.+
(1188) Intermediate 161
Tert-Butyl {2-[5-Methyl-1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-4-Yl]-2-Oxoethyl}Carbamate
(1189) ##STR00196##
(1190) 2-amino-1-[5-methyl-1-(2,2,2-trifluoroethyl)-1H-pyrazol-4-yl]ethan-1-one hydrogenchloride (350 mg, 1.36 mmol) dissolved in 5 ml of dichloromethane was treated with di-tert-butyl dicarbonate (340 l, 1.5 mmol) and triethylamine (570 l, 4.1 mmol). The mixture was stirred at room temperature over night. The solvent was removed on a rotary evaporator. The residue was taken up with ethyl acetate and washed with water and saturated aqueous sodium chloride solution. The organic layer was dried over sodium sulfate, filtered and evaporated on a rotary evaporator. 367 mg (100% purity, 84% yield) of the title compound were obtained.
(1191) LC-MS (Method 7): R.sub.t=1.62 min; MS (ESIpos): m/z=322 [M+H].sup.+
(1192) Intermediate 162
Rac-Tert-Butyl({4-[5-Methyl-1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-4-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)Carbamate
(1193) ##STR00197##
(1194) tert-butyl {2-[5-methyl-1-(2,2,2-trifluoroethyl)-1H-pyrazol-4-yl]-2-oxoethyl}carbamate (367 mg, 1.14 mmol) was dissolved in 10 ml of methanol. Potassium cyanide (372 mg, 5.71 mmol) and ammonium carbonate (549 mg, 5.71 mmol) were added. The vial was sealed and the mixture was stirred at 60 C. for 2 d. Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 25 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 70.0 mg (100% purity, 16% yield) of the title compound were obtained.
(1195) LC-MS (Method 7): R.sub.t=1.20 min; MS (ESIpos): m/z=392 [M+H].sup.+
(1196) Intermediate 163
Rac-5-(Aminomethyl)-5-[5-Methyl-1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-4-Yl]Imidazolidine-2,4-Dione Hydrochloride
(1197) ##STR00198##
(1198) rac-tert-butyl({4-[5-methyl-1-(2,2,2-trifluoroethyl)-1H-pyrazol-4-yl]-2,5-dioxoimidazolidin-4-yl}methyl)carbamate (70.0 mg, 179 mol) was dissolved in 2.5 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (220 l, 4.0 M, 890 mol) was added and the mixture was stirred over night. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 52.0 mg (94% purity, 83% yield) of the title compound were obtained.
(1199) LC-MS (Method 9): R.sub.t=0.26 min; MS (ESIpos): m/z=292 [MHCl+H].sup.+
(1200) Intermediate 164
4-Methyl-5-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylicacid
(1201) ##STR00199##
(1202) To a suspension of [2-(methoxycarbonyl)-5-(trifluoromethyl)phenyl]boronic acid (200 mg, 807 mol) and 1-bromo-4-methylbenzene (172 mg, 1.01 mmol) in 1,2-dimethoxyethane (3.6 ml) was added under argon a 2 M solution sodium carbonate in water (2.0 ml, 2.0 M, 4.0 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (46.8 mg, 40.3 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 52 mg of the title compound were obtained.
(1203) LC-MS (Method 7): R.sub.t=2.03 min; MS (ESIpos): m/z=279 [MH].sup.
(1204) Intermediate 165
Methyl 4,6-Dimethyl[1,1-Biphenyl]-2-Carboxylate
(1205) ##STR00200##
(1206) To a suspension of (4-methylphenyl)boronic acid (100 mg, 736 mol) and methyl 2-bromo-3-methylbenzoate (150 l, 920 mol) in 1,2-dimethoxyethane (3.0 ml) was added under argon a2 M solution sodium carbonate in water (1.8 ml, 2.0 M, 3.7 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (42.7 mg, 36.8 mol). The mixture was stirred overnight at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine and then dried, filtered and evaporated Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 129 mg (100% purity, 73% yield) of the title compound were obtained.
(1207) LC-MS (Method 7): R.sub.t=2.29 min; MS (ESIpos): m/z=241 [M+H].sup.+
(1208) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.056 (16.00), 2.349 (14.64), 3.327 (5.89), 6.998 (4.23), 7.019 (5.30), 7.197 (4.12), 7.216 (3.44), 7.336 (1.37), 7.355 (3.39), 7.374 (2.30), 7.459 (2.09), 7.477 (1.50), 7.523 (1.92), 7.542 (1.60).
(1209) Intermediate 166
4,6-Dimethyl[1,1-Biphenyl]-2-Carboxylic Acid
(1210) ##STR00201##
(1211) To a solution of methyl 4,6-dimethyl[1,1-biphenyl]-2-carboxylate (126 mg, 525 mol) in THF (2 ml) and methanol (400 l) an aqueous lithium hydroxide solution was added (1.3 ml, 2.0 M, 2.6 mmol) and the mixture was stirred at room temperature over night. The mixture was then heated to 60 C. and stirred over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The THF was removed on a rotary evaporator and the resulting precipitate was filtered off, washed with water and dried in vacuo. 127 mg (100% purity, 106% yield) of the title compound were obtained.
(1212) LC-MS (Method 7): R.sub.t=1.86 min, MS (ESIpos): m/z=227 [M+H].sup.+
(1213) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.236 (0.47), 2.034 (16.00), 2.341 (15.60), 7.021 (4.49), 7.040 (5.64), 7.183 (5.37), 7.202 (4.58), 7.302 (1.30), 7.321 (3.03), 7.340 (2.19), 7.407 (2.98), 7.425 (2.13), 7.501 (2.60), 7.520 (2.22), 12.379 (3.58).
(1214) Intermediate 167
Methyl 4-(1,1-Difluoropropyl)[1,1-Biphenyl]-2-Carboxylate
(1215) ##STR00202##
(1216) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 1-bromo-4-(1,1-difluoropropyl)benzene (224 mg, 954 mol) in 1,2-dimethoxyethane (4.0 ml) was added under argon a 2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate. The combined organic layers were washed with brine dried, filtered and evaporated Purification was done by flash chromatography. Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 138 mg (100% purity, 62% yield) of the title compound were obtained.
(1217) LC-MS (Method 8): R.sub.t=1.18 min; MS (ESIpos): m/z=291 [M+H].sup.+
(1218) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.928 (3.20), 0.941 (7.12), 0.953 (3.28), 2.221 (0.58), 2.233 (0.67), 2.249 (1.23), 2.261 (1.23), 2.276 (0.60), 2.289 (0.51), 3.323 (16.00), 7.392 (2.52), 7.406 (2.92), 7.456 (1.32), 7.457 (1.36), 7.469 (1.54), 7.470 (1.52), 7.516 (0.70), 7.518 (0.69), 7.529 (1.56), 7.531 (1.46), 7.541 (0.99), 7.543 (0.93), 7.552 (3.06), 7.565 (2.55), 7.639 (0.89), 7.641 (0.92), 7.651 (1.45), 7.654 (1.46), 7.664 (0.65), 7.666 (0.64), 7.786 (1.46), 7.788 (1.40), 7.799 (1.35), 7.801 (1.24).
(1219) Intermediate 168
4-(1,1-Difluoropropyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1220) ##STR00203##
(1221) To a solution of methyl 4-(1,1-difluoropropyl)[1,1-biphenyl]-2-carboxylate (135 mg, 463 mol) in THF (2.5 ml) and methanol (500 l) an aqueous lithium hydroxide solution was added (1.2 ml, 2.0 M, 2.3 mmol) and the mixture was stirred over night at 60 C. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and the mixture was concentrated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 116 mg (100% purity, 91% yield) of the title compound were obtained.
(1222) LC-MS (Method 7): R.sub.t=2.00 min; MS (ESIneg): m/z=275 [MH].sup.
(1223) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.86), 0.008 (0.97), 0.929 (6.82), 0.948 (16.00), 0.967 (7.26), 2.182 (0.45), 2.200 (1.42), 2.219 (1.56), 2.242 (2.94), 2.260 (2.90), 2.284 (1.45), 2.303 (1.27), 2.321 (0.43), 7.396 (2.70), 7.398 (2.94), 7.415 (3.77), 7.418 (4.31), 7.423 (5.12), 7.444 (6.87), 7.471 (1.51), 7.474 (1.55), 7.490 (3.51), 7.493 (3.31), 7.509 (2.45), 7.512 (2.23), 7.537 (7.08), 7.558 (5.00), 7.579 (2.30), 7.582 (2.47), 7.598 (3.31), 7.601 (3.44), 7.616 (1.42), 7.620 (1.37), 7.759 (3.26), 7.762 (3.28), 7.778 (2.94), 7.781 (2.77), 12.794 (2.70).
(1224) Intermediate 169
Tert-Butyl 4-Cyclopropyl-5-Methoxy[1,1-Biphenyl]-2-Carboxylate
(1225) ##STR00204##
(1226) To a suspension of [2-(tert-butoxycarbonyl)-5-methoxyphenyl]boronic acid (125 mg, 496 mol) and 1-bromo-4-cyclopropylbenzene (122 mg, 620 mol) in 1,2-dimethoxyethane (2.2 ml) was added under argon a 2 M solution sodium carbonate in water (1.2 ml, 2.0 M, 2.5 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (28.8 mg, 24.8 mol). The mixture was stirred over night at 80 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 72.0 mg (99% purity, 44% yield) of the title compound were obtained.
(1227) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.670 (0.78), 0.675 (0.71), 0.682 (0.77), 0.687 (0.75), 0.960 (0.68), 0.965 (0.71), 0.980 (0.71), 0.986 (0.69), 1.175 (0.44), 1.188 (16.00), 1.988 (0.49), 3.822 (5.74), 6.804 (0.92), 6.811 (0.99), 6.961 (0.56), 6.968 (0.50), 6.983 (0.58), 6.989 (0.55), 7.098 (0.44), 7.120 (2.13), 7.132 (2.23), 7.153 (0.45), 7.655 (1.05), 7.677 (0.99).
(1228) Intermediate 170
4-Cyclopropyl-5-Methoxy[1,1-Biphenyl]-2-Carboxylic Acid
(1229) ##STR00205##
(1230) To a solution of tert-butyl 4-cyclopropyl-5-methoxy[1,1-biphenyl]-2-carboxylate (70.0 mg, 216 mol) in trifluoroethanol (2.5 ml) was added zinc chloride (176 mg, 1.29 mmol) and the reaction was stirred at 50 C. for 1 hour. EDTA (378 mg, 1.29 mmol) was added and the mixture was stirred for a few minutes. Water+0.1% TFA (1 ml) was added. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 41.3 mg (100% purity, 71% yield) of the title compound were obtained.
(1231) LC-MS (Method 7): R.sub.t=1.87 min; MS (ESIpos): m/z=269 [M+H].sup.+
(1232) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.680 (0.70), 0.687 (2.41), 0.691 (2.25), 0.696 (2.32), 0.699 (2.38), 0.706 (0.79), 0.954 (0.76), 0.961 (2.10), 0.965 (2.12), 0.968 (1.05), 0.972 (1.00), 0.975 (2.18), 0.978 (2.11), 0.986 (0.72), 1.925 (0.58), 1.931 (0.64), 1.939 (1.12), 1.947 (0.62), 1.953 (0.56), 3.825 (16.00), 6.803 (2.74), 6.807 (2.90), 6.961 (1.54), 6.965 (1.48), 6.975 (1.59), 6.980 (1.55), 7.071 (3.30), 7.085 (4.30), 7.176 (4.48), 7.189 (3.41), 7.731 (2.97), 7.745 (2.82).
(1233) Intermediate 171
Methyl 4-Cyclopropyl-5-Fluoro[1,1-Biphenyl]-2-Carboxylate
(1234) ##STR00206##
(1235) To a suspension of methyl 4-fluoro-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 714 mol) and 1-bromo-4-cyclopropylbenzene (176 mg, 893 mol) in 1,2-dimethoxyethane (3.1 ml) was added under argon a 2 M solution sodium carbonate in water (1.8 ml, 2.0 M, 3.6 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (41.4 mg, 35.7 mol). The mixture was stirred over night at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated. Purification was done by flash chromatography (n-heptane 100-4 n-heptane:ethyl acetate (70:30)). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 55.0 mg (97% purity, 28% yield) of the title compound were obtained.
(1236) LC-MS (Method 8): R.sub.t=1.23 min; MS (ESIpos): m/z=271 [M+H].sup.+
(1237) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.698 (0.76), 0.706 (2.44), 0.709 (2.21), 0.714 (2.24), 0.717 (2.29), 0.725 (0.73), 0.970 (0.81), 0.977 (2.06), 0.980 (2.05), 0.984 (1.01), 0.988 (1.01), 0.991 (2.08), 0.994 (1.98), 1.002 (0.67), 1.942 (0.60), 1.948 (0.64), 1.957 (1.10), 1.965 (0.60), 1.970 (0.53), 3.594 (16.00), 7.117 (2.90), 7.131 (4.48), 7.178 (4.68), 7.192 (2.86), 7.244 (1.13), 7.248 (1.39), 7.260 (1.13), 7.265 (1.32), 7.286 (0.70), 7.291 (0.63), 7.300 (1.33), 7.305 (1.22), 7.314 (0.71), 7.319 (0.65), 7.779 (1.18), 7.789 (1.23), 7.794 (1.19), 7.803 (1.12).
(1238) Intermediate 172
4-Cyclopropyl-5-Fluoro[1,1-Biphenyl]-2-Carboxylic Acid
(1239) ##STR00207##
(1240) To a solution of methyl 4-cyclopropyl-5-fluoro[1,1-biphenyl]-2-carboxylate (50.0 mg, 185 mol) in THF (640 l) and methanol (130 l) an aqueous lithium hydroxide solution was added (460 l, 2.0 M, 920 mol) and the mixture was stirred at 60 C. over night. The THF was removed on a rotary evaporator and the residue was acidified with excess 2N aqueous hydrochloric acid. The mixture was extracted with ethyl acetate and the organic layers were dried, filtered and evaporated to give 48.0 mg (92% purity, 93% yield) of the title compound without further purification.
(1241) LC-MS (Method 8): R.sub.t=1.04 min; MS (ESIpos): m/z=257 [M+H].sup.+
(1242) Intermediate 173
Methyl 4-Cyclopropyl[1,1-Biphenyl]-2-Carboxylate
(1243) ##STR00208##
(1244) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 1-bromo-4-cyclopropylbenzene (188 mg, 954 mol) in 1,2-dimethoxyethane (3.4 ml) was added under argon a2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 80 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 120 mg (95% purity, 59% yield) of the title compound were obtained.
(1245) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.006 (1.18), 0.006 (0.97), 0.691 (2.22), 0.700 (7.36), 0.704 (6.88), 0.710 (7.06), 0.714 (7.11), 0.723 (2.48), 0.833 (0.52), 0.837 (0.48), 0.842 (0.50), 0.847 (0.53), 0.960 (2.51), 0.968 (6.28), 0.973 (6.54), 0.977 (3.29), 0.982 (3.17), 0.985 (6.62), 0.989 (6.33), 0.998 (2.23), 1.125 (0.44), 1.129 (0.46), 1.141 (0.65), 1.146 (0.46), 1.922 (0.90), 1.932 (1.81), 1.939 (1.98), 1.949 (3.42), 1.959 (1.89), 1.966 (1.70), 1.976 (0.80), 2.086 (0.41), 3.741 (1.44), 3.776 (1.60), 7.107 (7.45), 7.124 (15.33), 7.155 (16.00), 7.172 (7.54), 7.401 (4.76), 7.417 (5.54), 7.439 (2.46), 7.441 (2.46), 7.454 (5.62), 7.456 (5.40), 7.469 (3.78), 7.472 (3.66), 7.497 (0.74), 7.514 (0.42), 7.522 (0.65), 7.539 (0.55), 7.579 (3.13), 7.582 (3.42), 7.595 (5.03), 7.597 (5.31), 7.610 (2.32), 7.612 (2.42), 7.686 (4.89), 7.689 (4.93), 7.702 (4.39), 7.704 (4.27).
(1246) Intermediate 174
4-Cyclopropyl[1,1-Biphenyl]-2-Carboxylic Acid
(1247) ##STR00209##
(1248) To a solution of methyl 4-cyclopropyl[1,1-biphenyl]-2-carboxylate (120 mg, 476 mol) in THE (1.6 ml) and methanol (330 l) an aqueous lithium hydroxide solution was added (1.2 ml, 2.0 M, 2.4 mmol) and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The mixture was extracted with ethyl acetate and the combined organic layers were dried, filtered and evaporated. Purification was done by flash chromatography (n-heptane.fwdarw.n-heptane:ethyl acetate (50:50)). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 73.0 mg (99% purity, 64% yield) of the title compound were obtained.
(1249) LC-MS (Method 7): R.sub.t=1.87 min, MS (ESIneg): m/z=237 [MH].sup.
(1250) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.684 (2.57), 0.692 (8.57), 0.696 (7.92), 0.702 (8.17), 0.706 (8.30), 0.715 (2.78), 0.955 (2.86), 0.963 (7.34), 0.967 (7.41), 0.971 (3.71), 0.976 (3.66), 0.980 (7.67), 0.984 (7.21), 0.993 (2.47), 1.174 (0.70), 1.234 (0.46), 1.916 (1.08), 1.926 (2.13), 1.933 (2.31), 1.943 (3.96), 1.953 (2.18), 1.960 (1.96), 1.970 (0.93), 1.989 (1.32), 7.094 (11.30), 7.110 (15.30), 7.197 (16.00), 7.214 (11.49), 7.346 (5.66), 7.362 (6.47), 7.405 (2.63), 7.407 (2.77), 7.420 (5.97), 7.422 (5.91), 7.435 (3.74), 7.437 (3.60), 7.528 (3.50), 7.531 (3.81), 7.543 (5.52), 7.546 (5.74), 7.558 (2.42), 7.561 (2.43), 7.671 (5.78), 7.673 (5.87), 7.686 (5.25), 7.688 (5.08), 12.724 (2.04).
(1251) Intermediate 175
Methyl 4-Ethyl[1,1-Biphenyl]-2-Carboxylate
(1252) ##STR00210##
(1253) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 1-bromo-4-ethylbenzene (177 mg, 954 mol) in 1,2-dimethoxyethane (3.4 ml) was added under argon a2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 113 mg (98% purity, 60% yield) of the title compound were obtained.
(1254) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.007 (0.89), 0.006 (0.61), 1.188 (0.41), 1.201 (7.50), 1.216 (16.00), 1.231 (7.60), 1.236 (1.09), 1.252 (0.40), 2.625 (1.83), 2.640 (5.34), 2.655 (5.15), 2.670 (1.68), 7.194 (4.99), 7.207 (2.71), 7.211 (8.78), 7.252 (7.56), 7.268 (4.17), 7.418 (2.78), 7.433 (3.23), 7.448 (1.44), 7.450 (1.39), 7.463 (3.19), 7.465 (2.89), 7.478 (2.02), 7.481 (1.81), 7.587 (1.86), 7.590 (1.99), 7.603 (2.93), 7.605 (3.00), 7.613 (0.51), 7.618 (1.41), 7.621 (1.44), 7.638 (0.54), 7.696 (2.86), 7.698 (2.86), 7.711 (2.55), 7.713 (2.45).
(1255) Intermediate 176
4-Ethyl[1,1-Biphenyl]-2-Carboxylic Acid
(1256) ##STR00211##
(1257) To a solution of methyl 4-ethyl[1,1-biphenyl]-2-carboxylate (110 mg, 458 mol) in THF (1.6 ml) and methanol (320 l) an aqueous lithium hydroxide solution (1.1 ml, 2.0 M, 2.3 mmol) was added and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated. Purification was done by flash chromatography (n-heptane.fwdarw.n-heptane:ethyl acetate (50:50)). Product containing samples were united, the solvents were evaporated. 92.0 mg (99% purity, 88% yield) of the title compound were obtained.
(1258) LC-MS (Method 7): R.sub.t=1.87 min, MS (ESIneg): m/z=225 [MH].sup.
(1259) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 1.202 (2.92), 1.217 (6.22), 1.232 (3.03), 2.620 (0.90), 2.635 (2.68), 2.651 (2.58), 2.666 (0.81), 7.247 (16.00), 7.362 (1.05), 7.376 (1.25), 7.413 (0.56), 7.415 (0.52), 7.428 (1.25), 7.430 (1.10), 7.443 (0.79), 7.445 (0.67), 7.534 (0.74), 7.537 (0.75), 7.550 (1.15), 7.552 (1.12), 7.565 (0.50), 7.567 (0.47), 7.678 (1.17), 7.681 (1.10), 7.694 (1.06), 7.696 (0.94), 12.725 (0.76).
(1260) Intermediate 177
Tert-Butyl 5-Methoxy-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylate
(1261) ##STR00212##
(1262) To a suspension of [2-(tert-butoxycarbonyl)-5-methoxyphenyl]boronic acid (125 mg, 496 mol) and 1-bromo-4-(trifluoromethyl)benzene (139 mg, 620 mol) in 1,2-dimethoxyethane (2.2 ml) was added under argon a 2 M solution sodium carbonate in water (1.2 ml, 2.0 M, 2.5 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (28.8 mg, 24.8 mol). The mixture was stirred overnight at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated Purification was done by flash chromatography (n-heptane.fwdarw.n-heptane:ethyl acetate (70:30)). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 133 mg (99% purity, 75% yield) of the title compound were obtained.
(1263) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.164 (16.00), 3.846 (5.62), 6.881 (0.93), 6.888 (0.98), 7.059 (0.55), 7.066 (0.51), 7.081 (0.58), 7.088 (0.55), 7.490 (0.81), 7.510 (0.93), 7.770 (0.98), 7.785 (1.35), 7.790 (0.89), 7.807 (1.00).
(1264) Intermediate 178
5-Methoxy-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1265) ##STR00213##
(1266) To a solution of tert-butyl 5-methoxy-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylate (130 mg, 369 mol) in trifluoroethanol (6.5 ml) was added zinc chloride (302 mg, 2.21 mmol) and the reaction was stirred at 50 C. for 2 hours. EDTA (647 mg, 2.21 mmol) was added and the mixture was stirred for a few minutes. The mixture was filtered and the residue was washed with Acetonitrile. The filtrate was concentrated and purification was done by flash chromatography (n-heptane.fwdarw.n-heptane:ethyl acetate (50:50)). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 104 mg (98% purity, 93% yield) of the title compound were obtained.
(1267) LC-MS (Method 7): R.sub.t=1.91 min, MS (ESIpos): m/z=297 [M+H].sup.+
(1268) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.175 (0.74), 1.235 (0.40), 1.988 (1.27), 2.524 (0.57), 3.313 (16.00), 3.824 (0.94), 3.867 (0.69), 6.871 (9.40), 6.878 (10.14), 7.052 (5.60), 7.058 (5.22), 7.074 (5.88), 7.080 (5.68), 7.512 (8.24), 7.532 (9.92), 7.731 (10.21), 7.751 (8.56), 7.859 (10.47), 7.869 (0.42), 7.881 (10.09), 12.477 (8.54).
(1269) Intermediate 179
Methyl 4-Cyclopropyl-5-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylate
(1270) ##STR00214##
(1271) To a suspension of [2-(methoxycarbonyl)-5-(trifluoromethyl)phenyl]boronic acid (200 mg, 807 mol) and 1-bromo-4-cyclopropylbenzene (199 mg, 1.01 mmol) in 1,2-dimethoxyethane (3.6 ml) was added under argon a 2 M solution sodium carbonate in water (2.0 ml, 2.0 M, 4.0 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (46.8 mg, 40.3 mol). The mixture was stirred overnight at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated Purification was done by flash chromatography (n-heptane.fwdarw.n-heptane:ethyl acetate (70:30)).
(1272) Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 93.0 mg (70% purity, 25% yield) of the title compound were obtained.
(1273) Intermediate 180
4-Cyclopropyl-5-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1274) ##STR00215##
(1275) To a solution of methyl 4-cyclopropyl-5-(trifluoromethyl)[1,1-biphenyl]-2-carboxylate (90.0 mg, 281 mol) in THF (970 l) and methanol (190 l) an aqueous lithium hydroxide solution (700 l, 2.0 M, 1.4 mmol) q was added and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated. Purification was done by flash chromatography (n-heptane.fwdarw.n-heptane:ethyl acetate (50:50)). Product containing samples were united, the solvents were evaporated. 48.0 mg (99% purity, 55% yield) of the title compound were obtained.
(1276) LC-MS (Method 11): R.sub.t=1.42 min, MS (ESIneg): m/z=305 [MH].sup.
(1277) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.702 (2.66), 0.709 (8.96), 0.712 (8.21), 0.718 (8.42), 0.721 (8.80), 0.728 (2.85), 0.977 (2.84), 0.984 (7.60), 0.987 (7.67), 0.991 (3.80), 0.995 (3.73), 0.998 (7.94), 1.002 (7.51), 1.009 (2.57), 1.164 (0.58), 1.176 (1.20), 1.188 (0.59), 1.943 (1.11), 1.952 (2.20), 1.958 (2.39), 1.966 (4.13), 1.974 (2.26), 1.980 (2.05), 1.990 (2.84), 2.522 (0.47), 4.025 (0.55), 4.036 (0.52), 7.140 (12.42), 7.154 (15.22), 7.279 (16.00), 7.293 (12.83), 7.670 (8.88), 7.789 (3.78), 7.803 (5.29), 7.804 (5.27), 7.869 (7.56), 7.882 (5.36), 13.233 (0.57).
(1278) Intermediate 181
Methyl 6-Methyl-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylate
(1279) ##STR00216##
(1280) To a suspension of [4-(trifluoromethyl)phenyl]boronic acid (100 mg, 527 mol) and methyl 2-bromo-3-methylbenzoate (110 l, 660 mol) in 1,2-dimethoxyethane (3.0 ml) was added under argon a 2 M solution sodium carbonate in water (1.3 ml, 2.0 M, 2.6 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (30.5 mg, 26.3 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 92.0 mg (100% purity, 59% yield) of the title compound were obtained.
(1281) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.035 (10.68), 3.311 (16.00), 7.365 (2.17), 7.385 (2.41), 7.427 (0.93), 7.446 (2.29), 7.465 (1.53), 7.544 (1.42), 7.562 (1.02), 7.682 (1.19), 7.700 (1.03), 7.757 (2.51), 7.777 (2.30).
(1282) Intermediate 182
6-Methyl-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1283) ##STR00217##
(1284) To a solution of methyl 6-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylate (90.0 mg, 306 mol) in THF (2.0 ml) and methanol (400 l) an aqueous lithium hydroxide solution (760 l, 2.0 M, 1.5 mmol) was added and the mixture was stirred at room temperature over night. Aqueous lithium hydroxide solution (760 l, 2.0 M, 1.5 mmol) was added and the mixture was then heated to 60 C. and stirred over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The THF was removed on a rotary evaporator and the resulting precipitate was filtered off, washed with water and dried in vacuo. 132 mg (97% purity, 150% yield) of the title compound were obtained.
(1285) LC-MS (Method 7): R.sub.t=1.98 min, MS (ESIpos): m/z=281 [M+H].sup.+
(1286) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.234 (0.99), 2.015 (16.00), 3.491 (0.48), 7.379 (5.58), 7.392 (6.54), 7.409 (3.71), 7.421 (2.36), 7.491 (3.22), 7.503 (2.65), 7.652 (2.98), 7.664 (2.79), 7.748 (5.68), 7.760 (5.62), 12.566 (2.37).
(1287) Intermediate 183
Methyl 4-Ethyl-5-Fluoro[1,1-Biphenyl]-2-Carboxylate
(1288) ##STR00218##
(1289) To a suspension of methyl 4-fluoro-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 714 mol) and 1-bromo-4-ethylbenzene (165 mg, 893 mol) in 1,2-dimethoxyethane (3.1 ml) was added under argon a 2 M solution sodium carbonate in water (1.8 ml, 2.0 M, 3.6 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (41.4 mg, 35.7 mol). The mixture was stirred over night at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated Purification was done by flash chromatography (n-heptane.fwdarw.n-heptane:ethyl acetate (70:30)). Product containing samples were united, the solvents were evaporated. 92.0 mg (80% purity, 45% yield) of the title compound were obtained.
(1290) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.196 (3.69), 1.206 (0.91), 1.215 (8.15), 1.225 (0.57), 1.234 (3.89), 2.624 (1.09), 2.643 (2.80), 2.662 (2.63), 2.681 (0.83), 3.592 (16.00), 7.213 (1.82), 7.217 (0.81), 7.228 (1.24), 7.233 (4.86), 7.260 (4.63), 7.280 (2.56), 7.287 (2.34), 7.293 (0.79), 7.308 (1.51), 7.315 (1.16), 7.329 (0.77), 7.336 (0.65), 7.782 (1.13), 7.797 (1.17), 7.804 (1.13), 7.819 (1.06).
(1291) Intermediate 184
4-Ethyl-5-Fluoro[1,1-Biphenyl]-2-Carboxylic Acid
(1292) ##STR00219##
(1293) To a solution of methyl 4-ethyl-5-fluoro[1,1-biphenyl]-2-carboxylate (90.0 mg, 348 mol) in THE (1.2 ml) and methanol (240 l) an aqueous lithium hydroxide solution (870 l, 2.0 M, 1.7 mmol) was added and the mixture was stirred at 60 C. for 3 hours. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The resulting precipitate was filtered off to give 74.0 mg (90% purity, 84% yield) of the title compound without further purification.
(1294) LC-MS (Method 8): R.sub.t=1.04 min; MS (ESIneg): m/z=243 [MH].sup.
(1295) Intermediate 185
4-(2,2-Difluorocyclopropyl)[1,1-Biphenyl]-2-Carboxylic Acid (Racemic Mixture)
(1296) ##STR00220##
(1297) To a suspension of [2-(methoxycarbonyl)phenyl]boronic acid (150 mg, 833 mol) and 1-bromo-4-(2,2-difluorocyclopropyl)benzene (243 mg, 1.04 mmol) in 1,2-dimethoxyethane (3.7 ml) was added under argon a 2 M solution sodium carbonate in water (2.1 ml, 2.0 M, 4.2 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (48.3 mg, 41.7 mol). The mixture was stirred overnight at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 45.0 mg (95% purity, 20% yield) of the title compound were obtained.
(1298) LC-MS (Method 7): R.sub.t=1.84 min; MS (ESIpos): m/z=275 [M+H].sup.+
(1299) Intermediate 186
Methyl 4-Cyclobutyl[1,1-Biphenyl]-2-Carboxylate
(1300) ##STR00221##
(1301) To a suspension of (4-cyclobutylphenyl)boronic acid (100 mg, 568 mol) and methyl 2-bromobenzoate (110 l, 710 mol) in 1,2-dimethoxyethane (3.0 ml) was added under argon a2 M solution sodium carbonate in water (1.4 ml, 2.0 M, 2.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (32.9 mg, 28.4 mol). The mixture was stirred overnight at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated Purification was done by flash chromatography (n-n-heptane/ethyl acetate gradient). Product containing samples were united, the solvents were evaporated. 97.2 mg (100% purity, 64% yield) of the title compound were obtained.
(1302) LC-MS (Method 7): R.sub.t=2.48 min; MS (ESIpos): m/z=267 [M+H].sup.+
(1303) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.822 (0.72), 1.839 (0.82), 1.966 (0.44), 1.982 (0.97), 1.998 (1.00), 2.012 (0.50), 2.015 (0.50), 2.088 (0.41), 2.103 (1.23), 2.107 (1.13), 2.119 (1.57), 2.123 (1.62), 2.135 (0.93), 2.138 (1.08), 2.288 (0.63), 2.292 (0.75), 2.302 (1.33), 2.306 (1.77), 2.310 (1.04), 2.316 (1.09), 2.320 (1.61), 2.324 (0.99), 2.334 (0.55), 3.328 (0.44), 3.333 (0.76), 3.542 (0.81), 3.557 (1.18), 3.571 (0.82), 3.586 (0.48), 3.601 (16.00), 7.210 (3.15), 7.223 (4.78), 7.269 (4.51), 7.283 (2.84), 7.413 (1.81), 7.425 (2.03), 7.451 (0.89), 7.463 (1.90), 7.476 (1.12), 7.589 (1.07), 7.590 (1.08), 7.602 (1.73), 7.603 (1.72), 7.614 (0.76), 7.701 (1.82), 7.714 (1.62).
(1304) Intermediate 187
4-Cyclobutyl[1,1-Biphenyl]-2-Carboxylic Acid
(1305) ##STR00222##
(1306) To a solution of methyl 4-cyclobutyl[1,1-biphenyl]-2-carboxylate (93.1 mg, 350 mol) in THE (2.0 ml) and methanol (400 l) an aqueous solution of lithium hydroxide (870 l, 2.0 M, 1.7 mmol) was added and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and the mixture was evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated. 76.9 mg (99% purity, 87% yield) of the title compound were obtained.
(1307) LC-MS (Method 8): R.sub.t=1.07 min; MS (ESIneg): m/z=251 [MH].sup.
(1308) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.816 (0.42), 1.842 (0.53), 1.976 (0.61), 2.000 (0.64), 2.025 (0.40), 2.095 (0.82), 2.101 (0.74), 2.119 (0.92), 2.124 (1.07), 2.147 (0.71), 2.274 (0.44), 2.280 (0.47), 2.294 (0.86), 2.301 (1.13), 2.307 (0.62), 2.314 (0.69), 2.321 (1.12), 2.328 (0.70), 3.529 (0.54), 3.550 (0.78), 3.573 (0.51), 7.262 (16.00), 7.354 (1.07), 7.356 (1.06), 7.374 (1.33), 7.409 (0.56), 7.412 (0.50), 7.428 (1.31), 7.430 (1.12), 7.446 (0.90), 7.449 (0.73), 7.530 (0.79), 7.534 (0.78), 7.549 (1.20), 7.553 (1.13), 7.568 (0.52), 7.572 (0.46), 7.677 (1.25), 7.680 (1.23), 7.696 (1.12), 7.699 (1.04), 12.696 (1.78).
(1309) Intermediate 188
Methyl 4-Tert-Butyl[1,1-Biphenyl]-2-Carboxylate
(1310) ##STR00223##
(1311) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 1-bromo-4-tert-butylbenzene (203 mg, 954 mol) in 1,2-dimethoxyethane (3.4 ml) was added under argon a 2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 80 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min) following flash chromatography (n-heptane:ethyl acetate). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 104 mg (99% purity, 66% yield) of the title compound were obtained.
(1312) LC-MS (Method 7): R.sub.t=2.47 min; MS (ESIpos): m/z=269 [M+H].sup.+
(1313) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.296 (0.70), 1.318 (16.00), 3.319 (2.05), 7.217 (1.42), 7.230 (1.59), 7.425 (1.02), 7.430 (1.81), 7.436 (1.24), 7.444 (1.54), 7.463 (0.81), 7.476 (0.49), 7.590 (0.45), 7.603 (0.72), 7.703 (0.74), 7.716 (0.66).
(1314) Intermediate 189
4-Tert-Butyl[1,1-Biphenyl]-2-Carboxylic Acid
(1315) ##STR00224##
(1316) To a solution of methyl 4-tert-butyl[1,1-biphenyl]-2-carboxylate (100 mg, 373 mol) in THF (1.3 ml) and methanol (260 l) an aqueous solution of lithium hydroxide (930 l, 2.0 M, 1.9 mmol) was added and the mixture was stirred at 60 C. for 5 hours. An aqueous solution of lithium hydroxide (930 l, 2.0 M, 1.9 mmol) was added and the mixture was stirred over night at 60 C.
(1317) The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The THF was removed on a rotary evaporator and the resulting precipitate was filtered off and dried in vacuo. 75.0 mg (95% purity, 75% yield) of the title compound were obtained.
(1318) LC-MS (Method 7): R.sub.t=2.08 min; MS (ESIneg): m/z=253 [MH].sup.
(1319) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.315 (16.00), 3.330 (0.71), 7.267 (1.42), 7.281 (1.61), 7.372 (0.74), 7.384 (0.82), 7.423 (1.88), 7.427 (1.45), 7.437 (1.54), 7.536 (0.46), 7.547 (0.70), 7.674 (0.75), 7.686 (0.66), 12.717 (0.56).
(1320) Intermediate 190
Methyl 4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylate
(1321) ##STR00225##
(1322) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 1-bromo-4-(trifluoromethyl)benzene (215 mg, 954 mol) in 1,2-dimethoxyethane (3.4 ml) was added under argon a 2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 80 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 123 mg (99% purity, 57% yield) of the title compound were obtained.
(1323) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.144 (0.72), 2.087 (0.52), 2.518 (0.58), 2.521 (0.63), 2.524 (0.58), 3.487 (0.54), 3.591 (1.05), 3.733 (0.59), 7.452 (0.56), 7.463 (8.11), 7.465 (8.07), 7.476 (9.24), 7.477 (8.88), 7.509 (14.13), 7.523 (15.11), 7.551 (4.41), 7.554 (4.34), 7.564 (9.48), 7.566 (8.73), 7.577 (5.81), 7.579 (5.30), 7.666 (5.60), 7.668 (5.62), 7.679 (8.99), 7.681 (8.91), 7.692 (4.07), 7.694 (3.85), 7.773 (16.00), 7.786 (14.17), 7.836 (8.75), 7.838 (8.30), 7.849 (8.05), 7.851 (7.29).
(1324) Intermediate 191
4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1325) ##STR00226##
(1326) To a solution of methyl 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylate (120 mg, 428 mol) in THF (1.5 ml) and methanol (300 l) was added an aqueous lithium hydroxide solution (1.1 ml, 2.0 M, 2.1 mmol) and the mixture was stirred at 60 C. for 5 hours. An aqueous solution of lithium hydroxide (1.1 ml, 2.0 M, 2.1 mmol) was added and the reaction was stirred at 60 C. over night. The mixture was acidified with excess 2N aqueous hydrochloric acid and was extracted with ethyl acetate and the organic layers were dried, filtered and evaporated. Purification was done by flash chromatography (n-heptane.fwdarw.n-heptane:ethyl acetate (50:50)). Product containing samples were united, the solvents were evaporated. 97.0 mg (99% purity, 84% yield) of the title compound were obtained.
(1327) LC-MS (Method 7): R.sub.t=1.87 min, MS (ESIneg): m/z=265 [MH].sup.
(1328) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.006 (0.47), 1.234 (0.49), 2.731 (0.57), 2.890 (0.71), 7.408 (7.62), 7.410 (7.81), 7.423 (8.91), 7.425 (8.64), 7.514 (4.14), 7.516 (4.14), 7.529 (11.51), 7.532 (14.91), 7.535 (14.57), 7.545 (8.62), 7.547 (11.70), 7.551 (15.41), 7.614 (5.63), 7.617 (5.78), 7.630 (8.61), 7.632 (8.40), 7.645 (3.72), 7.647 (3.45), 7.762 (16.00), 7.778 (13.68), 7.819 (8.50), 7.822 (8.25), 7.835 (7.76), 7.837 (7.12), 12.881 (1.65).
(1329) Intermediate 192
Methyl 4-[1-(Trifluoromethyl)Cyclopropyl][1,1-Biphenyl]-2-Carboxylate
(1330) ##STR00227##
(1331) To a suspension of [2-(methoxycarbonyl)phenyl]boronic acid (150 mg, 833 mol) and 1-bromo-4-[1-(trifluoromethyl)cyclopropyl]benzene (276 mg, 1.04 mmol) in 1,2-dimethoxyethane (4.0 ml) was added under argon a2 M solution sodium carbonate in water (2.1 ml, 2.0 M, 4.2 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (48.3 mg, 41.7 mol). The mixture was stirred overnight at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated. Purification was done by flash chromatography. Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 69.4 mg (100% purity, 26% yield) of the title compound were obtained.
(1332) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.168 (4.47), 1.360 (1.56), 1.368 (5.76), 1.379 (1.20), 3.297 (0.48), 3.575 (0.66), 3.590 (16.00), 7.298 (4.45), 7.309 (4.62), 7.311 (4.53), 7.434 (2.21), 7.447 (2.54), 7.496 (4.84), 7.503 (3.35), 7.508 (4.29), 7.617 (1.42), 7.629 (2.38), 7.642 (1.06), 7.756 (2.65), 7.769 (2.41).
(1333) Intermediate 193
4-[1-(Trifluoromethyl)Cyclopropyl][1,1-Biphenyl]-2-Carboxylic Acid
(1334) ##STR00228##
(1335) To a solution of methyl 4-[1-(trifluoromethyl)cyclopropyl][1,1-biphenyl]-2-carboxylate (65.2 mg, 204 mol) in THF (1.5 ml) and methanol (300 l) was added aqueous lithium hydroxide (510 l, 2.0 M, 1.0 mmol) and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated. 58.9 mg (98% purity, 93% yield) of the title compound were obtained.
(1336) LC-MS (Method 12): R.sub.t=3.47 min; MS (ESIneg): m/z=305 [MH].sup.
(1337) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.47), 0.008 (1.56), 1.073 (1.45), 1.091 (2.97), 1.108 (1.56), 1.157 (8.75), 1.314 (0.42), 1.354 (4.62), 1.366 (10.76), 1.370 (10.60), 1.383 (3.53), 2.524 (0.87), 3.374 (3.21), 3.392 (2.17), 3.409 (0.85), 7.339 (11.78), 7.343 (4.36), 7.355 (5.03), 7.359 (16.00), 7.374 (4.77), 7.377 (5.07), 7.393 (5.78), 7.396 (5.91), 7.445 (2.69), 7.448 (2.67), 7.464 (5.94), 7.467 (5.62), 7.485 (15.34), 7.506 (9.17), 7.554 (3.69), 7.558 (4.01), 7.573 (5.48), 7.577 (5.61), 7.592 (2.38), 7.595 (2.25), 7.717 (5.22), 7.720 (5.16), 7.736 (4.66), 7.739 (4.33), 12.778 (0.64).
(1338) Intermediate 194
Methyl 5-Fluoro-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylate
(1339) ##STR00229##
(1340) To a suspension of methyl 4-fluoro-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 714 mol) and 1-bromo-4-(trifluoromethyl)benzene (201 mg, 893 mol) in 1,2-dimethoxyethane (3.1 ml) was added under argon a 2 M solution sodium carbonate in water (1.8 ml, 2.0 M, 3.6 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (41.4 mg, 35.7 mol). The mixture was stirred over night at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 74.0 mg (97% purity, 34% yield) of the title compound were obtained.
(1341) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.519 (0.53), 2.524 (0.41), 3.606 (16.00), 7.347 (0.95), 7.354 (1.24), 7.371 (0.96), 7.378 (1.25), 7.392 (0.69), 7.398 (0.58), 7.413 (1.30), 7.420 (1.12), 7.434 (0.76), 7.441 (0.70), 7.532 (2.02), 7.551 (2.37), 7.778 (2.43), 7.798 (2.09), 7.921 (1.10), 7.935 (1.14), 7.942 (1.11), 7.957 (1.04).
(1342) Intermediate 195
5-Fluoro-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1343) ##STR00230##
(1344) To a solution of methyl 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylate (70.0 mg, 235 mol) in THF (810 l) and methanol (160 l) was added aqueous lithium hydroxide (590 l, 2.0 M, 1.2 mmol) and the mixture was stirred for 2 hours at 60 C. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The THF was removed on a rotary evaporator and the resulting precipitate was filtered off, washed with water and dried in vacuo. 64.0 mg (97% purity, 93% yield) of the title compound were obtained.
(1345) LC-MS (Method 7): R.sub.t=1.93 min; MS (ESIneg): m/z=283 [MH].sup.
(1346) Intermediate 196
Methyl 4,5-Bis(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1347) ##STR00231##
(1348) To a suspension of [2-(methoxycarbonyl)-5-(trifluoromethyl)phenyl]boronic acid (200 mg, 807 mol) and 1-bromo-4-(trifluoromethyl)benzene (227 mg, 1.01 mmol) in 1,2-dimethoxyethane (3.6 ml) was added under argon a 2 M solution sodium carbonate in water (2.0 ml, 2.0 M, 4.0 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (46.8 mg, 40.3 mol). The mixture was stirred over night at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 99.0 mg (97% purity, 36% yield) of the title compound were obtained.
(1349) LC-MS (Method 8): R.sub.t=1.12 min; MS (ESIneg): m/z=332 [MH].sup.
(1350) .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 7.63 (d, J=8.19 Hz, 2H) 7.76-7.84 (m, 3H) 7.88-7.94 (m, 1H) 8.02 (d, J=8.07 Hz, 1H) 13.37 (s, 1H).
(1351) Intermediate 197
Methyl 4-(Propan-2-Yl)[1,1-Biphenyl]-2-Carboxylate
(1352) ##STR00232##
(1353) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 1-bromo-4-(propan-2-yl)benzene (190 mg, 954 mol) in 1,2-dimethoxyethane (3.4 ml) was added under argon a 2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 80 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 262 mg (94% purity, 128% yield) of the title compound were obtained.
(1354) LC-MS (method 7): R.sub.t=2.40 min; MS (ESIpos): m/z=255 [M+H].sup.+
(1355) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 1.231 (15.94), 1.245 (16.00), 2.916 (0.88), 2.930 (1.14), 2.944 (0.83), 3.717 (1.74), 7.203 (3.12), 7.216 (1.49), 7.220 (4.72), 7.284 (4.35), 7.300 (2.89), 7.423 (1.56), 7.438 (1.86), 7.447 (0.85), 7.450 (0.81), 7.462 (1.80), 7.465 (1.63), 7.478 (1.15), 7.480 (1.02), 7.587 (1.02), 7.590 (1.10), 7.602 (1.63), 7.605 (1.69), 7.617 (0.77), 7.620 (0.76), 7.699 (1.63), 7.701 (1.63), 7.714 (1.45), 7.716 (1.41).
(1356) Intermediate 198
4-(Propan-2-Yl)[1,1-Biphenyl]-2-Carboxylic Acid
(1357) ##STR00233##
(1358) To a solution of methyl 4-(propan-2-yl)[1,1-biphenyl]-2-carboxylate (260 mg, 1.02 mmol) in THE (3.5 ml) and methanol (710 l) an aqueous solution of lithium hydroxide (2.6 ml, 2.0 M, 5.1 mmol) was added and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated. Purification was done by flash chromatography (n-heptane.fwdarw.n-heptane:ethyl acetate (50:50)). Product containing samples were united, the solvents were evaporated. 63.0 mg (99% purity, 25% yield) of the title compound were obtained.
(1359) LC-MS (Method 7): R.sub.t=1.99 min; MS (ESIpos): m/z=241 [M+H].sup.+
(1360) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 1.229 (15.85), 1.243 (16.00), 1.250 (0.72), 2.911 (0.96), 2.925 (1.26), 2.939 (0.92), 7.249 (1.51), 7.253 (0.76), 7.261 (1.48), 7.266 (7.00), 7.275 (6.65), 7.292 (1.34), 7.367 (1.57), 7.381 (1.80), 7.383 (1.81), 7.411 (0.79), 7.414 (0.75), 7.427 (1.80), 7.429 (1.62), 7.442 (1.15), 7.444 (0.99), 7.532 (1.03), 7.535 (1.07), 7.547 (1.62), 7.550 (1.61), 7.562 (0.72), 7.565 (0.69), 7.672 (1.67), 7.674 (1.63), 7.687 (1.51), 7.690 (1.40), 12.728 (0.48).
(1361) Intermediate 199
Methyl 4-(2,2,2-Trifluoroethyl)[1,1-Biphenyl]-2-Carboxylate
(1362) ##STR00234##
(1363) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 1-bromo-4-(2,2,2-trifluoroethyl)benzene (228 mg, 954 mol) in 1,2-dimethoxyethane (4.0 ml) was added under argon a 2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated. Purification was done by flash chromatography (n-heptane:ethyl acetate gradient). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 122 mg (100% purity, 54% yield) of the title compound were obtained.
(1364) LC-MS (Method 8): R.sub.t=1.13 min, MS (ESIpos): m/z=295 [M+H].sup.+
(1365) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.324 (16.00), 3.670 (0.73), 3.689 (2.10), 3.709 (2.01), 3.728 (0.63), 7.294 (3.27), 7.307 (4.30), 7.399 (3.13), 7.413 (2.45), 7.444 (1.47), 7.445 (1.56), 7.456 (1.72), 7.458 (1.75), 7.486 (0.77), 7.488 (0.77), 7.499 (1.72), 7.501 (1.63), 7.511 (1.07), 7.513 (0.98), 7.616 (0.96), 7.618 (1.03), 7.628 (1.61), 7.630 (1.64), 7.641 (0.73), 7.643 (0.71), 7.747 (1.57), 7.748 (1.55), 7.759 (1.45), 7.761 (1.39).
(1366) Intermediate 200
4-(2,2,2-Trifluoroethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1367) ##STR00235##
(1368) To a solution of methyl 4-(2,2,2-trifluoroethyl)[1,1-biphenyl]-2-carboxylate (119 mg, 405 mol) in THF (2.5 ml) and methanol (500 l) an aqueous solution of lithium hydroxide (1.0 ml, 2.0 M, 2.0 mmol) was added and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and the mixture and evaporated. Purification was done by flash chromatography (n-heptane:ethyl acetate gradient). Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 101 mg (100% purity, 89% yield) of the title compound were obtained.
(1369) LC-MS (Method 7): R.sub.t=1.90 min; MS (ESIpos): m/z=281 [M+H].sup.+
(1370) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.98), 0.008 (1.01), 3.644 (2.35), 3.674 (6.85), 3.703 (6.56), 3.732 (2.07), 7.328 (7.03), 7.333 (3.01), 7.344 (4.33), 7.349 (16.00), 7.383 (14.81), 7.402 (9.91), 7.442 (2.12), 7.445 (2.13), 7.461 (5.06), 7.464 (4.59), 7.480 (3.47), 7.483 (2.99), 7.555 (3.14), 7.559 (3.35), 7.574 (4.68), 7.578 (4.73), 7.593 (2.02), 7.597 (1.89), 7.720 (4.70), 7.723 (4.64), 7.739 (4.19), 7.742 (3.88), 12.757 (4.01).
(1371) Intermediate 201
Methyl 4-(1,1,1-Trifluoro-2-Methylpropan-2-Yl)[1,1-Biphenyl]-2-Carboxylate
(1372) ##STR00236##
(1373) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 1-bromo-4-(1,1,1-trifluoro-2-methylpropan-2-yl)benzene (255 mg, 954 mol, CAS 1225380-05-1) in 1,2-dimethoxyethane (4.0 ml) was added under argon a 2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B: flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 123 mg (92% purity, 46% yield) of the title compound were obtained.
(1374) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.591 (16.00), 3.383 (0.81), 3.586 (9.92), 3.588 (9.52), 3.614 (0.96), 3.616 (0.94), 7.307 (2.41), 7.326 (2.90), 7.444 (1.31), 7.463 (1.64), 7.480 (0.70), 7.499 (1.59), 7.518 (1.12), 7.572 (2.69), 7.592 (2.19), 7.610 (1.05), 7.629 (1.59), 7.648 (0.77), 7.746 (1.40), 7.766 (1.22).
(1375) Intermediate 202
4-(1,1,1-Trifluoro-2-Methylpropan-2-Yl)[1,1-Biphenyl]-2-Carboxylic Acid
(1376) ##STR00237##
(1377) To a solution of methyl 4-(1,1,1-trifluoro-2-methylpropan-2-yl)[1,1-biphenyl]-2-carboxylate (118 mg, 366 mol) in THF (2.5 ml) and methanol (500 l) was added aqueous lithium hydroxide (920 l, 2.0 M, 1.8 mmol) and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and the mixture was evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 99.4 mg (94% purity, 83% yield) of the title compound were obtained.
(1378) LC-MS (Method 7): R.sub.t=2.10 min; MS (ESIpos): m/z=309 [M+H].sup.+
(1379) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.43), 1.588 (16.00), 7.349 (0.41), 7.355 (3.10), 7.359 (1.08), 7.371 (1.23), 7.376 (3.82), 7.382 (0.61), 7.389 (1.20), 7.391 (1.28), 7.408 (1.51), 7.410 (1.56), 7.443 (0.66), 7.446 (0.66), 7.462 (1.56), 7.465 (1.43), 7.481 (1.09), 7.484 (0.96), 7.555 (1.09), 7.558 (1.38), 7.566 (2.64), 7.573 (2.07), 7.577 (1.80), 7.587 (2.10), 7.592 (1.15), 7.596 (0.86), 7.711 (1.35), 7.714 (1.34), 7.730 (1.20), 7.733 (1.11), 12.769 (0.88).
(1380) Intermediate 203
Methyl 4-(Difluoromethyl)[1,1-Biphenyl]-2-Carboxylate
(1381) ##STR00238##
(1382) To a suspension of [2-(methoxycarbonyl)phenyl]boronic acid (150 mg, 833 mol) and 1-bromo-4-(difluoromethyl)benzene (130 l, 1.0 mmol) in 1,2-dimethoxyethane (4.0 ml) was added under argon a 2 M solution sodium carbonate in water (2.1 ml, 2.0 M, 4.2 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (48.3 mg, 41.7 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated. Purification was done by flash chromatography (cyclohexane: ethyl acetate gradient). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 96.7 mg (100% purity, 44% yield) of the title compound were obtained.
(1383) LC-MS (Method 7): R.sub.t=2.04 min, MS (ESIpos): m/z=263 [M+H].sup.+
(1384) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.604 (16.00), 7.000 (1.00), 7.093 (2.00), 7.186 (0.92), 7.424 (2.57), 7.437 (2.94), 7.450 (1.52), 7.463 (1.69), 7.522 (0.69), 7.524 (0.73), 7.535 (1.56), 7.537 (1.59), 7.548 (0.95), 7.549 (0.95), 7.612 (2.63), 7.625 (2.30), 7.644 (0.90), 7.646 (0.95), 7.657 (1.48), 7.659 (1.54), 7.669 (0.67), 7.671 (0.67), 7.794 (1.51), 7.795 (1.50), 7.807 (1.39), 7.808 (1.35).
(1385) Intermediate 204
4-(Difluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1386) ##STR00239##
(1387) To a solution of methyl 4-(difluoromethyl)[1,1-biphenyl]-2-carboxylate (90.6 mg, 345 mol) in THF (2.0 ml) and methanol (400 l) was added aqueous lithium hydroxide (860 l, 2.0 M, 1.7 mmol) and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and the mixture was evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated. 82.2 mg (100% purity, 96% yield) of the title compound were obtained.
(1388) LC-MS (Method 12): R.sub.t=2.79 min; MS (ESIneg): m/z=247 [MH].sup.
(1389) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.20), 0.008 (1.58), 6.944 (5.73), 7.084 (11.35), 7.223 (5.28), 7.390 (6.81), 7.392 (7.25), 7.409 (8.53), 7.411 (8.60), 7.451 (12.04), 7.471 (16.00), 7.480 (4.63), 7.483 (4.07), 7.499 (8.48), 7.502 (8.03), 7.517 (5.81), 7.520 (5.24), 7.587 (6.90), 7.591 (12.93), 7.594 (14.78), 7.606 (9.78), 7.609 (12.63), 7.614 (11.61), 7.624 (4.19), 7.628 (3.61), 7.776 (7.75), 7.779 (7.81), 7.795 (7.04), 7.798 (6.70), 12.806 (4.91).
(1390) Intermediate 205
Methyl 4-(2-Cyanopropan-2-Yl)[1,1-Biphenyl]-2-Carboxylate
(1391) ##STR00240##
(1392) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 2-(4-bromophenyl)-2-methylpropanenitrile (160 l, 950 mol) in 1,2-dimethoxyethane (4.0 ml) was added under argon a 2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine dried, filtered and evaporated Purification was done by flash chromatography (n-heptane:ethyl acetate gradient). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 126 mg (100% purity, 59% yield) of the title compound were obtained.
(1393) LC-MS (Method 8): R.sub.t=1.06 min; MS (ESIpos): m/z=280 [M+H].sup.+
(1394) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.728 (16.00), 3.322 (9.42), 7.346 (2.11), 7.349 (0.71), 7.356 (0.78), 7.359 (2.45), 7.438 (0.80), 7.440 (0.84), 7.451 (0.93), 7.452 (0.93), 7.493 (0.44), 7.495 (0.43), 7.505 (0.94), 7.507 (0.88), 7.518 (0.58), 7.520 (0.53), 7.559 (2.43), 7.562 (0.75), 7.570 (0.74), 7.573 (2.10), 7.621 (0.54), 7.624 (0.57), 7.634 (0.89), 7.636 (0.91), 7.646 (0.41), 7.761 (0.89), 7.763 (0.86), 7.774 (0.82), 7.776 (0.76).
(1395) Intermediate 206
4-(2-Cyanopropan-2-Yl)[1,1-Biphenyl]-2-Carboxylic Acid
(1396) ##STR00241##
(1397) To a solution of methyl 4-(2-cyanopropan-2-yl)[1,1-biphenyl]-2-carboxylate (123 mg, 440 mol) in THF (2.5 ml) and methanol (500 l) an aqueous solution of lithium hydroxide (1.1 ml, 2.0 M, 2.2 mmol) was added and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The mixture was evaporated and purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated. 102 mg (100% purity, 87% yield) of the title compound were obtained.
(1398) LC-MS (Method 7): R.sub.t=1.78 min; MS (ESIneg): m/z=264 [MH].sup.
(1399) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.726 (16.00), 7.381 (2.64), 7.402 (3.40), 7.407 (0.45), 7.450 (0.40), 7.453 (0.41), 7.469 (0.95), 7.472 (0.88), 7.488 (0.66), 7.491 (0.59), 7.547 (2.57), 7.553 (0.80), 7.561 (0.84), 7.565 (1.26), 7.569 (2.01), 7.580 (0.96), 7.584 (0.95), 7.728 (0.86), 7.731 (0.87), 7.748 (0.77), 7.751 (0.72), 12.769 (0.58).
(1400) Intermediate 207
Methyl 4-(1,1-Difluoroethyl)[1,1-Biphenyl]-2-Carboxylate
(1401) ##STR00242##
(1402) To a suspension of [2-(methoxycarbonyl)phenyl]boronic acid (150 mg, 833 mol) and 1-bromo-4-(1,1-difluoroethyl)benzene (150 l, 1.0 mmol) in 1,2-dimethoxyethane (4.0 ml) was added under argon a 2 M solution sodium carbonate in water (2.1 ml, 2.0 M, 4.2 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (48.3 mg, 41.7 mol). The mixture was stirred overnight at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine dried, filtered and evaporated. Purification was done by flash chromatography (cyclohexane: ethyl acetate gradient). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 61.1 mg (100% purity, 27% yield) of the title compound were obtained.
(1403) LC-MS (Method 7): R.sub.t=2.14 min, MS (ESIpos): m/z=277 [M+H].sup.+
(1404) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.981 (3.05), 2.012 (6.24), 2.044 (2.73), 3.611 (16.00), 7.394 (2.57), 7.407 (2.83), 7.446 (1.39), 7.459 (1.60), 7.516 (0.73), 7.518 (0.67), 7.528 (1.61), 7.530 (1.43), 7.541 (1.01), 7.543 (0.86), 7.602 (2.87), 7.616 (2.48), 7.639 (0.91), 7.641 (0.91), 7.651 (1.52), 7.654 (1.45), 7.664 (0.70), 7.666 (0.63), 7.787 (1.44), 7.789 (1.41), 7.800 (1.33), 7.802 (1.25).
(1405) Intermediate 208
4-(1,1-Difluoroethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1406) ##STR00243##
(1407) To a solution of methyl 4-(1,1-difluoroethyl)[1,1-biphenyl]-2-carboxylate (55.3 mg, 200 mol) in THF (1.5 ml) and methanol (300 l) was added aqueous lithium hydroxide (500 l, 2.0 M, 1.0 mmol) and the mixture was stirred at 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The mixture was evaporated and purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated. 47.1 mg (97% purity, 90% yield) of the title compound were obtained.
(1408) LC-MS (Method 12): R.sub.t=3.02 min; MS (ESIneg): m/z=261 [MH].sup.
(1409) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.48), 0.008 (0.56), 1.964 (8.05), 2.011 (16.00), 2.058 (7.20), 7.387 (2.86), 7.390 (3.16), 7.406 (3.60), 7.409 (3.80), 7.424 (5.45), 7.445 (6.91), 7.473 (1.47), 7.476 (1.56), 7.492 (3.53), 7.495 (3.48), 7.511 (2.42), 7.514 (2.31), 7.580 (2.62), 7.584 (3.83), 7.589 (7.01), 7.599 (4.06), 7.603 (4.67), 7.610 (5.63), 7.618 (1.99), 7.621 (1.63), 7.763 (3.24), 7.766 (3.34), 7.782 (2.91), 7.785 (2.85), 12.797 (1.97).
(1410) Intermediate 209
Methyl 4-(Difluoromethoxy)[1,1-Biphenyl]-2-Carboxylate
(1411) ##STR00244##
(1412) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 1-bromo-4-(difluoromethoxy)benzene (213 mg, 954 mol) in 1,2-dimethoxyethane (3.4 ml) was added under argon a 2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 80 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 122 mg (93% purity, 53% yield) of the title compound were obtained.
(1413) LC-MS (Method 12): R.sub.t=3.39 min; MS (ESIpos): m/z=279 [M+H].sup.+
(1414) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.142 (0.63), 2.523 (0.74), 3.732 (0.62), 7.177 (4.49), 7.215 (11.45), 7.229 (13.82), 7.300 (8.90), 7.334 (16.00), 7.348 (12.22), 7.423 (10.05), 7.435 (6.67), 7.488 (3.31), 7.501 (6.98), 7.513 (4.21), 7.563 (0.46), 7.616 (3.69), 7.618 (3.59), 7.629 (6.23), 7.641 (3.16), 7.657 (0.46), 7.756 (6.12), 7.769 (5.53).
(1415) Intermediate 210
4-(Difluoromethoxy)[1,1-Biphenyl]-2-Carboxylic Acid
(1416) ##STR00245##
(1417) To a solution of methyl 4-(difluoromethoxy)[1,1-biphenyl]-2-carboxylate (120 mg, 431 mol) in THF (1.5 ml) and methanol (300 l) was added an aqueous solution of lithium hydroxide (1.1 ml, 2.0 M, 2.2 mmol) and the mixture was stirred at 60 C. overnight. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated. Purification was done by flash chromatography (n-heptane.fwdarw.n-heptane:ethyl acetate (50:50)). Product containing samples were united, the solvents were evaporated. 90.0 mg (99% purity, 78% yield) of the title compound were obtained.
(1418) LC-MS (Method 8): R.sub.t=0.94 min, MS (ESIneg): m/z=263 [MH].sup.
(1419) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.007 (0.41), 1.989 (0.54), 7.151 (3.91), 7.205 (8.62), 7.222 (10.43), 7.227 (1.24), 7.299 (7.92), 7.361 (1.89), 7.367 (16.00), 7.370 (7.15), 7.380 (4.43), 7.384 (14.37), 7.390 (1.36), 7.448 (3.97), 7.451 (2.37), 7.454 (2.18), 7.466 (4.73), 7.469 (4.40), 7.482 (3.06), 7.484 (2.74), 7.563 (2.88), 7.566 (2.99), 7.579 (4.47), 7.581 (4.43), 7.594 (1.99), 7.596 (1.87), 7.739 (4.37), 7.742 (4.33), 7.755 (3.98), 7.757 (3.72), 12.814 (2.80).
(1420) Intermediate 211
Methyl 4,5-Difluoro[1,1-Biphenyl]-2-Carboxylate
(1421) ##STR00246##
(1422) To a suspension of methyl 4-fluoro-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 714 mol) and 1-bromo-4-fluorobenzene (156 mg, 893 mol) in 1,2-dimethoxyethane (3.1 ml) was added under argon a 2 M solution sodium carbonate in water (1.8 ml, 2.0 M, 3.6 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (41.4 mg, 35.7 mol). The mixture was stirred for 3.5 hours at 90 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine dried, filtered and evaporated. Purification was done by flash chromatography (n-heptane:ethyl acetate (80:20).fwdarw.ethyl acetate). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 102 mg (58% yield) of the title compound were obtained.
(1423) .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 3.60 (s, 3H) 7.22-7.32 (m, 3H) 7.32-7.39 (m, 3H) 7.86 (dd, J=8.62, 5.93 Hz, 1H)
(1424) Intermediate 212
4,5-Difluoro[1,1-Biphenyl]-2-Carboxylic Acid
(1425) ##STR00247##
(1426) To a solution of methyl 4,5-difluoro[1,1-biphenyl]-2-carboxylate (100 mg, 403 mol) in THF (1.4 ml) and methanol (280 l) an aqueous solution of lithium hydroxide (1.0 ml, 2.0 M, 2.0 mmol) was added and the mixture was stirred 60 C. for 3.5 hours. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The THF was removed on a rotary evaporator and the resulting precipitate was filtered off, washed with water and dried in vacuo. 76.0 mg (95% purity, 77% yield) of the title compound were obtained.
(1427) LC-MS (Method 7): R.sub.t=1.70 min: MS (ESIneg): m/z=233 [MH].sup.
(1428) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.235 (1.44), 7.212 (5.03), 7.219 (10.94), 7.241 (16.00), 7.263 (8.34), 7.270 (1.38), 7.278 (2.86), 7.285 (2.46), 7.299 (5.47), 7.306 (4.74), 7.321 (2.98), 7.327 (2.59), 7.363 (8.12), 7.368 (3.71), 7.377 (9.06), 7.385 (7.19), 7.393 (3.17), 7.398 (6.13), 7.549 (0.69), 7.557 (0.61), 7.566 (0.79), 7.574 (0.68), 7.598 (0.94), 7.615 (0.81), 7.627 (1.17), 7.645 (0.66), 7.815 (4.80), 7.830 (5.15), 7.837 (4.91), 7.852 (4.55), 12.871 (0.46).
(1429) Intermediate 213
Methyl 4-Fluoro[1,1-Biphenyl]-2-Carboxylate
(1430) ##STR00248##
(1431) To a suspension of methyl 2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (200 mg, 763 mol) and 1-bromo-4-fluorobenzene (167 mg, 954 mol) in 1,2-dimethoxyethane (3.4 ml) was added under argon a2 M solution sodium carbonate in water (1.9 ml, 2.0 M, 3.8 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (44.3 mg, 38.2 mol). The mixture was stirred over night at 80 C. Water was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 80.0 mg (96% purity, 44% yield) of the title compound were obtained.
(1432) LC-MS (Method 7): R.sub.t=2.00 min; MS (ESIpos): m/z=231 [M+H].sup.+
(1433) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 3.600 (16.00), 7.232 (1.36), 7.236 (0.53), 7.245 (0.75), 7.249 (3.40), 7.254 (0.68), 7.263 (0.65), 7.267 (2.20), 7.310 (2.14), 7.315 (0.87), 7.321 (2.31), 7.328 (1.55), 7.334 (0.61), 7.339 (1.32), 7.420 (1.19), 7.422 (1.25), 7.435 (1.39), 7.437 (1.43), 7.484 (0.66), 7.486 (0.66), 7.499 (1.46), 7.501 (1.38), 7.514 (0.94), 7.516 (0.85), 7.611 (0.89), 7.613 (0.95), 7.626 (1.40), 7.629 (1.43), 7.641 (0.63), 7.644 (0.61), 7.751 (1.32), 7.753 (1.29), 7.767 (1.19), 7.769 (1.11).
(1434) Intermediate 214
4-Fluoro[1,1-Biphenyl]-2-Carboxylic Acid
(1435) ##STR00249##
(1436) To a solution of methyl 4-fluoro[1,1-biphenyl]-2-carboxylate (80.0 mg, 347 mol) in THF (1.2 ml) and methanol (240 l) was added aqueous lithium hydroxide (870 l, 2.0 M, 1.7 mmol) and the mixture was stirred at 60 C. for 3.5 hours. An aqueous solution of lithium hydroxide (870 l, 2.0 M, 1.7 mmol) was added and the mixture was stirred at 60 C. for 2 hours. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The THF was removed on a rotary evaporator and the resulting precipitate was filtered off, washed with water and dried in vacuo. 69.0 mg (99% purity, 91% yield) of the title compound were obtained.
(1437) LC-MS (Method 7): R.sub.t=1.61 min, MS (ESIpos): m/z=217 [M+H].sup.+
(1438) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.236 (0.41), 3.600 (0.78), 7.220 (7.61), 7.234 (16.00), 7.249 (9.30), 7.343 (10.00), 7.352 (12.11), 7.356 (10.48), 7.366 (14.14), 7.380 (9.31), 7.452 (4.05), 7.464 (8.71), 7.477 (5.23), 7.562 (5.14), 7.575 (8.21), 7.587 (3.62), 7.739 (8.56), 7.752 (7.79), 12.792 (5.90).
(1439) Intermediate 215
Methyl 6-Methyl-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylate
(1440) ##STR00250##
(1441) To a suspension of [4-(trifluoromethyl)phenyl]boronic acid (100 mg, 527 mol) and methyl 2-bromo-3-methylbenzoate (110 l, 660 mol) in 1,2-dimethoxyethane (3.0 ml) was added under argon a 2 M solution sodiumcarbonat in water (1.3 ml, 2.0 M, 2.6 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (30.5 mg, 26.3 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 92.0 mg (100% purity, 59% yield) of the title compound were obtained.
(1442) LC-MS (Method 7): R.sub.t=2.35 min; MS (ESIpos): m/z=295 [M+H].sup.+
(1443) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.035 (10.68), 3.311 (16.00), 7.365 (2.17), 7.385 (2.41), 7.427 (0.93), 7.446 (2.29), 7.465 (1.53), 7.544 (1.42), 7.562 (1.02), 7.682 (1.19), 7.700 (1.03), 7.757 (2.51), 7.777 (2.30).
(1444) Intermediate 216
6-Methyl-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1445) ##STR00251##
(1446) To a solution of methyl 6-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylate (90.0 mg, 306 mol) in THF (2.0 ml) and methanol (400 l) was added Lithiumhydroxide (760 l, 2.0 M, 1.5 mmol) and the mixture was stirred at room temperature for over night. Lithiumhydroxide (760 l, 2.0 M, 1.5 mmol) was added to the mixture and the reaction was stirred 60 C. over night. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The THF was removed on a rotary evaporator and the resulting precipitate was filtered off, washed with water and dried in vacuo. 132 mg (97% purity, 150% yield, contains salts) of the title compound were obtained.
(1447) LC-MS (Method 7): R.sub.t=1.98 min; MS (ESIpos): m/z=281 [M+H].sup.+
(1448) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.234 (0.99), 2.015 (16.00), 3.491 (0.48), 7.379 (5.58), 7.392 (6.54), 7.409 (3.71), 7.421 (2.36), 7.491 (3.22), 7.503 (2.65), 7.652 (2.98), 7.664 (2.79), 7.748 (5.68), 7.760 (5.62), 12.566 (2.37).
(1449) Intermediate 217
Methyl 4,6-Dimethyl[1,1-Biphenyl]-2-Carboxylate
(1450) ##STR00252##
(1451) To a suspension of (4-methylphenyl)boronic acid (100 mg, 736 mol) and methyl 2-bromo-3-methylbenzoate (150 l, 920 mol) in 1,2-dimethoxyethane (3.0 ml) was added under argon a2 M solution sodiumcarbonat in water (1.8 ml, 2.0 M, 3.7 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (42.7 mg, 36.8 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 129 mg (100% purity, 73% yield) of the title compound were obtained.
(1452) LC-MS (Method 7): R.sub.t=2.29 min; MS (ESIpos): m/z=241 [M+H].sup.+
(1453) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.056 (16.00), 2.349 (14.64), 3.327 (5.89), 6.998 (4.23), 7.019 (5.30), 7.197 (4.12), 7.216 (3.44), 7.336 (1.37), 7.355 (3.39), 7.374 (2.30), 7.459 (2.09), 7.477 (1.50), 7.523 (1.92), 7.542 (1.60).
(1454) Intermediate 218
4,6-Dimethyl[1,1-Biphenyl]-2-Carboxylic Acid
(1455) ##STR00253##
(1456) To a solution of methyl 4,6-dimethyl[1,1-biphenyl]-2-carboxylate (126 mg, 525 mol) in THE (2.0 ml) and methanol (400 l) was added Lithiumhydroxide (1.3 ml, 2.0 M, 2.6 mmol) and the mixture was stirred at room temperature for over night. Lithiumhydroxide (1.3 ml, 2.0 M, 2.6 mmol) was added to the mixture and the reaction was stirred over night at 60 C. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid. The THF was removed on a rotary evaporator and the resulting precipitate was filtered off, washed with water and dried in vacuo. 127 mg (98% purity, 106% yield) of the title compound were obtained.
(1457) LC-MS (Method 7): R.sub.t=1.86 min, MS (ESIpos): m/z=227 [M+H].sup.+
(1458) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.236 (0.47), 2.034 (16.00), 2.341 (15.60), 7.021 (4.49), 7.040 (5.64), 7.183 (5.37), 7.202 (4.58), 7.302 (1.30), 7.321 (3.03), 7.340 (2.19), 7.407 (2.98), 7.425 (2.13), 7.501 (2.60), 7.520 (2.22), 12.379 (3.58).
(1459) Intermediate 219
Tert-Butyl 4-(2,2-Difluorocyclopropyl)-5-Methyl[1,1-Biphenyl]-2-Carboxylate (Racemic Mixture)
(1460) ##STR00254##
(1461) To a suspension of tert-butyl 4-methyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (197 mg, 618 mol) and 1-bromo-4-(2,2-difluorocyclopropyl)benzene (180 mg, 772 mol) in 1,2-dimethoxyethane (3.0 ml) was added under argon a 2 M solution sodium carbonate in water (1.5 ml, 2.0 M, 3.1 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (35.8 mg, 30.9 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with brine, dried, filtered and evaporated. Purification was done by flash chromatography (heptane:ethyl acetate gradient). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 175 mg (98% purity, 81% yield) of the title compound were obtained.
(1462) LC-MS (Method 7): R.sub.t=2.59 min; MS (ESIpos): m/z=367 [M+Na].sup.+
(1463) Intermediate 220
4-(2,2-Difluorocyclopropyl)-5-Methyl[1,1-Biphenyl]-2-Carboxylicacid (Racemic Mixture)
(1464) ##STR00255##
(1465) To a solution of tert-butyl 4-(2,2-difluorocyclopropyl)-5-methyl[1,1-biphenyl]-2-carboxylate (172 mg, 500 mol) in trifluoroethanol (3.0 ml) was added zinc chloride (409 mg, 3.00 mmol) and the reaction was stirred at 50 C. for 1 hour. EDTA (877 mg, 3.00 mmol) was added and the mixture was stirred for a few minutes. Water+0.1% TFA (1 ml) was added. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 114 mg (100% purity, 79% yield) of the title compound were obtained.
(1466) LC-MS (Method 7): R.sub.t=1.95 min; MS (ESIneg): m/z=287 [MH].sup.
(1467) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.930 (0.75), 1.936 (0.82), 1.943 (0.67), 1.951 (0.94), 1.958 (0.69), 1.966 (0.73), 1.972 (0.49), 1.976 (0.50), 1.988 (0.71), 1.997 (0.73), 2.009 (0.63), 2.018 (0.44), 2.375 (16.00), 3.004 (0.64), 3.018 (0.66), 3.026 (0.86), 3.040 (0.86), 3.046 (0.69), 3.060 (0.58), 3.274 (0.45), 7.174 (3.29), 7.247 (1.76), 7.248 (1.70), 7.260 (1.92), 7.264 (2.20), 7.268 (0.83), 7.274 (1.22), 7.278 (12.12), 7.283 (10.40), 7.293 (0.63), 7.297 (1.21), 7.643 (3.85), 7.656 (3.57).
(1468) Intermediate 221
Methyl 4-(2,2-Difluorocyclopropyl)-4-Fluoro[1,1-Biphenyl]-2-Carboxylate (Racemic Mixture)
(1469) ##STR00256##
(1470) To a suspension of [4-fluoro-2-(methoxycarbonyl)phenyl]boronic acid (122 mg, 618 mol) and 1-bromo-4-(2,2-difluorocyclopropyl)benzene (180 mg, 772 mol) in 1,2-dimethoxyethane (3.0 ml) was added under argon a2 M solution sodium carbonate in water (1.5 ml, 2.0 M, 3.1 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (35.8 mg, 30.9 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with 1 N sodium hydroxide solution, dried, filtered and evaporated. Purification was done by flash chromatography (heptane:ethyl acetate gradient). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 36.1 mg (100% purity, 19% yield) of the title compound were obtained.
(1471) The aqueous phase was acidified (pH 1-2) with hydrochloric acid and extracted with dichloromethane. The combined organic layers were washed with brine, dried, filtered and evaporated. The crude material 83 mg (saponified product of this step) was purified together with the material described in the next step.
(1472) LC-MS (Method 7): R.sub.t=2.22 min, MS (ESIpos): m/z=329 [M+Na].sup.+
(1473) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.50), 0.008 (0.63), 1.951 (0.53), 1.963 (0.75), 1.972 (0.54), 1.982 (1.12), 1.995 (1.05), 2.004 (0.60), 2.010 (0.87), 2.016 (0.65), 2.024 (0.42), 3.038 (0.53), 3.043 (0.43), 3.063 (0.48), 3.072 (0.41), 3.610 (16.00), 7.239 (2.33), 7.244 (0.97), 7.255 (1.23), 7.260 (4.47), 7.311 (3.59), 7.331 (2.01), 7.474 (2.43), 7.478 (3.07), 7.491 (2.68), 7.495 (2.30), 7.553 (0.71), 7.557 (1.23), 7.561 (0.67), 7.576 (0.75), 7.580 (1.00), 7.584 (0.67).
(1474) Intermediate 222
4-(2,2-Difluorocyclopropyl)-4-Fluoro[1,1-Biphenyl]-2-Carboxylicacid (Racemic Mixture)
(1475) ##STR00257##
(1476) To a solution of methyl 4-(2,2-difluorocyclopropyl)-4-fluoro[1,1-biphenyl]-2-carboxylate (33.6 mg, 110 mol) in THF (4 ml) and methanol (200 l) was added lithium hydroxide (270 l, 2.0 M, 550 mol) and the mixture was stirred at 60 C. over night. Lithium hydroxide (270 l, 2.0 M, 550 mol) was added 3 times and the mixture was stirred for additional 6.6 hours. The reaction was cooled to room temperature and acidified with excess 2N aqueous hydrochloric acid and evaporated. Purification was done (together with the saponified product from the previous step) by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated. 98.2 mg (97% purity) of the title compound were obtained.
(1477) LC-MS (Method 7): R.sub.t=1.87 min; MS (ESIneg): m/z=291 [MH].sup.
(1478) Intermediate 223
Methyl 4-(2,2-Difluorocyclopropyl)-5-Fluoro[1,1-Biphenyl]-2-Carboxylate (Racemic Mixture)
(1479) ##STR00258##
(1480) To a suspension of methyl 4-fluoro-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (173 mg, 618 mol) and 1-bromo-4-(2,2-difluorocyclopropyl)benzene (180 mg, 772 mol) in 1,2-dimethoxyethane (3.0 ml) was added under argon a 2 M solution sodium carbonate in water (1.5 ml, 2.0 M, 3.1 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (35.8 mg, 30.9 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with 1 N sodium hydroxide solution, dried, filtered and evaporated. Purification was done by flash chromatography (heptane:ethyl acetate gradient). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 72.9 mg (100% purity, 39% yield) of the title compound were obtained.
(1481) The aqueous phase was acidified (pH 1-2) with hydrochloric acid and extracted with dichloromethane. The combined organic layers were washed with brine, dried, filtered and evaporated. The crude material 47 mg (saponified product of this step) was purified together with the material described in the next step.
(1482) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.61), 0.008 (0.66), 1.962 (0.54), 1.974 (0.65), 1.984 (0.59), 1.990 (1.13), 1.995 (0.64), 2.000 (0.75), 2.006 (0.62), 2.016 (1.13), 2.030 (0.53), 3.046 (0.59), 3.052 (0.43), 3.073 (0.47), 3.082 (0.42), 3.589 (16.00), 7.273 (1.90), 7.278 (0.95), 7.282 (1.15), 7.289 (2.50), 7.294 (5.08), 7.307 (1.10), 7.313 (1.80), 7.323 (4.14), 7.332 (1.76), 7.339 (1.84), 7.344 (1.79), 7.353 (0.86), 7.360 (0.65), 7.814 (1.11), 7.829 (1.14), 7.836 (1.11), 7.850 (1.04).
(1483) Intermediate 224
4-(2,2-Difluorocyclopropyl)-5-Fluoro[1,1-Biphenyl]-2-Carboxylic Acid (Racemic Mixture)
(1484) ##STR00259##
(1485) To a solution of methyl 4-(2,2-difluorocyclopropyl)-5-fluoro[1,1-biphenyl]-2-carboxylate (70.4 mg, 230 mol) in THF (2.0 ml) and methanol (400 l) was added lithium hydroxide (570 l, 2.0 M, 1.1 mmol) and the mixture was stirred at 60 C. over night. Lithium hydroxide (570 l, 2.0 M, 1.1 mmol) was added and the mixture was stirred for 5.5 hours at 60 C. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and the mixture evaporated. Purification was done (together with the saponified product from the previous step) by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated. 85.5 mg (100% purity) of the title compound were obtained.
(1486) LC-MS (Method 7): R.sub.t=1.88 min; MS (ESIneg): m/z=291 [MH].sup.
(1487) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.960 (0.44), 1.971 (0.43), 1.981 (0.71), 1.995 (0.60), 2.002 (0.44), 2.012 (0.65), 3.039 (0.49), 7.215 (0.80), 7.222 (1.06), 7.240 (0.82), 7.246 (1.03), 7.269 (0.55), 7.275 (0.50), 7.290 (1.08), 7.297 (1.04), 7.311 (1.02), 7.319 (16.00), 7.795 (0.92), 7.810 (0.96), 7.817 (0.95), 7.832 (0.88), 12.814 (1.32).
(1488) Intermediate 225
Methyl 4-(2,2-Difluorocyclopropyl)-4,5-Difluoro[1,1-Biphenyl]-2-Carboxylate (Racemic Mixture)
(1489) ##STR00260##
(1490) To a suspension of methyl 4,5-difluoro-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (184 mg, 618 mol) and 1-bromo-4-(2,2-difluorocyclopropyl)benzene (180 mg, 772 mol) in 1,2-dimethoxyethane (3.0 ml) was added under argon a 2 M solution sodium carbonate in water (1.5 ml, 2.0 M, 3.1 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (35.8 mg, 30.9 mol). The mixture was stirred over night at 90 C. Water (5 ml) was added at room temperature and the reaction was extracted with ethyl acetate (three times). The combined organic layers were washed with 1 N sodium hydroxide solution, dried, filtered and evaporated. Purification was done by flash chromatography (heptane:ethyl acetate gradient). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 50.1 mg (100% purity, 25% yield) of the title compound were obtained.
(1491) The aqueous phase was acidified (pH 1-2) with hydrochloric acid and extracted with dichloromethane. The combined organic layers were washed with brine, dried, filtered and evaporated. The crude material 71 mg (saponified product of this step) was purified together with the material described in the next step.
(1492) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.52), 0.008 (0.59), 1.962 (0.58), 1.970 (0.60), 1.974 (0.68), 1.984 (0.67), 1.990 (1.24), 1.995 (0.73), 1.999 (0.89), 2.006 (0.67), 2.016 (1.35), 2.029 (0.70), 2.045 (0.45), 3.018 (0.41), 3.044 (0.67), 3.051 (0.48), 3.071 (0.53), 3.080 (0.47), 3.604 (16.00), 7.262 (2.27), 7.283 (4.96), 7.321 (4.24), 7.341 (2.07), 7.548 (0.94), 7.568 (1.03), 7.577 (1.02), 7.596 (0.98), 7.824 (0.84), 7.844 (0.91), 7.851 (0.93), 7.871 (0.88).
(1493) Intermediate 226
4-(2,2-Difluorocyclopropyl)-4,5-Difluoro[1,1-Biphenyl]-2-Carboxylicacid (Racemic Mixture)
(1494) ##STR00261##
(1495) To a solution of methyl 4-(2,2-difluorocyclopropyl)-4,5-difluoro[1,1-biphenyl]-2-carboxylate (47.6 mg, 147 mol) in THF (1.5 ml) and methanol (300 l) was added lithium hydroxide (370 l, 2.0 M, 730 mol) and the mixture was stirred at 60 C. over night. Lithium hydroxide (370 l, 2.0 M, 730 mol) was added and the mixture was stirred for 5.5 hours at 60 C. The reaction was cooled to room temperature and was acidified with excess 2N aqueous hydrochloric acid and the mixture was evaporated. Purification was done (together with the saponified product from the previous step) by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated. 84.4 mg (98% purity) of the title compound were obtained.
(1496) LC-MS (Method 7): R.sub.t=1.95 min; MS (ESIneg): m/z=309 [MH].sup.
(1497) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.45), 1.091 (0.56), 1.950 (0.49), 1.961 (0.57), 1.965 (0.52), 1.971 (0.52), 1.982 (1.06), 1.994 (0.96), 2.003 (0.56), 2.011 (0.81), 2.014 (0.70), 3.037 (0.57), 3.042 (0.48), 3.063 (0.50), 3.071 (0.46), 7.312 (16.00), 7.478 (0.80), 7.498 (0.90), 7.507 (0.89), 7.526 (0.86), 7.776 (0.76), 7.796 (0.85), 7.803 (0.86), 7.823 (0.81), 13.110 (1.15).
(1498) Intermediate 227
Methyl 5,6-Dimethyl-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylate
(1499) ##STR00262##
(1500) To a suspension of [4-(trifluoromethyl)phenyl]boronic acid (300 mg, 1.58 mmol) and methyl 2-bromo-3,4-dimethylbenzoate (480 mg, 1.97 mmol) in DMF (7.7 ml) was added under argon a 2 M solution sodiumcarbonat in water (3.9 ml, 2.0 M, 7.9 mmol) and tetrakis(triphenylphosphine)palladium(0) [Pd(PPh.sub.3).sub.4] (91.6 mg, 79.0 mol). The mixture was stirred over night at 90 C. Ethylacetate was added at room temperature and the mixture was washed with water, 1 M Sodiumhydroxid solution and brine. The organic layer were dried, filtered and evaporated Purification was done by flash chromatography (n-hexane: ethyl acetate gradient). Product containing samples were united, the solvents were evaporated. 338 mg (81% purity, 56% yield) of the title compound were obtained.
(1501) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.906 (9.66), 2.279 (0.47), 2.287 (0.48), 2.347 (9.43), 2.358 (5.55), 2.370 (5.72), 3.268 (0.40), 3.471 (16.00), 3.822 (0.99), 3.829 (9.56), 7.262 (0.69), 7.275 (0.91), 7.324 (2.12), 7.337 (2.25), 7.345 (1.45), 7.358 (1.57), 7.364 (1.03), 7.377 (0.76), 7.614 (1.71), 7.627 (1.54), 7.748 (2.33), 7.762 (2.19).
(1502) Intermediate 228
5,6-Dimethyl-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1503) ##STR00263##
(1504) To a solution of methyl 5,6-dimethyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylate (218 mg, 81% purity, 573 mol) in THF (5.2 ml) and [X.sup.3] was added Lithiumhydroxide (1.4 ml, 2.0 M, 2.9 mmol) and the mixture was stirred at room temperature over night. Lithiumhydroxide (1.4 ml, 2.0 M, 2.9 mmol) was added and the mixture was stirred at 60 C. over night. The mixture was diluted with water and was acidified with excess 2N aqueous hydrochloric acid. The mixture was extracted with ethyl acetate and the combined organic layers were washed with brine, dried, filtered and evaporated. The crude product was suspended in water and filtered. The residue was dired to give 171 mg (90% purity, 92% yield) of the title compound without further purification.
(1505) LC-MS (Method 7): R.sub.t=2.15 min, MS (ESIneg): m/z=293 [MH].sup.
(1506) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.171 (1.25), 1.888 (16.00), 1.905 (1.58), 2.332 (15.44), 2.346 (1.77), 3.470 (2.13), 7.308 (2.46), 7.321 (2.91), 7.334 (4.04), 7.347 (4.11), 7.584 (2.93), 7.597 (2.68), 7.734 (4.16), 7.748 (4.30), 7.761 (0.43), 12.365 (0.57).
(1507) Intermediate 229
Ethyl 5-Isopropyl-1,3-Oxazole-4-Carboxylate
(1508) ##STR00264##
(1509) A solution of 2.47 mL (26.67 mmol) of 2-methylpropanoic acid and 5.19 g (32.00 mmol) of 1,1-carbonyldiimidazole in 30 mL of tetrahydrofuran was stirred for 3 hours at room temperature. After that time, a solution of 3.21 mL (29.34 mmol) of ethyl isocyanoacetate in 35 mL of tetrahydrofuran and a solution of 26.67 mL (26.67 mmol) of 1 M lithium bis(trimethylsilyl)amide in tetrahydrofuran were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 16 hours. The reaction was concentrated in vacuo and extracted with ethyl acetate, the combined organic layers were filtered over magnesium sulfate and concentrated. The resulting residue was purified by flash chromatography on silica gel eluting with heptane/dichloromethane mixtures to give 2.26 g (46%) of the product as a brown oil.
(1510) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=1.23 (d, 6H), 3.62-3.75 (m, 1H), 4.26 (q, 2H), 8.34 (s, 1H).
(1511) LC-MS (Method 3): R.sub.t=0.708 min. MS (Mass method 1): m/z=184 (M+H).sup.+
(1512) Intermediate 230
Tert-Butyl (3-Methyl-2-Oxobutyl)Carbamate
(1513) ##STR00265##
(1514) 2.26 g (12.39 mmol) of ethyl 5-isopropyl-1,3-oxazole-4-carboxylate was suspended in 40 mL of 6N hydrochloric acid (aq.) and the mixture was refluxed for 12 hours. Concentration of the reaction under reduced pressure gave 1.69 g (99%) of the intermediate amino ketone hydrochloride as a brown oil. A solution of 1.69 g (12.28 mmol) of the latter compound and 3.10 mL (13.51 mmol) of di-tert-butyl dicarbonate were dissolved in 30 mL of dichloromethane and 4.28 mL (30.70 mmol) of triethylamine was added, allowing the mixture to stir at room temperature for 12 hours. The crude was diluted with ethyl acetate, washed with water, dried over magnesium sulfate, filtered and concentrated under vacuum. The resulting residue was purified by flash chromatography on silica gel eluting with heptane/ethyl acetate mixtures to provide 1.96 g (79%) of the product as an oil.
(1515) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.99 (d, 6H), 1.37 (s, 9H), 2.59-2.73 (m, 1H), 3.82 (d, 2H), 6.96 (t, 1H).
(1516) LC-MS (Method 3): R.sub.t=0.739 min. MS (Mass method 1): m/z=224 (M+Na)+
(1517) Intermediate 231
Tert-Butyl [(Rac-4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]Carbamate
(1518) ##STR00266##
(1519) A solution of 1.93 g (9.59 mmol) of tert-butyl (3-methyl-2-oxobutyl)carbamate in 15 mL of ethanol was added to a solution of 1.25 g (19.18 mmol) of potassium cyanide and 9.21 g (95.89 mmol) of ammonium carbonate in 15 mL of water into a pressure flask, the container was sealed and the mixture was stirred at 60 C. for 24 hours. After that time, the solvent was partially removed and the resulting precipitate was filtered off to give 1.74 g (67%) of the product as a withe solid.
(1520) The compound was used as such in the next step.
(1521) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.79 (d, 3H), 0.87 (d, 3H), 1.36 (s, 9H), 1.82-1.95 (m, 1H), 3.12-3.30 (m, 2H), 6.70 (bp, 1H), 7.38 (s, 1H), 10.53 (s, 1H).
(1522) LC-MS (Method 3): R.sub.t=0.489 min. MS (Mass method 1): m/z=216 (Mt-Bu+H).sup.+
(1523) Intermediate 232
Ent-Tert-Butyl [(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]Carbamate
(1524) ##STR00267##
(1525) The reaction was performed in 2 batches. A) To a solution of tert-Butyl (3-methyl-2-oxobutyl)carbamate (4.63 g, 23.0 mmol) in methanol (30 ml) was added potassium cyanide (5.99 g, 92.0 mmol) and ammonium carbonate (8.84 g, 92.0 mmol) at RT. The reaction mixture was heated up to 80 C. overnight into a sealed pressure flask. After filtration at RT, the filtrate was concentrated in vacuo (Batch 1) B) To a solution of tert-Butyl (3-methyl-2-oxobutyl)carbamate (1.52 g, 7.55 mmol) in methanol (10 ml) was added potassium cyanide (1.97 g, 30.21 mmol) and ammonium carbonate (2.90 g, 30.21 mmol) at RT. The reaction mixture was heated up to 80 C. overnight into a sealed pressure flask. After filtration at RT, the filtrate was concentrated in vacuo (Batch 2)
(1526) The combined crude product (batch1+2) was purified by preparative chiral SFC [sample preparation: 13.36 g dissolved in 250 ml MeOH; column: Chiralpak AD SFC 20 m 36050 mm; eluent: 70% carbon dioxide/30% methanol; injection volume: 5 ml; flow rate: 400 ml/min; temperature: 35 C.; UV detection: 210 nm] afforded 3.03 g (100% purity) of the desired product.
(1527) Analytical chiral SFC: Analytical chiral SFC: R.sub.t=2.27 min, e.e.=>99% [column: Chiralpak AD-3; eluent: carbon dioxide/methanol (5%.fwdarw.50% MeOH); flow rate: 3 ml/min; UV detection: 210 nm]
(1528) LC-MS (Method 7): R.sub.t=1.10 min; MS (ESIneg): m/z=270 [MH].sup.
(1529) .sup.1H NMR (600 MHz, DMSO-d.sub.6) ppm 10.52 (bs, 1H), 7.57 (s, 1H), 6.66 (brs, 1H), 3.13-3.32 (m, 2H), 1.82-1.95 (m, 1H), 1.36 (s, 9H), 0.73-0.91 (m, 6H)
(1530) Intermediate 233
Rac-5-(Aminomethyl)-5-Isopropylimidazolidine-2,4-Dione Hydrochloride
(1531) ##STR00268##
(1532) 1.74 g (6.41 mmol) of tert-butyl [(rac-4-isopropyl-2,5-dioxoimidazolidin-4-yl)methyl] carbamate was dissolved in 20 mL of dichloromethane and 8.02 mL (32.06 mmol) of 4M hydrochloric acid in dioxane were added and the resulting suspension was stirred at room temperature for 12 hours. After that time, the solvent was in vacuo to give 1.10 g (83%) of the product a solid. The compound was used as such in the next step.
(1533) LC-MS (Method 3): R.sub.t=0.125 min. MS (Mass method 1): m/z=172 (M+H).sup.+
(1534) Intermediate 234
Ent-5-(Aminomethyl)-5-Isopropylimidazolidine-2,4-Dione Hydrochloride
(1535) ##STR00269##
(1536) To a solution of ent-tert-butyl [(4-isopropyl-2,5-dioxoimidazolidin-4-yl)methyl]carbamate (3.03 g, 11.2 mmol) in dichloromethane (60 ml) were added 14 ml of 4M hydrochloric acid (56 mmol) in dioxane. The reaction mixture was stirred overnight at room temperature. The precipitate was filtered off, washed with dichloromethane, and then dissolved in water. After lyophilisation, 2.94 g of the title compound was obtained and used without further purification.
(1537) LC-MS (Method 9): R.sub.t=0.28 min; MS (ESIpos): m/z=172 [MHCl+H].sup.+
(1538) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.844 (4.80), 0.855 (4.96), 0.895 (4.80), 0.907 (4.97), 1.998 (0.72), 2.009 (0.96), 2.020 (0.71), 3.026 (0.61), 3.092 (0.61), 3.114 (0.40), 3.568 (16.00), 8.046 (1.80), 8.279 (1.55), 10.945 (1.34).
(1539) Intermediate 235
2-Bromo-1-Cyclobutylethan-1-One
(1540) ##STR00270##
(1541) 1.31 mL (25.47 mmol) of bromine were added drop wise to a solution of 2.50 g (25.47 mmol) of cyclobutyl methyl ketone in 25 mL of methanol at 0 C. and the solution was then stirred for 1 hour under the same conditions. The solvent was removed under vacuum and the mixture was partitioned between ethyl acetate and water. The organic layer was isolated, dried over magnesium sulfate, filtered and concentrated to afford 3.80 g (84%) of the product as a dark oil.
(1542) The compound was used as such in the next step.
(1543) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm] 1.62-1.81 (m, 1H), 1.84-2.02 (m, 1H), 2.05-2.20 (m, 4H), 3.42-3.58 (m, 1H), 4.51 (s, 2H).
(1544) LC-MS (Method 1): R.sub.t=2.665 min. MS (Mass method 1): m/z=no ionisation.
(1545) Intermediate 236
2-Azido-1-Cyclobutylethan-1-One
(1546) ##STR00271##
(1547) 0.75 g (4.24 mmol) of 2-bromo-1-cyclobutylethan-1-one were added to a suspension of 0.36 g (5.51 mmol) of sodium azide in 20 mL of acetone and the mixture was stirred at room temperature for 16 hours. The resulting precipitate was filtered and the filtrate concentrated to give 0.43 g (73%) of the product as a pale orange oil. The compound was used as such in the next step.
(1548) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=01.68-1.83 (m, 1H), 1.84-2.01 (m, 1H), 2.02-2.22 (m, 4H), 3.22-3.32 (m, 1H), 4.17 (, 1H).
(1549) LC-MS (Method 3): R.sub.t=0.570 min. MS (Mass method 1): m/z=no ionisation.
(1550) Intermediate 237
Rac-5-(Azidomethyl)-5-Cyclobutylimidazolidine-2,4-Dione
(1551) ##STR00272##
(1552) A solution of 0.43 g (3.10 mmol) of 2-azido-1-cyclobutylethan-1-one in 5 mL of ethanol was added to a solution of 0.41 g (6.21 mmol) of potassium cyanide and 2.98 g (31.00 mmol) of ammonium carbonate in 5 mL water into a pressure flask. The container was sealed and the mixture was stirred at 60 C. for 12 hours. The ethanolic fraction was removed under reduced pressure and the mixture was extracted with ethyl acetate. The combined organic extracts were dried over magnesium sulfate, filtered and concentrated and the resulting precipitate was filtered off, washed with dichloromethane and dried in vacuo to give 0.23 g (35%) of the product as an orange solid.
(1553) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=1.58-1.95 (m, 6H), 2.52-2.65 (m, 1H), 3.39 (s, 2H), 8.26 (s, 1H), 10.76 (bp, 1H).
(1554) Intermediate 238
Rac-5-(Aminomethyl)-5-Cyclobutylimidazolidine-2,4-Dione
(1555) ##STR00273##
(1556) 230 mg (1.10 mmol) of rac-5-(azidomethyl)-5-cyclobutylimidazolidine-2,4-dione were dissolved in 15 mL of methanol in a round-bottom flask with a stirrer then the system was purged with nitrogen. 23 mg (0.22 mmol) of palladium on carbon (Degussa type, 10% loading, wet basis) was added the mixture was stirred at room temperature under hydrogen atmosphere for 12 hours. The black suspension was filtered through a pad of celite and the filtrates were concentrated to afford a pale-orange solid, which was washed with dichloromethane/methanol (9:1) give 180 mg (90%) of the product as white crystals.
(1557) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=1.59-1.91 (m, 6H), 2.53-2.59 (m, 1H), 2.64 (d, 2H), 7.82 (s, 1H), 10.51 (bp, 1H).
(1558) LC-MS (Method 3): R.sub.t=0.119 min. MS (Mass method 1): m/z=184 (M+H).sup.+
(1559) Intermediate 239
Rac-Tert-Butyl [(4-Cyclobutyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]Carbamate
(1560) ##STR00274##
(1561) rac-5-(aminomethyl)-5-cyclobutylimidazolidine-2,4-dione-hydrogen chloride (1.00 g, 4.55 mmol) was dissolved in 10 ml of THE and cooled at 0 C. At this temperature triethylamine (1.9 ml, 14 mmol), 4-(dimethylamino)pyridine (83.4 mg, 683 mol) and di-tert-butyl dicarbonate (1.04 g, 4.78 mmol) were added and the mixture was stirred over night at room temperature. The reaction was then diluted in ethyl acetate and washed twice with water and once with brine. The organic layer was dried over sodium sulfate, filtered and evaporated. The residue was put on Isolute and purified by chromatography on silica gel (25 g Ultra Snap Cartridge Biotage; Biotage-Isolera-One; DCM/MeOH-gradient: 2% MeOH-20% MeOH; flow: 75 ml/min). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 247 mg (100% purity, 19% yield) of the title compound were obtained.
(1562) LC-MS (Method 9): R.sub.t=0.91 min; MS (ESIneg): m/z=282 [MH].sup.
(1563) Intermediate 240
Ent-Tert-Butyl [(4-Cyclobutyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]Carbamate
(1564) ##STR00275##
(1565) Enantiomeric separation of rac-tert-butyl [(4-cyclobutyl-2,5-dioxoimidazolidin-4 yl)methyl]carbamate (245 mg, 865 mol) using the following method Column: Maisch Diacel AD-H 5 m 250*25 mm Eluent A: 80% CO.sub.2, eluent B: 20% methanol Flow: 80 ml/min UV-detection: 210 nm Temperature: 40 C.
(1566) afforded 92.9 mg (100% purity, 38% yield) of the desired product.
(1567) Chiral-HPLC (Method Info: AD-15 MeOH, 3.0 ml/min, 210 nm, 10 min, 5 l): R.sub.t=1.87 min; 98% ee
(1568) LC-MS (Method 7): R.sub.t=1.25 min; MS (ESIneg): m/z=282 [MH].sup.
(1569) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.60), 0.008 (0.54), 1.364 (16.00), 1.867 (0.41), 3.085 (0.49), 7.724 (0.80), 10.536 (0.51).
(1570) Intermediate 241
Ent-5-(Aminomethyl)-5-Cyclobutylimidazolidine-2,4-Dione Hydrochloride
(1571) ##STR00276##
(1572) ent-tert-butyl [(4-cyclobutyl-2,5-dioxoimidazolidin-4-yl)methyl]carbamate (92.0 mg, 325 mol) was dissolved in 1.5 ml of dichloromethane. 4 M hydrochloric acid in 1,4-dioxane (410 l, 4.0 M, 1.6 mmol) was added and the mixture was stirred over night at room temperature. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 73.0 mg (100% purity, 102% yield) of the title compound were obtained.
(1573) LC-MS (Method 9): R.sub.t=0.36 min; MS (ESIpos): m/z=184 [MHCl+H].sup.+
(1574) Intermediate 242
Tert-Butyl [2-(1-Methyl-1H-Imidazol-2-Yl)-2-Oxoethyl]Carbamate
(1575) ##STR00277##
(1576) A solution of 2.70 mL (6.70 mmol) of 2.5M n-butyllithium in hexanes was added to a solution of 0.49 mL (6.10 mmol) of 1-methyl-1H-imidazole in 10 mL of anhydrous tetrahydrofuran under nitrogen atmosphere at 0 C. over 5 min and the resulting yellow solution was stirred under these conditions for 10 min. After that, the lithiated imidazole solution was transferred to a solution of 1.46 g (6.70 mmol) of tert-butyl {2-[methoxy(methyl)amino]-2-oxoethyl}carbamate at 78 C. over 15 min and the corresponding solution was further stirred for 1 hour under the same conditions. After that time, the solution was taken out of the cooling bath and it was stirred for 15 min while warming up to room temperature. The mixture was quenched with 5 mL of a 1 M solution of hydrochloric acid (aq.), stirred for 5 min, and 5 mL of brine and 5 mL of saturated hydrogencarbonate (aq.) were added. The resulting mixture was transferred to a separatory funnel and extracted with ethyl acetate. The organic layer was dried over magnesium sulfate, filtered and evaporated to dryness to give 0.70 g (48%) of the product as a pale orange oil. The compound was pure enough to be used as such without further purification.
(1577) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=1.39 (s, 9H), 3.91 (s, 3H), 4.40 (d, 2H), 6.99 (t, 1H), 7.11 (s, 1H), 7.52 (s, 1H).
(1578) LC-MS (Method 3): R.sub.t=0.546 min. MS (Mass method 1): m/z=240 (M+H).sup.+
(1579) Intermediate 243
Rac-Tert-Butyl {[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1580) ##STR00278##
(1581) To a stirring solution of 4.22 g (43.90 mmol) of ammonium carbonate and 0.63 g (11.70 mmol) of ammonium chloride in 10 mL of water was added 0.70 g (2.93 mmol) of tert-butyl [2-(1-methyl-1H-imidazol-2-yl)-2-oxoethyl]carbamate in 10 mL of ethanol. After 15 min, 0.86 g (13.20 mmol) of potassium cyanide were added and the mixture was heated up to 60 C. for 16 hours into a sealed pressure flask. The yellow solution was concentrated until only a small fraction of water remained (a white precipitate appeared). Then, more water was added and the suspension was allowed to stand at 0 C. for 2 hour. After that time, the resulting solid was filtered off and washed with cold water and diethyl ether to give 0.90 g (98%) of the product as an off-white powder. The compound was used as such in the next step.
(1582) LC-MS (Method 3): R.sub.t=0.253 min. MS (Mass method 1): m/z=310 (M+H).sup.+
(1583) Intermediate 244
Rac-5-(Aminomethyl)-5-(1-Methyl-1H-Imidazol-2-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1584) ##STR00279##
(1585) 3.60 mL (15.00 mmol) of 4N hydrochloric acid in dioxane were added to a solution of 0.90 g (2.91 mmol) of rac-tert-Butyl {[4-(1-methyl-1H-imidazol-2-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate in 20 mL of dichloromethane and the mixture was allowed to stir at room temperature for 16 hours. The resulting precipitate was collected by filtration and washed with dichloromethane, ethyl acetate and diethyl ether to give 0.71 g (99%) of the product as a white solid. The compound was used as such in the next step.
(1586) LC-MS (Method 3): R.sub.t=0.089 min. MS (Mass method 1): m/z=157 (M+H).sup.+
(1587) Intermediate 245
Ent-Tert-Butyl {[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1588) ##STR00280##
(1589) To a solution of tert-butyl [2-(1-methyl-1H-imidazol-2-yl)-2-oxoethyl]carbamate (4.96 g, 20.7 mmol, Example 3d in J: Med. Chem. 2014, 57, 10476-10485) in a mixture of Ethanol (30 ml) and water (12 ml) was added potassium cyanide (5.40 g, 82.9 mmol) and ammonium carbonate (7.97 g, 82.9 mmol) at RT. The reaction mixture was heated up to 80 C. for 2 days into a sealed pressure flask. The resulting mixture was diluted with water, partially concentrated in vacuo and filtered. The resulting filtrate was concentrated in vacuo and 10.78 g of the crude product were isolated. 9.3 g of this crude product were suspended in ethanol and the residue was filtered off and washed 3 times with ethanol. The combined filtrate was concentrated in vacuo and the resulting product was purified by preparative chiral SFC (sample preparation: 7.3 g dissolved in a mixture of methanol and acetonitrile; column: ChirapakAD-H (SFC) 5 m, 25030 mm; eluent: carbon dioxide/methanol 78:22; flow rate: 125 ml/min; temperature: 40 C.; UV detection: 210 nm). 2 g (6.47 mmol) of the desired product was obtained
(1590) Analytical chiral SFC: R.sub.t=1.70 min, e.e. =99%[column: AD 3 m, 1004.6 mm; eluent: carbon dioxide/methanol 80:20; flow rate: 3 ml/min; temperature: 40 C.; UV detection: 210 nm]
(1591) .sup.1H NMR (600 MHz, DMSO-d.sub.6) ppm 11.09 (bs, 1H), 8.16 (s, 1H), 7.20 (s, 1H), 6.67-6.95 (m, 2H), 3.73-3.91 (m, 2H), 3.49 (s, 3H), 1.37 (s, 9H)
(1592) The title compound can also be synthesized via the procedure described in J: Med. Chem. 2014, 57, 10476-10485
(1593) Intermediate 246
Ent-5-(Aminomethyl)-5-(1-Methyl-1H-Imidazol-2-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1594) ##STR00281##
(1595) To a solution of ent-tert-butyl {[4-(1-methyl-1H-imidazol-2-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (2.00 g, 6.46 mmol) in methanol (46 ml) were added 16 ml (65 mmol) of 4M hydrochloric acid in dioxane at 0 C. The resulting suspension was stirred overnight at room temperature. After filtration, the filtrate was concentrated in vacuo (1.23 g of the title compound) and the remaining residue was washed twice with methanol and dried under vacuum (0.41 g of of the title compound). Both fractions were used in the next step without further purification.
(1596) LC-MS (Method 9): R.sub.t=0.23 min; MS (ESIpos): m/z=210 [MHCl+H].sup.+
(1597) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.389 (0.48), 2.428 (0.49), 3.061 (1.66), 3.166 (1.50), 3.296 (0.55), 3.388 (1.15), 3.494 (0.46), 3.510 (0.45), 3.666 (0.48), 3.677 (0.51), 3.702 (0.83), 3.738 (6.54), 3.782 (16.00), 3.846 (2.02), 3.895 (1.13), 3.910 (1.64), 3.924 (0.90), 3.929 (0.64), 3.988 (0.48), 4.021 (0.52), 4.050 (0.72), 4.080 (0.42), 4.119 (0.80), 4.129 (0.89), 4.160 (0.45), 4.259 (0.45), 4.697 (0.54), 7.250 (1.55), 7.322 (2.88), 7.335 (2.41), 7.419 (1.52), 7.545 (5.13), 7.729 (0.53), 7.776 (0.43), 8.699 (4.41), 9.125 (3.30), 11.735 (5.00).
(1598) Intermediate 247
Tert-Butyl [2-(1-Methyl-1H-Pyrazol-5-Yl)-2-Oxoethyl]Carbamate
(1599) ##STR00282##
(1600) To a solution of 2-amino-1-(2-methylpyrazol-3-yl)ethanone hydrochloride (3.00 g, 17.1 mmol) in dichloromethane (77 ml) was added di-tert-butyl dicarbonate (4.10 g, 18.8 mmol) and triethylamine (7.1 ml, 51 mmol). After 2 h of stirring at RT, the reaction mixture was diluted with dichloromethane and washed with water. The organic phase was dried, concentrated in vacuo and 4.40 g of the title compound was used without further purification.
(1601) LC-MS (Method 7): R.sub.t=1.47 min; MS (ESIpos): m/z=240 [M+H].sup.+
(1602) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.943 (0.60), 1.111 (3.12), 1.280 (0.80), 1.366 (0.51), 1.372 (0.47), 1.394 (16.00), 4.046 (6.83), 4.256 (1.81), 4.271 (1.81), 7.143 (0.56), 7.202 (1.19), 7.207 (1.20), 7.553 (1.30), 7.558 (1.32).
(1603) Intermediate 248
Rac-Tert-Butyl {[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1604) ##STR00283##
(1605) The reaction was performed in 2 batches.
(1606) A) To a solution of tert-butyl [2-(1-methyl-1H-pyrazol-5-yl)-2-oxoethyl]carbamate (2.00 g, 8.36 mmol) in methanol (15.3 ml) was added potassium cyanide (2.18 g, 33.4 mmol) and ammonium carbonate (3.21 g, 33.4 mmol) at RT. The reaction mixture was heated up to 80 C. overnight into a sealed pressure flask. After filtration at RT, the filtrate was concentrated in vacuo and the crude was suspended in methanol. The suspension was filtered off and the resulting filtrate was concentrated in vacuo. (Batch 1)
(1607) B) To a solution of tert-butyl [2-(1-methyl-1H-pyrazol-5-yl)-2-oxoethyl]carbamate (2.00 g, 8.36 mmol) in a mixture of Ethanol (15 ml) and water (6 ml) was added potassium cyanide (2.18 g, 33.4 mmol) and ammonium carbonate (3.21 g, 33.4 mmol) at RT. The reaction mixture was heated up to 40 C. overnight into a sealed pressure flask. After filtration at RT, the resulting filtrate was concentrated in vacuo. (Batch 2)
(1608) The combined crude product (batch1+2) was purified by preparative HPLC (sample preparation: 15 g dissolved in a mixture of acetonitrile, methanol and water; column: XBridge C18 5 m, 10030 mm; eluent: water.fwdarw.acetonitrile/water 80:20+1% ammonia solution.fwdarw.acetonitrile; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 220 nm). After lyophilisation, 1.8 g of the desired product was obtained and used without further purification.
(1609) LC-MS (Method 9): R.sub.t=0.36 min; MS (ESIpos): m/z=310 [M+H].sup.+
(1610) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.43), 0.008 (0.54), 1.359 (16.00), 1.754 (0.51), 3.524 (0.41), 3.540 (0.41), 3.693 (4.71), 6.230 (0.96), 7.250 (0.96).
(1611) The title compound can also be synthesized via the procedure described in J: Med. Chem. 2014, 57, 10476-10485
(1612) Intermediate 249
Ent-Tert-Butyl {[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1613) ##STR00284##
(1614) To a solution of tert-butyl [2-(1-methyl-1H-pyrazol-5-yl)-2-oxoethyl]carbamate (5.26 g, 22.0 mmol) in methanol (30 ml) was added potassium cyanide (5.73 g, 87.9 mmol) and ammonium carbonate (8.45 g, 87.9 mmol) at RT. The reaction mixture was stirred overnight at 80 C. into a sealed pressure flask. After filtration and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative chiral SFC (sample preparation: 11.9 g dissolved in methanol; column: Daicel Chiralpak AD-H 5 m, 25030 mm; eluent: carbon dioxide/methanol 80:20; flow rate: 140 ml/min; temperature: 40 C.; UV detection: 210 nm]. 2.22 g (95% purity, 6.77 mmol) of the desired product was obtained.
(1615) Analytical chiral SFC: R.sub.t=1.12 min, e.e. =99.1% [column: AD 3 m, 1004.6 mm; eluent: carbon dioxide/methanol 80:20; flow rate: 3 ml/min; UV detection: 210 nm]
(1616) LC-MS (Method 7): R.sub.t=0.95 min; MS (ESIpos): m/z=310 [M+H].sup.+
(1617) .sup.1H NMR (600 MHz, DMSO-d.sub.6) ppm 10.84-11.40 (m, 1H), 8.13 (brs, 1H), 7.36 (d, 1H), 6.98-7.12 (m, 1H), 6.43 (d, 1H), 3.77 (s, 3H), 3.63-3.71 (m, 2H), 1.37 (s, 9H)
(1618) Intermediate 250
Rac-5-(Aminomethyl)-5-(1-Methyl-1H-Pyrazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1619) ##STR00285##
(1620) To a solution of rac-tert-butyl {[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (520 mg, 1.68 mmol) in dichloromethane (14.5 ml) were added 2.1 ml (8.4 mmol) of 4M hydrochloric acid in dioxane at RT. The reaction mixture was stirred overnight and concentrated in vacuo. 400 mg of the title compound was used without further purification.
(1621) LC-MS (Method 9): R.sub.t=0.22 min; MS (ESIneg): m/z=208 [MHClH].sup.
(1622) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.767 (3.19), 2.119 (1.47), 2.390 (0.50), 3.166 (0.76), 3.463 (1.91), 3.473 (2.29), 3.485 (2.90), 3.494 (2.58), 3.590 (2.66), 3.598 (2.94), 3.612 (2.25), 3.620 (1.90), 3.725 (0.42), 4.091 (0.50), 5.692 (1.73), 6.501 (15.58), 6.504 (16.00), 7.358 (0.46), 7.425 (15.98), 7.428 (15.92), 8.608 (10.32), 8.873 (12.22), 11.515 (9.95).
(1623) The title compound can also be synthesized via the procedure described in J: Med. Chem. 2014, 57, 10476-10485
(1624) Intermediate 251
Ent-5-(Aminomethyl)-5-(1-Methyl-1H-Pyrazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1625) ##STR00286##
(1626) To a solution of ent-tert-butyl {[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (2.20 g, 95% purity, 6.77 mmol) in dichloromethane (50 ml) were added 8.5 ml of 4M hydrochloric acid (34 mmol) in dioxane. The reaction mixture was stirred overnight at room temperature. The precipitate was filtered off, washed with dichloromethane, and then dissolved in water. After lyophilisation, 2.08 g of the title compound was obtained and used without further purification.
(1627) LC-MS (Method 9): R.sub.t=0.23 min, MS (ESIpos): m/z=210 [MHCl+H].sup.+
(1628) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.46), 1.596 (2.01), 2.427 (0.43), 2.522 (1.00), 2.525 (0.92), 2.576 (0.48), 3.468 (1.65), 3.483 (2.12), 3.568 (5.57), 3.603 (2.18), 3.619 (1.70), 3.725 (0.46), 3.868 (0.53), 3.877 (0.57), 3.959 (0.52), 4.186 (2.08), 4.295 (12.82), 6.494 (15.83), 6.497 (16.00), 7.424 (15.71), 7.427 (15.45), 8.554 (7.39), 8.823 (9.72), 11.497 (7.28).
(1629) Intermediate 252
Ethyl 5-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]-1,3-Oxazole-4-Carboxylate
(1630) ##STR00287##
(1631) 1-(difluoromethyl)-1H-pyrazole-5-carboxylic acid (2.60 g, 16.0 mmol) dissolved in 25 ml of THE was treated with 1,1,-carbonyl-diimidazole (3.12 g, 19.2 mmol) and stirred at room temperature. After 2 h ethyl isocyanoacetate (1.9 ml, 18 mmol), dissolved in 25 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (16 ml, 1.0 M, 16 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred overnight and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried over sodium sulfate, filtered, Isolute was added and the solvent was evaporated on a rotary evaporator. The crude product was purified by column chromatography (100 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 10%.fwdarw.65%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 1.60 g (100% purity, 39% yield) of the title compound was obtained.
(1632) LC-MS (Method 7): R.sub.t=1.43 min; MS (ESIpos): m/z=258 [M+H].sup.+
(1633) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.173 (7.68), 1.191 (16.00), 1.209 (7.93), 4.212 (2.57), 4.230 (7.90), 4.247 (7.83), 4.265 (2.52), 7.086 (4.50), 7.090 (4.56), 7.709 (2.14), 7.851 (4.21), 7.994 (2.25), 8.000 (4.40), 8.004 (4.29), 8.759 (6.93).
(1634) Intermediate 253
2-Amino-1-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]Ethanone Hydrochloride
(1635) ##STR00288##
(1636) ethyl 5-[1-(difluoromethyl)-1H-pyrazol-5-yl]-1,3-oxazole-4-carboxylate (1.60 g, 6.22 mmol) was taken up in 35 ml of 6 N hydrochloric acid and stirred at 100 C. After 2 h the resulting mixture was concentrated in vacuo and the residue was treated with DCM and a small amount of methanol. The precipitate was filtered off and dried in vacuo. 1.10 g (84% yield) of the title compound was obtained.
(1637) LC-MS (Method 9): R.sub.t=0.74 min; MS (ESIpos): m/z=176 [MHCl+H].sup.+
(1638) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.091 (0.50), 1.109 (1.11), 1.127 (0.59), 2.328 (0.75), 2.367 (1.14), 2.670 (0.78), 2.711 (1.17), 4.421 (0.53), 4.492 (13.60), 7.583 (16.00), 7.587 (15.25), 7.957 (6.86), 8.047 (13.41), 8.102 (13.69), 8.248 (6.77), 8.418 (8.00).
(1639) Intermediate 254
Tert-Butyl {2-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]-2-Oxoethyl}Carbamate
(1640) ##STR00289##
(1641) To a solution of 2-amino-1-[1-(difluoromethyl)-1H-pyrazol-5-yl]ethanone hydrochloride (1.10 g, 5.20 mmol) in dichloromethane (23 ml) was added di-tert-butyl dicarbonate (1.25 g, 5.72 mmol) and triethylamine (3.6 ml, 26 mmol). After 2 h of stirring at RT, the reaction mixture was diluted with dichloromethane and washed with water. The organic phase was dried, concentrated in vacuo and 1.44 g of the title compound was used without further purification.
(1642) LC-MS (Method 7): R.sub.t=1.58 min; MS (ESIpos): m/z=276 [M+H].sup.+
(1643) Intermediate 255
Rac-Tert-Butyl({4-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)Carbamate
(1644) ##STR00290##
(1645) To a solution of tert-butyl {2-[1-(difluoromethyl)-1H-pyrazol-5-yl]-2-oxoethyl}carbamate (1.44 g, 5.23 mmol) in methanol (9.6 ml) was added potassium cyanide (1.36 g, 20.9 mmol) and ammonium carbonate (2.01 g, 20.9 mmol) at RT. The reaction mixture was stirred for 2 days at 60 C. into a sealed pressure flask. After filtration at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 3.9 g dissolved in a mixture of methanol, water, acetonitrile and ammonia; column: XBridge C18 5 m, 10030 mm; eluent: water.fwdarw.acetonitrile/water 80:20+1% ammonia solution.fwdarw.acetonitrile; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 220 nm). 699 mg of the desired product was obtained and used without further purification.
(1646) LC-MS (Method 7): R.sub.t=1.08 min; MS (ESIneg): m/z=344 [MH].sup.
(1647) Intermediate 256
Rac-5-(Aminomethyl)-5-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]Imidazolidine-2,4-Dione Hydrochloride
(1648) ##STR00291##
(1649) To a solution of rac-tert-butyl({4-[1-(difluoromethyl)-1H-pyrazol-5-yl]-2,5-dioxoimidazolidin-4 yl}methyl)carbamate (340 mg, 985 mol) in dichloromethane (8.5 ml) were added 1.2 ml (4.9 mmol) of 4M hydrochloric acid in dioxane at RT. The reaction mixture was stirred for 2 h and concentrated in vacuo. 280 mg (99% purity, 100% yield) of the title compound was used without further purification.
(1650) LC-MS (Method 9): R.sub.t=0.22 min; MS (ESIpos): m/z=246 [MHCl+H].sup.+
(1651) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.44), 0.008 (3.88), 0.008 (3.67), 0.146 (0.44), 1.110 (0.42), 1.596 (0.84), 1.754 (5.24), 2.111 (2.45), 2.324 (0.50), 2.329 (0.71), 2.333 (0.50), 2.367 (0.75), 2.524 (2.73), 2.666 (0.52), 2.671 (0.71), 2.675 (0.52), 2.711 (0.73), 3.457 (5.03), 3.491 (6.16), 3.568 (2.20), 3.689 (5.72), 3.723 (4.42), 5.756 (1.11), 6.811 (15.81), 6.816 (16.00), 7.820 (4.47), 7.835 (12.96), 7.839 (12.85), 7.960 (4.43), 7.969 (4.22), 8.109 (3.69), 8.504 (6.88), 8.825 (4.30), 11.497 (3.56).
(1652) Intermediate 257
Ethyl 5-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]-1,3-Oxazole-4-Carboxylate
(1653) ##STR00292##
(1654) 5-(trifluoromethyl)-1,3-thiazole-4-carboxylic acid (2.00 g, 10.1 mmol) dissolved in 15 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.97 g, 12.2 mmol) and stirred at room temperature. After 1 h ethyl isocyanoacetate (1.2 ml, 11 mmol), dissolved in 15 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (10 ml, 1.0 M, 10 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred over 2 days and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (100 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 8%.fwdarw.85%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 1.43 g (48% yield) of the title compound was obtained.
(1655) LC-MS (Method 7): R.sub.t=1.62 min; MS (ESIpos): m/z=293 [M+H].sup.+
(1656) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.086 (7.76), 1.104 (16.00), 1.122 (8.00), 4.148 (2.68), 4.166 (8.12), 4.184 (8.05), 4.201 (2.61), 8.780 (5.87), 9.570 (4.98).
(1657) Intermediate 258
2-Amino-1-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Ethanone Hydrochloride
(1658) ##STR00293##
(1659) ethyl 5-[5-(trifluoromethyl)-1,3-thiazol-4-yl]-1,3-oxazole-4-carboxylate (1.43 g, 4.89 mmol) was taken up in 200 ml of 6 N hydrochloric acid and stirred for 2 h at 100 C. After further stirring overnight at room temperature, the resulting mixture was concentrated in vacuo. 1.25 g (95% purity, 98% yield) of the title compound was obtained.
(1660) LC-MS (Method 9): R.sub.t=1.00 min; MS (ESIpos): m/z=211 [MHCl+H].sup.+
(1661) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.13), 0.008 (1.18), 4.571 (16.00), 8.411 (4.83), 9.517 (12.18).
(1662) Intermediate 259
Tert-Butyl {2-Oxo-2-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Ethyl}Carbamate
(1663) ##STR00294##
(1664) To a solution of 2-amino-1-[5-(trifluoromethyl)-1,3-thiazol-4-yl]ethanone hydrochloride (1.25 g, 5.07 mmol) in dichloromethane (23 ml) was added di-tert-butyl dicarbonate (1.22 g, 5.57 mmol) and triethylamine (3.5 ml, 25 mmol). After 2 h of stirring at RT, the reaction mixture was diluted with dichloromethane and washed with water. The organic phase was dried, concentrated in vacuo and 1.66 g of the title compound was used without further purification.
(1665) LC-MS (Method 9): R.sub.t=1.58 min; MS (ESIpos): m/z=310 [MH].sup.+
(1666) Intermediate 260
Rac-Tert-Butyl({2,5-Dioxo-4-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Imidazolidin-4-Yl}Methyl)Carbamate
(1667) ##STR00295##
(1668) To a solution of tert-butyl {2-oxo-2-[5-(trifluoromethyl)-1,3-thiazol-4-yl]ethyl}carbamate (800 mg, 2.58 mmol) in methanol (4.6 ml) was added potassium cyanide (672 mg, 10.3 mmol) and ammonium carbonate (991 mg, 10.3 mmol) at RT. The reaction mixture was stirred overnight at 60 C. into a sealed pressure flask. After filtration at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 473 mg dissolved in a mixture of methanol, water, acetonitrile and ammonia; column: XBridge C18 5 m, 10030 mm; eluent: water.fwdarw.acetonitrile/water 80:20+1% ammonia solution.fwdarw.acetonitrile; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 220 nm). 227 mg (100% purity, 23% yield) of the desired product was obtained and used without further purification.
(1669) LC-MS (Method 9): R.sub.t=0.76 min; MS (ESIneg): m/z=379 [MH].sup.
(1670) Intermediate 261
Rac-5-(Aminomethyl)-5-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Imidazolidine-2,4-Dione Hydrochloride
(1671) ##STR00296##
(1672) To a solution of rac-tert-butyl({2,5-dioxo-4-[5-(trifluoromethyl)-1,3-thiazol-4-yl]imidazolidin-4-yl}methyl)carbamate (485 mg, 1.28 mmol) in dichloromethane (20 ml) were added 1.2 ml (1.6 ml, 4.0 M, 6.4 mmol) of 4M hydrochloric acid in dioxane at RT. The reaction mixture was stirred overnight and concentrated in vacuo. 413 mg (95% purity, 97% yield) of the title compound was used without further purification.
(1673) LC-MS (Method 9): R.sub.t=0.29 min; MS (ESIpos): m/z=281 [MHCl+H].sup.+
(1674) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.97), 0.008 (0.91), 1.754 (10.12), 2.108 (3.70), 2.367 (0.43), 2.519 (1.81), 2.524 (1.46), 2.558 (0.54), 2.560 (0.45), 2.710 (0.41), 3.167 (16.00), 3.708 (3.29), 3.741 (2.54), 8.321 (2.94), 8.628 (1.96), 9.440 (7.56), 11.450 (3.19).
(1675) Intermediate 262
Tert-Butyl [2-Oxo-2-(1,3-Thiazol-2-Yl)Ethyl]Carbamate
(1676) ##STR00297##
(1677) Under argon, thiazole (3.6 ml, 51 mmol) was dissolved in THF (20 ml) and cooled in an acetonitrile/dry ice bath to 40 C. The solution was treated dropwise with n-butyllithium in hexane (20.3 ml, 2.5 M, 51 mmol). After 45 minutes at 35 C., a solution of tert-butyl {2-[methoxy(methyl)amino]-2-oxoethyl}carbamate (5.00 g, 22.9 mmol) in 30 ml of THE was added dropwise, while keeping the temperature below 40 C. After 2 h at 40 to 45 C., the reaction was quenched with 1 N citric acid (25 ml) and diluted with ethyl acetate. The layers were separated. The aqueous layer was extracted with ethyl acetate and the organic phases were combined, washed with brine, dried and concentrated under reduced pressure. The crude product was purified by column chromatography (100 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient: 25%.fwdarw.60%) to give. 3.04 g (98% purity, 24% yield) of the title compound.
(1678) LC-MS (Method 8): R.sub.t=0.78 min; MS (ESIpos): m/z=243 [M+H].sup.+
(1679) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 1.263 (0.77), 1.398 (16.00), 4.515 (1.84), 4.527 (1.80), 7.182 (0.52), 8.167 (1.36), 8.173 (1.47), 8.257 (1.73), 8.263 (1.52).
(1680) Intermediate 263
Rac-Tert-Butyl {[2,5-Dioxo-4-(1,3-Thiazol-2-Yl)Imidazolidin-4-Yl]Methyl}Carbamate
(1681) ##STR00298##
(1682) To a solution of tert-butyl [2-oxo-2-(1,3-thiazol-2-yl)ethyl]carbamate (3.04 g, 12.5 mmol) in methanol (20 ml) was added potassium cyanide (3.27 g, 50.2 mmol) and ammonium carbonate (4.82 g, 50.2 mmol) at RT. The reaction mixture was stirred overnight at 40 C. into a sealed pressure flask and then diluted with water. The resulting suspension was extracted with dichloromethane. After phase separation; the aqueous phase was concentrated under reduced pressure and the crude product was suspended in a mixture of 30 ml acetonitrile and 20 ml methanol. After filtration of the residue, the filtrate was concentrated in vacuo and 1.4 g of the desired product was obtained and used without further purification.
(1683) LC-MS (Method 7): R.sub.t=0.99 min; MS (ESIneg): m/z=311 [MH].sup.
(1684) The title compound can also be synthesized via the procedure described in J. Med. Chem. 2014, 57, 10476-10485.
(1685) Intermediate 264
Rac-5-(Aminomethyl)-5-(1,3-Thiazol-2-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1686) ##STR00299##
(1687) To a solution of rac-tert-butyl {[2,5-dioxo-4-(1,3-thiazol-2-yl)imidazolidin-4-yl]methyl}carbamate (1.40 g, 4.48 mmol) in methanol (28 ml) were added 22.4 ml (90 mmol) of 4M hydrochloric acid in dioxane at 0 C. After 1 h at 0 C., the reaction mixture was stirred overnight at RT and concentrated in vacuo. 1.30 g of the title compound was used without further purification.
(1688) LC-MS (Method 9): R.sub.t=0.26 min; MS (ESIneg): m/z=211 [MHClH].sup.
(1689) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (1.86), 1.234 (0.56), 1.246 (0.80), 1.596 (0.54), 1.759 (0.78), 2.387 (0.62), 2.426 (1.00), 2.655 (0.64), 2.887 (0.46), 3.167 (0.62), 3.462 (0.48), 3.472 (0.58), 3.492 (0.52), 3.502 (0.56), 3.527 (1.42), 3.537 (1.68), 3.550 (1.90), 3.559 (1.52), 3.667 (0.54), 3.676 (0.42), 3.704 (0.58), 3.713 (0.54), 3.722 (1.86), 3.754 (1.74), 3.763 (1.94), 3.776 (1.62), 3.785 (1.34), 3.917 (0.52), 5.084 (1.26), 7.183 (2.00), 7.268 (2.21), 7.352 (2.00), 7.774 (0.52), 7.780 (0.46), 7.881 (10.95), 7.886 (15.10), 7.909 (16.00), 7.914 (10.55), 8.484 (5.59), 9.120 (5.57), 11.420 (5.69).
(1690) The title compound can also be synthesized via the procedure described in J. Med. Chem. 2014, 57, 10476-10485.
(1691) Intermediate 265
Ethyl 5-(1,3-Thiazol-4-Yl)-1,3-Oxazole-4-Carboxylate
(1692) ##STR00300##
(1693) 1,3-thiazole-4-carboxylic acid (1.00 g, 7.74 mmol) dissolved in 12 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.51 g, 9.29 mmol) and stirred at room temperature. After 2 h, ethyl isocyanoacetate (930 l, 8.5 mmol), dissolved in 12 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (7.7 ml, 1.0 M, 7.7 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred overnight and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (100 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 15%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 783 mg (44% yield) of the title compound was used without further purification.
(1694) LC-MS (Method 8): R.sub.t=0.65 min; MS (ESIpos): m/z=225 [M+H].sup.+
(1695) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.291 (7.74), 1.302 (16.00), 1.314 (7.70), 4.313 (2.51), 4.325 (7.74), 4.337 (7.62), 4.349 (2.39), 8.580 (9.32), 8.744 (5.07), 8.747 (5.10), 9.273 (4.82), 9.276 (4.76).
(1696) Intermediate 266
2-Amino-1-(1,3-Thiazol-4-Yl)Ethanone Hydrochloride
(1697) ##STR00301##
(1698) ethyl 5-(1,3-thiazol-4-yl)-1,3-oxazole-4-carboxylate (782 mg, 3.49 mmol) was taken up in 19 ml of 6 N hydrochloric acid. After 2 h the resulting mixture was concentrated in vacuo and the residue was treated with DCM and a small amount of methanol. The precipitate was filtered off and dried in vacuo. 613 mg (98% yield) of the title compound was obtained and used without further purification
(1699) LC-MS (Method 9): R.sub.t=0.48 min; MS (ESIpos): m/z=143 [MHCl+H].sup.+
(1700) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.067 (4.56), 1.079 (9.66), 1.091 (4.71), 2.525 (0.47), 4.145 (1.10), 4.156 (3.13), 4.168 (3.10), 4.180 (1.18), 4.437 (4.70), 4.479 (5.69), 4.488 (11.43), 4.497 (11.15), 5.938 (1.13), 8.478 (5.26), 8.827 (15.55), 8.830 (16.00), 8.982 (3.87), 8.985 (4.11), 9.202 (1.56), 9.303 (15.03), 9.307 (15.02), 9.322 (4.08), 9.325 (4.09).
(1701) Intermediate 267
Tert-Butyl [2-Oxo-2-(1,3-Thiazol-4-Yl)Ethyl]Carbamate
(1702) ##STR00302##
(1703) To a solution of 2-amino-1-(1,3-thiazol-4-yl)ethanone hydrochloride (610 mg, 3.41 mmol) in dichloromethane (14 ml) was added di-tert-butyl dicarbonate (860 l, 3.8 mmol) and triethylamine (1.4 ml, 10 mmol). After 1.5 h of stirring at RT, the reaction mixture was concentrated under reduced pressure, diluted with ethylacetate and washed with water and brine. After phase separation, the organic phase was dried; concentrated in vacuo and 781 mg of the title compound was used without further purification.
(1704) LC-MS (Method 7): R.sub.t=1.33 min; MS (ESIpos): m/z=143 [MBoc+H]
(1705) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.42), 0.008 (0.42), 1.093 (0.66), 1.110 (0.45), 1.282 (0.71), 1.306 (0.40), 1.366 (0.48), 1.387 (2.15), 1.398 (14.02), 1.468 (16.00), 4.430 (1.68), 4.445 (1.65), 7.061 (0.46), 8.635 (0.72), 8.640 (0.78), 9.236 (0.92), 9.240 (0.90).
(1706) Intermediate 268
Rac-Tert-Butyl {[2,5-Dioxo-4-(1,3-Thiazol-4-Yl)Imidazolidin-4-Yl]Methyl}Carbamate
(1707) ##STR00303##
(1708) To a solution of tert-butyl [2-oxo-2-(1,3-thiazol-4-yl)ethyl]carbamate (781 mg, 3.22 mmol) in methanol (5.9 ml) was added potassium cyanide (840 mg, 12.9 mmol) and ammonium carbonate (1.24 g, 12.9 mmol) at RT. The reaction mixture was stirred for 2 days at 40 C. into a sealed pressure flask. After filtration at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (Method 2f). 283 mg of the desired product was obtained and used without further purification
(1709) LC-MS (Method 8): R.sub.t=0.63 min, MS (ESIneg): m/z=311 [MH].sup.
(1710) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.366 (16.00), 1.434 (0.81), 7.733 (1.28), 7.738 (1.32), 8.136 (0.77), 9.107 (0.96), 9.111 (0.97), 10.776 (0.53).
(1711) Intermediate 269
Rac-5-(Aminomethyl)-5-(1,3-Thiazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1712) ##STR00304##
(1713) To a solution of rac-tert-butyl {[2,5-dioxo-4-(1,3-thiazol-4-yl)imidazolidin-4-yl]methyl}carbamate (283 mg, 906 mol) in dichloromethane (7.8 ml) were added 1.1 ml of 4M hydrochloric acid in dioxane at RT. The reaction mixture was stirred for 4 h and concentrated in vacuo. 200 mg (84% yield) of the title compound was used without further purification.
(1714) LC-MS (Method 9): R.sub.t=0.24 min; MS (ESIpos): m/z=213 [MHCl+H].sup.+
(1715) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.08), 0.008 (2.39), 1.366 (1.42), 1.596 (1.40), 2.525 (0.83), 3.433 (0.84), 3.446 (1.03), 3.466 (1.26), 3.479 (1.11), 3.568 (16.00), 3.637 (0.42), 3.660 (1.41), 3.676 (1.25), 3.695 (1.03), 3.709 (0.84), 3.872 (0.44), 4.304 (1.61), 5.755 (1.98), 7.647 (0.43), 7.652 (0.46), 7.895 (8.71), 7.900 (8.69), 8.343 (3.74), 8.524 (4.89), 9.180 (4.89), 9.185 (4.86), 11.201 (4.04).
(1716) Intermediate 270
Ent-Tert-Butyl {[2,5-Dioxo-4-(1,3-Thiazol-4-Yl)Imidazolidin-4-Yl]Methyl}Carbamate
(1717) ##STR00305##
(1718) To a solution of tert-butyl [2-oxo-2-(1,3-thiazol-4-yl)ethyl]carbamate (6.95 g, 90% purity, 25.9 mmol) in methanol (40 ml) was added potassium cyanide (6.74 g, 104 mmol) and ammonium carbonate (9.94 g, 104 mmol) at RT. The reaction mixture was stirred overnight at 80 C. into a sealed pressure flask. After filtration and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative chiral SFC [sample preparation: 12 g dissolved in MeOH; column: Maisch chiralpak AD-H 5 m 25025 mm; eluent: 70% carbon dioxide/30% isopropanol; injection volume: 1.5 ml; flow rate: 100 ml/min; temperature: 38 C.; UV detection: 210 nm] afforded 2.63 g (100% purity) of the desired product that were used without further purification.
(1719) Analytical chiral SFC: Analytical chiral SFC: R.sub.t=3.14 min, e.e. =>99% [column: Chiralpak AD-H 3 m 1004.6 mm; eluent: 80% carbon dioxide/20% isopropanol; flow rate: 3 ml/min; temperature: 40 C.; UV detection: 210 nm]
(1720) LC-MS (Method 7): R.sub.t=0.96 min; MS (ESIneg): m/z=311 [MH].sup.
(1721) Intermediate 271
Ent-5-(Aminomethyl)-5-(1,3-Thiazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1722) ##STR00306##
(1723) To a solution of ent-tert-butyl {[2,5-dioxo-4-(1,3-thiazol-4-yl)imidazolidin-4-yl]methyl}carbamate (2.63 g, 8.42 mmol) in dichloromethane (50 ml) were added 10.5 ml of 4M hydrochloric acid (42 mmol) in dioxane at RT. The reaction mixture was stirred overnight at RT and concentrated in vacuo. After lyophilisation, 2.43 g of the title compound was used without further purification.
(1724) LC-MS (Method 9): R.sub.t=0.24 min; MS (ESIpos): m/z=213 [MHCl+H].sup.+
(1725) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.596 (0.73), 2.521 (0.78), 2.524 (0.72), 3.467 (1.63), 3.477 (1.96), 3.490 (2.34), 3.499 (2.02), 3.638 (2.03), 3.648 (2.28), 3.660 (1.93), 3.670 (1.57), 4.683 (5.74), 7.898 (15.46), 7.901 (16.00), 8.491 (6.40), 8.588 (8.09), 9.175 (14.29), 9.177 (14.14), 11.172 (6.99).
(1726) Intermediate 272
Tert-Butyl {2-Oxo-2-[3-(Trifluoromethyl)Pyridin-2-Yl]Ethyl}Carbamate
(1727) ##STR00307##
(1728) To a solution of 2-amino-1-[3-(trifluoromethyl)pyridin-2-yl]ethanone hydrochloride (2.00 g, 8.31 mmol, FCH1366623 HCl salt) in dichloromethane (37 ml) was added di-tert-butyl dicarbonate (2.00 g, 9.14 mmol) and triethylamine (3.5 ml, 25 mmol). After 2 h of stirring at RT, the reaction mixture was diluted with dichloromethane and extracted with water. After phase separation, the organic phase was dried; concentrated in vacuo and 2.30 g (91% yield) of the title compound was obtained.
(1729) LC-MS (Method 9): R.sub.t=1.58 min; MS (ESIpos): m/z=205 [MBoc+H].sup.+
(1730) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.284 (0.44), 1.322 (1.44), 1.371 (0.52), 1.394 (16.00), 4.481 (1.92), 4.496 (1.89), 7.197 (0.61), 7.842 (0.57), 7.853 (0.62), 7.862 (0.65), 7.874 (0.65), 8.378 (0.80), 8.399 (0.76), 8.939 (0.88), 8.950 (0.89).
(1731) Intermediate 273
Rac-Tert-Butyl({2,5-Dioxo-4-[3-(Trifluoromethyl)Pyridin-2-Yl]Imidazolidin-4-Yl}Methyl)Carbamate
(1732) ##STR00308##
(1733) To a solution of tert-butyl {2-oxo-2-[3-(trifluoromethyl)pyridin-2-yl]ethyl}carbamate (2.30 g, 7.56 mmol) in methanol (13.6 ml) was added potassium cyanide (1.97 g, 30.2 mmol) and ammonium carbonate (2.91 g, 30.2 mmol) at RT. The reaction mixture was first stirred overnight at 60 C. into a sealed pressure flask. After additional 24 h stirring at 80 C., extra portion of potassium cyanide (738 mg, 11.3 mmol) and ammonium carbonate (1.09 g, 11.3 mmol) were added due to incomplete conversion. The reaction mixture was additionally stirred overnight at 80 C. After filtration at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 7.7 g dissolved in a mixture of methanol, water, acetonitrile; column: XBridge C18 5 m, 10030 mm; eluent: water.fwdarw.acetonitrile/water 80:20+1% ammonia solution.fwdarw.acetonitrile; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm). 730 mg of the desired product was obtained and used without further purification.
(1734) LC-MS (Method 9): R.sub.t=0.87 min; MS (ESIneg): m/z=373 [MH].sup.
(1735) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.368 (16.00), 1.378 (2.03), 1.755 (0.91), 7.624 (0.46), 7.632 (0.55), 7.644 (0.48), 8.240 (0.67), 8.253 (0.66), 8.855 (0.75), 8.862 (0.75).
(1736) Intermediate 274
rac-5-(aminomethyl)-5-[3-(trifluoromethyl)pyridin-2-yl]imidazolidine-2,4-dione hydrochloride
(1737) ##STR00309##
(1738) To a solution of rac-tert-butyl({2,5-dioxo-4-[3-(trifluoromethyl)pyridin-2-yl]imidazolidin-4 yl}methyl)carbamate (725 mg, 1.94 mmol) in dichloromethane (7.6 ml) were added 2.42 ml of 4M hydrochloric acid (9.7 mmol) in dioxane at 0 C. The reaction mixture was stirred for 1 h at 0 C. then for 2 h at room temperature. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 610 mg of the title compound were obtained and used without further purification.
(1739) LC-MS (Method 9): R.sub.t=0.28 min; MS (ESIneg): m/z=273 [MHClH].sup.
(1740) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.596 (0.55), 1.757 (2.53), 2.501 (16.00), 3.168 (2.76), 3.483 (0.75), 3.493 (0.85), 3.795 (0.96), 3.807 (0.84), 7.745 (1.54), 7.754 (1.68), 7.759 (1.72), 7.767 (1.66), 8.362 (5.66), 8.375 (3.57), 8.708 (3.61), 8.898 (2.56), 8.905 (2.54), 11.399 (3.00).
(1741) Intermediate 275
Ethyl 5-(3,3-Difluorocyclobutyl)-1,3-Oxazole-4-Carboxylate
(1742) ##STR00310##
(1743) 3,3-difluorocyclobutane-1-carboxylic acid (3.00 g, 22.0 mmol) dissolved in 30 ml of THE was treated with 1,1,-carbonyl-diimidazole (4.29 g, 26.5 mmol) and stirred at room temperature. After 1 h, ethylisocyanoacetate (2.7 ml, 24 mmol), dissolved in 30 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (22 ml, 1.0 M, 22 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred overnight and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (340 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 8%.fwdarw.58%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 2.50 g (100% purity, 49% yield) of the title compound was used without further purification.
(1744) LC-MS (Method 9): R.sub.t=1.39 min; MS (ESIpos): m/z=232 [M+H].sup.+
(1745) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.272 (7.71), 1.290 (16.00), 1.308 (7.89), 2.831 (0.57), 2.852 (0.60), 2.864 (0.99), 2.868 (1.15), 2.873 (0.96), 2.884 (1.04), 2.889 (1.24), 2.893 (1.23), 2.901 (1.49), 2.906 (1.08), 2.910 (1.36), 2.921 (1.29), 2.926 (1.03), 2.930 (1.27), 2.943 (0.91), 2.963 (0.87), 3.004 (0.83), 3.013 (0.41), 3.022 (0.97), 3.027 (1.24), 3.031 (0.94), 3.038 (1.36), 3.045 (1.30), 3.061 (1.74), 3.075 (1.07), 3.080 (1.33), 3.088 (0.76), 3.093 (0.89), 3.098 (0.67), 3.116 (0.57), 4.005 (0.79), 4.026 (1.16), 4.032 (1.16), 4.047 (0.74), 4.249 (2.55), 4.267 (7.82), 4.285 (7.74), 4.303 (2.49), 8.450 (6.13).
(1746) Intermediate 276
2-Amino-1-(3,3-Difluorocyclobutyl)Ethanone Hydrochloride
(1747) ##STR00311##
(1748) Ethyl 5-(3,3-difluorocyclobutyl)-1,3-oxazole-4-carboxylate (2.50 g, 10.8 mmol) was taken up in 70 ml of 6 N hydrochloric acid and stirred for 2 h at 100 C., then overnight at room temperature.
(1749) The resulting mixture was concentrated in vacuo. Due to incomplete conversion, the crude was taken up in 70 ml of 6 N hydrochloric acid, stirred for 2 h at 100 C. and concentrated in vacuo. 1.77 g of the title compound was obtained and used without further purification.
(1750) LC-MS (Method 9): R.sub.t=0.82 min; MS (ESIpos): m/z=150 [MHCl+H].sup.+
(1751) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.34), 0.008 (1.24), 1.267 (0.48), 2.329 (0.48), 2.368 (0.73), 2.524 (2.03), 2.671 (0.48), 2.712 (1.34), 2.728 (0.98), 2.744 (4.36), 2.750 (2.01), 2.763 (5.03), 2.768 (5.47), 2.771 (5.05), 2.774 (5.44), 2.782 (7.33), 2.791 (9.26), 2.803 (9.07), 2.812 (7.08), 2.819 (5.74), 2.826 (8.00), 2.834 (4.36), 2.841 (3.64), 2.847 (3.75), 2.858 (1.51), 2.881 (0.78), 3.167 (1.28), 3.295 (0.80), 3.301 (0.82), 3.316 (2.32), 3.323 (2.55), 3.338 (3.25), 3.343 (3.54), 3.361 (2.01), 3.366 (2.03), 3.380 (0.63), 3.386 (0.54), 3.961 (6.24), 3.975 (16.00), 3.989 (15.43), 4.003 (4.82), 8.212 (5.51).
(1752) Intermediate 277
Tert-Butyl [2-(3,3-Difluorocyclobutyl)-2-Oxoethyl]Carbamate
(1753) ##STR00312##
(1754) To a solution of 2-amino-1-(3,3-difluorocyclobutyl)ethanone hydrochloride (1.77 g, 9.54 mmol) in dichloromethane (43 ml) was added di-tert-butyl dicarbonate (2.29 g, 10.5 mmol) and triethylamine (4.0 ml, 29 mmol). After 2 h of stirring at RT, the reaction mixture was diluted with dichloromethane and extracted with water. After phase separation, the organic phase was dried, concentrated in vacuo and 2.50 g (88% purity) of the title compound was obtained and used without further purification.
(1755) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.382 (5.06), 1.468 (16.00), 2.517 (0.48), 3.324 (0.46), 3.789 (0.73), 3.804 (0.73).
(1756) Intermediate 278
Rac-Tert-Butyl {[4-(3,3-Difluorocyclobutyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1757) ##STR00313##
(1758) To a solution of tert-butyl [2-(3,3-difluorocyclobutyl)-2-oxoethyl]carbamate (2.50 g, 88% purity, 8.83 mmol) in methanol (16 ml) was added potassium cyanide (2.30 g, 35.3 mmol) and ammonium carbonate (3.39 g, 35.3 mmol) at RT. The reaction mixture was first stirred overnight at 80 C. into a sealed pressure flask. Extra portion of potassium cyanide (1.15 g, 17.7 mmol) and ammonium carbonate (1.70 g, 17.7 mmol) were added due to incomplete conversion. The reaction mixture was additionally stirred overnight at 80 C.
(1759) After filtration and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 6.4 g dissolved in a mixture of methanol, water, acetonitrile; column: XBridge C18 5 m, 10030 mm; eluent: water.fwdarw.acetonitrile/water 80:20+1% ammonia solution.fwdarw.acetonitrile; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm). 1.68 g of the desired product was obtained and used without further purification.
(1760) LC-MS (Method 9): R.sub.t=0.92 min; MS (ESIneg): m/z=318 [MH].sup.
(1761) Intermediate 279
Rac-5-(Aminomethyl)-5-(3,3-Difluorocyclobutyl)Imidazolidine-2,4-Dione Hydrochloride
(1762) ##STR00314##
(1763) To a solution of rac-tert-butyl {[4-(3,3-difluorocyclobutyl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (1.68 g, 5.26 mmol) in dichloromethane (21 ml) were added 6.6 ml of 4M hydrochloric acid (26 mmol) in dioxane at 0 C. The reaction mixture was stirred for 1 h at 0 C. then for 2 h at room temperature. The precipitate was filtered off, washed with dichloromethane and dried in vacuo. 1.46 g of the title compound was obtained and used without further purification.
(1764) LC-MS (Method 9): R.sub.t=0.29 min; MS (ESIpos): m/z=220 [MHCl+H].sup.+
(1765) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.316 (0.52), 2.333 (0.53), 2.347 (0.45), 2.518 (1.08), 2.575 (0.84), 2.587 (1.27), 2.597 (1.19), 2.619 (0.73), 2.641 (0.62), 2.659 (0.75), 2.666 (0.72), 2.674 (0.61), 2.682 (0.51), 2.689 (0.41), 2.910 (1.65), 2.932 (2.01), 3.114 (2.03), 3.137 (1.66), 3.568 (16.00), 8.324 (2.83), 8.366 (3.74), 11.128 (1.25).
(1766) Intermediate 280
Ethyl 5-(1-Fluorocyclopropyl)-1,3-Oxazole-4-Carboxylate
(1767) ##STR00315##
(1768) 1-fluorocyclopropane-1-carboxylic acid (3.00 g, 28.8 mmol) dissolved in 45 ml of THE was treated with 1,1,-carbonyl-diimidazole (5.61 g, 34.6 mmol) and stirred at room temperature. After 2 h, ethyl isocyanoacetate (3.5 ml, 32 mmol), dissolved in 45 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (29 ml, 1.0 M, 29 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred overnight and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (340 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 10%.fwdarw.65%).
(1769) Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 2.84 g (100% purity, 49% yield) of the title compound was used without further purification.
(1770) LC-MS (Method 7): R.sub.t=1.37 min; MS (ESIpos): m/z=200 [M+H].sup.+
(1771) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 1.205 (0.54), 1.226 (7.72), 1.240 (16.00), 1.254 (7.77), 1.264 (0.41), 1.308 (0.68), 1.421 (0.81), 1.428 (0.83), 1.439 (1.20), 1.445 (1.15), 1.452 (0.62), 1.456 (1.04), 1.461 (0.66), 1.467 (1.15), 1.475 (1.00), 1.480 (0.83), 1.483 (0.77), 1.490 (0.81), 1.493 (0.80), 1.528 (0.66), 1.531 (0.78), 1.538 (0.85), 1.543 (1.22), 1.548 (0.95), 1.554 (1.08), 1.559 (0.97), 1.563 (0.70), 1.570 (0.53), 1.577 (0.58), 1.579 (0.54), 1.585 (0.51), 1.596 (0.75), 1.603 (0.81), 1.621 (0.40), 1.632 (0.73), 1.639 (0.74), 1.652 (0.71), 1.676 (2.04), 1.679 (2.23), 1.689 (2.12), 1.712 (2.11), 1.715 (2.23), 1.722 (1.82), 1.725 (1.63), 4.220 (1.69), 4.234 (0.92), 4.242 (1.04), 4.249 (0.96), 4.256 (3.51), 4.263 (0.62), 4.269 (5.01), 4.276 (0.59), 4.283 (3.52), 4.290 (0.91), 4.297 (0.97), 4.305 (0.81), 4.307 (0.45), 5.551 (4.54), 5.554 (4.40), 9.124 (1.25).
(1772) Intermediate 281
2-Amino-1-(1-Fluorocyclopropyl)Ethanone Hydrochloride
(1773) ##STR00316##
(1774) ethyl 5-(1-fluorocyclopropyl)-1,3-oxazole-4-carboxylate (2.84 g, 14.3 mmol) was taken up in 70 ml of 6 N hydrochloric acid and stirred for 2 h at 100 C. The resulting mixture was concentrated in vacuo. 1.88 g (100% purity, 86% yield) of the title compound was obtained and used without further purification.
(1775) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.241 (0.49), 1.402 (2.22), 1.418 (6.53), 1.426 (7.45), 1.439 (9.53), 1.447 (7.17), 1.461 (3.46), 1.485 (0.57), 1.506 (0.48), 1.537 (0.47), 1.582 (3.31), 1.596 (6.52), 1.604 (6.02), 1.620 (2.26), 1.627 (3.14), 1.641 (6.56), 1.650 (6.39), 1.665 (2.14), 4.235 (16.00), 8.356 (5.64).
(1776) Intermediate 282
Tert-Butyl [2-(1-Fluorocyclopropyl)-2-Oxoethyl]Carbamate
(1777) ##STR00317##
(1778) To a solution of 2-amino-1-(1-fluorocyclopropyl)ethanone hydrochloride (1.88 g, 12.2 mmol) in dichloromethane (55 ml) was added di-tert-butyl dicarbonate (2.94 g, 13.5 mmol) and triethylamine (5.1 ml, 37 mmol). After 1.5 h of stirring at RT, the reaction mixture was washed with water. After phase separation, the organic phase was dried; concentrated in vacuo and 2.48 g of the title compound was obtained and used without further purification.
(1779) LC-MS (Method 9): R.sub.t=1.39 min; MS (ESIpos): m/z=218 [M+H].sup.+
(1780) Intermediate 283
Rac-Tert-Butyl {[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1781) ##STR00318##
(1782) To a solution of tert-butyl [2-(1-fluorocyclopropyl)-2-oxoethyl]carbamate (2.46 g, 11.3 mmol) in methanol (20 ml) was added potassium cyanide (2.95 g, 45.3 mmol) and ammonium carbonate (4.35 g, 45.3 mmol) at RT. The reaction mixture was stirred overnight at 80 C. into a sealed pressure flask. After filtration at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 7.4 g dissolved in a mixture of methanol, water, acetonitrile; column: XBridge C18 5 m, 10030 mm; eluent: water.fwdarw.acetonitrile/water 80:20+1% ammonia solution.fwdarw.acetonitrile; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 220 nm). 2.31 g of the desired product was obtained and used without further purification
(1783) LC-MS (Method 9): R.sub.t=0.65 min; MS (ESIneg): m/z=286 [MH].sup.
(1784) Intermediate 284
Rac-5-(Aminomethyl)-5-(1-Fluorocyclopropyl)Imidazolidine-2,4-Dione Hydrochloride
(1785) ##STR00319##
(1786) To a solution of rac-tert-butyl {[4-(1-fluorocyclopropyl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (1.20 g, 4.18 mmol) in dichloromethane (36 ml) were added 5.2 ml (21 mmol) of 4M hydrochloric acid in dioxane at RT. The reaction mixture was stirred for 3 days and then concentrated in vacuo. 1.04 g of the title compound was used without further purification.
(1787) LC-MS (Method 9): R.sub.t=0.25 min; MS (ESIpos): m/z=188 [MHCl+H].sup.+
(1788) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.814 (0.66), 0.833 (2.66), 0.842 (2.91), 0.847 (3.07), 0.851 (3.10), 0.859 (2.45), 0.869 (2.25), 0.892 (0.51), 0.965 (0.55), 0.999 (0.64), 1.020 (2.80), 1.039 (5.31), 1.043 (5.25), 1.048 (3.48), 1.060 (9.17), 1.076 (2.31), 1.081 (3.58), 1.091 (5.77), 1.109 (1.82), 1.120 (0.63), 1.182 (1.41), 1.194 (2.97), 1.206 (1.66), 1.368 (11.79), 1.757 (5.46), 2.117 (2.39), 3.109 (7.54), 3.132 (9.02), 3.347 (8.25), 3.568 (4.33), 3.864 (1.61), 3.874 (1.62), 4.084 (0.44), 4.096 (1.31), 4.108 (1.33), 4.120 (0.50), 7.902 (0.50), 8.098 (0.91), 8.444 (16.00), 8.474 (9.62), 11.159 (4.19).
(1789) Intermediate 285
Methyl 5-(2,5-Dimethyl-1,3-Thiazol-4-Yl)-1,3-Oxazole-4-Carboxylate
(1790) ##STR00320##
(1791) 2,5-dimethyl-1,3-thiazole-4-carboxylicacid (3.00 g, 19.1 mmol) dissolved in 30 ml of THE was treated with 1,1,-carbonyl-diimidazole (3.71 g, 22.9 mmol) and stirred at room temperature. After 1 h, ethyl isocyanoacetate (2.3 ml, 21 mmol), dissolved in 30 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (19 ml, 1.0 M, 19 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred for 2 days and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product (ethyl ester derivative) was diluted in 50 ml of methanol; Isolute was added, and the solvent was evaporated on a rotary evaporator at higher temperature. The crude was then purified by column chromatography (340 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 15%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 2.67 g (100% purity, 59% yield) of the title compound was used without further purification.
(1792) LC-MS (Method 7): R.sub.t=1.11 min; MS (ESIpos): m/z=238 [M+H].sup.+
(1793) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.401 (13.72), 2.673 (12.80), 3.805 (16.00), 8.602 (2.93).
(1794) Intermediate 286
2-Amino-1-(2,5-Dimethyl-1,3-Thiazol-4-Yl)Ethanone Hydrochloride
(1795) ##STR00321##
(1796) methyl 5-(2,5-dimethyl-1,3-thiazol-4-yl)-1,3-oxazole-4-carboxylate (2.67 g, 11.2 mmol) was taken up in 60 ml of 6 N hydrochloric acid and stirred for 2 h at 100 C. The resulting mixture was concentrated in vacuo. 2.90 g of the title compound was obtained and used without further purification.
(1797) LC-MS (Method 9): R.sub.t=0.77 min; MS (ESIpos): m/z=171 [MHCl+H].sup.+
(1798) Intermediate 287
Tert-Butyl [2-(2,5-Dimethyl-1,3-Thiazol-4-Yl)-2-Oxoethyl]Carbamate
(1799) ##STR00322##
(1800) To a solution of 2-amino-1-(2,5-dimethyl-1,3-thiazol-4-yl)ethanone hydrochloride (2.90 g, 14.0 mmol) in dichloromethane (80 ml) was added di-tert-butyl dicarbonate (2.86 g, 13.1 mmol) and triethylamine (13 ml, 95 mmol). After 2 h of stirring at RT, the reaction mixture was washed with water. After phase separation, the organic phase was dried; concentrated in vacuo and 3.17 g of the title compound was obtained and used without further purification.
(1801) LC-MS (Method 9): R.sub.t=1.38 min; MS (ESIpos): m/z=271 [M+H].sup.+
(1802) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.111 (2.20), 1.275 (0.74), 1.367 (0.75), 1.394 (16.00), 1.412 (0.44), 2.500 (4.08), 2.607 (9.87), 2.663 (9.51), 4.143 (1.81), 4.153 (1.78), 7.156 (0.63).
(1803) Intermediate 288
Rac-Tert-Butyl {[4-(2,5-Dimethyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1804) ##STR00323##
(1805) To a solution of tert-butyl [2-(2,5-dimethyl-1,3-thiazol-4-yl)-2-oxoethyl]carbamate (3.17 g, 11.7 mmol) in methanol (21 ml) was added potassium cyanide (3.05 g, 46.9 mmol) and ammonium carbonate (4.51 g, 46.9 mmol) at RT. The reaction mixture was first stirred overnight at 60 C. into a sealed pressure flask. Extra portion of potassium cyanide (1.07 g, 16.4 mmol) and ammonium carbonate (1.58 g, 16.4 mmol) were added due to incomplete conversion. The reaction mixture was first stirred for 7 h at 60 C., then for 48 h at RT.
(1806) After filtration and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 5.4 g dissolved in acetonitrile; column: XBridge C18 5 m, 10030 mm; eluent: water.fwdarw.acetonitrile/water 80:20+1% ammonia solution.fwdarw.acetonitrile; flowrate: 80 ml/min; temperature: 45 C.; UV detection: 210 nm). 1.22 g of the desired product was obtained and used without further purification.
(1807) LC-MS (Method 7): R.sub.t=1.09 min; MS (ESIpos): m/z=341 [M+H].sup.+
(1808) Intermediate 289
Rac-5-(Aminomethyl)-5-(2,5-Dimethyl-1,3-Thiazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1809) ##STR00324##
(1810) To a solution rac-tert-butyl {[4-(2,5-dimethyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (300 mg, 881 mol) in dichloromethane (3.5 ml) were added 1.1 ml of 4M hydrochloric acid (4.4 mmol) in dioxane at RT. After stirring for 1 at RT, the precipitate was filtered off, washed with dichloromethane and dried in vacuo. 243 mg of the title compound was obtained and used without further purification.
(1811) LC-MS (Method 9): R.sub.t=0.24 min; MS (ESIpos): m/z=241 [MHCl+H].sup.+
(1812) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.30), 0.008 (2.40), 1.110 (0.56), 1.596 (1.42), 1.757 (2.42), 2.074 (2.42), 2.273 (0.40), 2.368 (0.52), 2.418 (12.62), 2.525 (1.42), 2.567 (16.00), 2.712 (0.47), 3.168 (8.55), 3.403 (0.64), 3.568 (1.07), 3.579 (0.83), 3.600 (0.74), 8.432 (1.64), 8.931 (0.84), 11.379 (2.14).
(1813) Intermediate 290
Ethyl 5-(5-Cyclopropyl-1,3-Thiazol-4-Yl)-1,3-Oxazole-4-Carboxylate
(1814) ##STR00325##
(1815) 5-cyclopropyl-1,3-thiazole-4-carboxylic acid (2.00 g, 11.8 mmol) dissolved in 30 ml of THE was treated with 1,1,-carbonyl-diimidazole (2.30 g, 14.2 mmol) and stirred at room temperature. After 1 h, ethyl isocyanoacetate (1.4 ml, 13 mmol), dissolved in 20 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (12 ml, 1.0 M, 12 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred overnight and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (50 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 10%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 2.30 g (100% purity, 74% yield) of the title compound was used without further purification.
(1816) LC-MS (Method 7): R.sub.t=1.37 min; MS (ESIpos): m/z=265 [M+H].sup.+
(1817) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.614 (1.40), 0.622 (5.17), 0.625 (4.35), 0.630 (4.44), 0.633 (5.10), 0.641 (1.42), 1.077 (1.50), 1.084 (4.03), 1.088 (4.16), 1.098 (4.20), 1.101 (4.01), 1.109 (1.32), 1.162 (7.86), 1.174 (16.00), 1.186 (7.91), 1.989 (2.00), 2.046 (0.62), 2.054 (1.27), 2.060 (1.37), 2.068 (2.39), 2.076 (1.30), 2.082 (1.16), 2.090 (0.56), 4.026 (0.49), 4.038 (0.48), 4.198 (2.59), 4.209 (7.79), 4.221 (7.66), 4.233 (2.49), 8.623 (9.20), 8.975 (8.85).
(1818) Intermediate 291
2-Amino-1-(5-Cyclopropyl-1,3-Thiazol-4-Yl)Ethanone Hydrochloride
(1819) ##STR00326##
(1820) ethyl 5-(5-cyclopropyl-1,3-thiazol-4-yl)-1,3-oxazole-4-carboxylate (2.30 g, 8.70 mmol) was taken up in 43 ml of 6 N hydrochloric acid and stirred for 2 h at 100 C. The resulting mixture was concentrated in vacuo. 1.99 g (100% purity) of the title compound was obtained and used without further purification.
(1821) LC-MS (Method 9): R.sub.t=1.15 min; MS (ESIpos): m/z=183 [MHCl+H].sup.+
(1822) Intermediate 292
Tert-Butyl [2-(5-Cyclopropyl-1,3-Thiazol-4-Yl)-2-Oxoethyl]Carbamate
(1823) ##STR00327##
(1824) To a solution of 2-amino-1-(5-cyclopropyl-1,3-thiazol-4-yl)ethanone hydrochloride (1.99 g, 9.10 mmol) in dichloromethane (41 ml) was added di-tert-butyl dicarbonate (2.18 g, 10.0 mmol) and triethylamine (7.6 ml, 55 mmol). After 2 h of stirring at RT, the reaction mixture was washed with water. After phase separation, the organic phase was dried; concentrated in vacuo and 2.44 g of the title compound was obtained and used without further purification.
(1825) LC-MS (Method 9): R.sub.t=1.58 min; MS (ESIpos): m/z=283 [M+H].sup.+
(1826) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.724 (1.35), 0.729 (1.19), 0.741 (1.36), 0.752 (0.43), 1.109 (0.60), 1.268 (0.47), 1.279 (1.24), 1.285 (1.29), 1.300 (1.80), 1.306 (2.06), 1.316 (0.84), 1.364 (0.70), 1.388 (1.53), 1.402 (16.00), 1.467 (8.35), 3.129 (0.61), 4.394 (1.90), 4.409 (1.87), 6.976 (0.58), 8.892 (1.62).
(1827) Intermediate 293
Rac-Tert-Butyl {[4-(5-Cyclopropyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1828) ##STR00328##
(1829) To a solution of tert-butyl [2-(5-cyclopropyl-1,3-thiazol-4-yl)-2-oxoethyl]carbamate (2.44 g, 8.64 mmol) in methanol (20 ml) was added potassium cyanide (2.25 g, 34.6 mmol) and ammonium carbonate (3.32 g, 34.6 mmol) at RT. The reaction mixture was stirred for 5 hours at 60 C., followed by 48 h at RT. into a sealed pressure flask. After additional 24 h stirring at 80 C., the reaction mixture was filtered at RT and the resulting filtrate was concentrated in vacuo.
(1830) The residue was purified by preparative HPLC (sample preparation: 5.6 g dissolved in acetonitrile; column: XBridge C18 5 m, 10030 mm; eluent: water.fwdarw.acetonitrile/water 80:20+1% ammonia solution.fwdarw.acetonitrile; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm). 1.98 g of the desired product was obtained and used without further purification.
(1831) LC-MS (Method 7): R.sub.t=1.22 min; MS (ESIpos): m/z=353 [M+H].sup.+
(1832) Intermediate 294
Ent-Tert-Butyl {[4-(5-Cyclopropyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1833) ##STR00329##
(1834) Enantiomeric separation of rac-tert-butyl {[4-(5-cyclopropyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate by preparative chiral SFC [sample preparation: 1.48 g dissolved in 50 ml acetonitrile/50 ml MeOH; column: Chiralpak AD SFC 20 m 36050 mm; eluent: 80% carbon dioxide/20% isopropanol; injection volume: 5 ml; flow rate: 400 ml/min; temperature: 40 C.; UV detection: 210 nm] afforded 0.63 g (100% purity) of the desired product.
(1835) Analytical chiral SFC: Analytical chiral SFC: R.sub.t=1.95 min, e.e. =98.4% [column: Chiralpak AD-3; eluent: 80% carbon dioxide/20% isopropanol; flow rate: 3 ml/min; temperature: 40 C.; UV detection: 210 nm]
(1836) LC-MS (Method 7): R.sub.t=1.24 min; MS (ESIpos): m/z=353 [M+H].sup.+
(1837) .sup.1H NMR (600 MHz, DMSO-d.sub.6) ppm 10.72-11.07 (m, 1H), 8.78 (s, 1H), 7.97-8.17 (m, 1H), 6.63-6.80 (m, 1H), 3.70-4.05 (m, 2H), 1.89-2.05 (m, 1H), 1.38 (s, 9H), 0.93-1.10 (m, 2 H), 0.63-0.75 (m, 1H), 0.47-0.60 (m, 1H)
(1838) Intermediate 295
Rac-5-(Aminomethyl)-5-(5-Cyclopropyl-1,3-Thiazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1839) ##STR00330##
(1840) To a solution of rac-tert-butyl {[4-(5-cyclopropyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (500 mg, 1.42 mmol) in dichloromethane (12 ml) were added 1.8 ml of 4M hydrochloric acid (7.1 mmol) in dioxane at RT. The reaction mixture was stirred for 1 h at room temperature, after which extra portion of 4M hydrochloric acid (180 l, 710 mol) was added due to incomplete conversion. After stirring for 1 at RT, the precipitate was filtered off, washed with dichloromethane and dried in vacuo. 435 mg of the title compound was obtained and used without further purification.
(1841) LC-MS (Method 9): R.sub.t=0.32 min, MS (ESIpos): m/z=253 [MHCl+H].sup.+
(1842) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.77), 0.553 (0.63), 0.562 (1.05), 0.570 (1.98), 0.576 (1.14), 0.578 (2.43), 0.584 (1.74), 0.587 (1.07), 0.593 (0.85), 0.719 (0.75), 0.725 (1.02), 0.728 (1.68), 0.734 (2.45), 0.742 (2.06), 0.751 (1.31), 0.759 (0.76), 1.014 (0.53), 1.021 (0.52), 1.024 (0.48), 1.029 (1.40), 1.036 (1.57), 1.039 (1.34), 1.045 (1.89), 1.049 (1.86), 1.054 (2.04), 1.058 (2.06), 1.063 (1.84), 1.068 (1.52), 1.071 (1.57), 1.078 (1.43), 1.083 (0.58), 1.086 (0.55), 1.093 (0.53), 1.596 (0.75), 1.910 (0.78), 1.919 (1.58), 1.924 (1.69), 1.927 (0.97), 1.932 (3.13), 1.938 (1.02), 1.941 (1.62), 1.946 (1.54), 1.955 (0.75), 2.523 (0.42), 2.573 (0.85), 3.058 (0.68), 3.168 (12.10), 3.568 (0.84), 3.615 (0.43), 3.626 (0.72), 3.637 (1.65), 3.647 (1.89), 3.653 (1.97), 3.662 (1.71), 3.684 (0.47), 8.368 (3.59), 8.628 (4.46), 8.862 (16.00), 11.327 (3.71).
(1843) Intermediate 296
Ent-5-(Aminomethyl)-5-(5-Cyclopropyl-1,3-Thiazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1844) ##STR00331##
(1845) To a solution of ent-tert-butyl {[4-(5-cyclopropyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}carbamate (630 mg, 1.79 mmol) in dichloromethane (9.6 ml) were added 2.7 ml of 4M hydrochloric acid (11 mmol) in dioxane at RT. After stirring overnight at RT, the precipitate was filtered off, washed with dichloromethane and dried in vacuo. 629 mg of the title compound was obtained and used without further purification.
(1846) LC-MS (Method 9): R.sub.t=0.28 min, MS (ESIpos): m/z=253 [MHCl+H].sup.+
(1847) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.98), 0.008 (0.97), 0.546 (0.72), 0.560 (1.47), 0.569 (1.66), 0.573 (1.79), 0.583 (1.98), 0.588 (1.89), 0.597 (1.28), 0.601 (1.04), 0.713 (1.00), 0.718 (1.31), 0.722 (1.47), 0.726 (1.98), 0.731 (1.99), 0.740 (1.67), 0.745 (1.72), 0.754 (1.66), 0.768 (0.83), 1.003 (0.62), 1.013 (0.56), 1.026 (1.67), 1.036 (2.17), 1.040 (2.13), 1.045 (4.49), 1.056 (2.75), 1.061 (2.48), 1.065 (4.72), 1.071 (2.24), 1.075 (2.04), 1.085 (1.58), 1.094 (0.52), 1.098 (0.47), 1.108 (0.51), 1.375 (0.77), 1.596 (1.47), 1.887 (0.79), 1.900 (1.60), 1.908 (1.73), 1.921 (3.04), 1.929 (1.13), 1.934 (1.66), 1.942 (1.50), 1.954 (0.71), 2.329 (0.56), 2.670 (0.55), 3.568 (16.00), 3.588 (0.86), 3.603 (1.13), 3.620 (1.81), 3.635 (1.66), 3.673 (1.54), 3.687 (1.68), 3.705 (1.06), 3.720 (0.75), 4.363 (2.00), 5.755 (12.12), 8.277 (3.98), 8.576 (3.11), 8.868 (12.20), 11.359 (4.74).
(1848) Intermediate 297
6-Fluoro-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(1849) ##STR00332##
(1850) To a suspension of [4-(trifluoromethyl)phenyl]boronic acid (2.47 g, 13.0 mmol) and 2-bromo-3-fluorobenzoic acid (1.90 g, 8.68 mmol) in 1,4-dioxane (53 ml) was added, under argon, a solution of K.sub.3PO.sub.4 in water (17 ml, 1.5 M, 26 mmol), dichlorobis(triphenylphosphin)palladium (II) (609 mg, 868 mol, CAS 13965-03-2) and XPhos (414 mg, 868 mol, CAS 564483-18-7). The reaction mixture was first stirred for 7.5 h at 80 C., then overnight at RT. The resulting mixture was filtered through celite, dried and concentrated in vacuo. 3.35 g (46% purity, 63% yield) of the title compound were obtained and used without further purification.
(1851) LC-MS (Method 7): R.sub.t=1.86 min; MS (ESIneg): m/z=283 [MH].sup.
(1852) Intermediate 298
Methyl 5-(1,3-Dimethyl-1H-Pyrazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(1853) ##STR00333##
(1854) 1,3-dimethyl-1H-pyrazole-5-carboxylic acid (4.00 g, 28.5 mmol) dissolved in 30 ml of THE was treated with 1,1,-carbonyl-diimidazole (5.55 g, 34.3 mmol) and stirred at room temperature. After 1 h, ethyl isocyanoacetate (3.4 ml, 31 mmol), dissolved in 30 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (28.5 ml, 1.0 M, 28.5 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred for 3 days and concentrated in vacuo. The crude product (ethyl ester derivative) was diluted in methanol; Isolute was added, and the solvent was evaporated on a rotary evaporator at higher temperature. The crude was then purified by column chromatography (340 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 20%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 2.17 g (100% purity, 34% yield) of the title compound was used without further purification.
(1855) LC-MS (Method 9): R.sub.t=1.05 min; MS (ESIpos): m/z=222 [M+H].sup.+
(1856) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.204 (6.75), 3.800 (16.00), 6.664 (1.56), 8.661 (1.60).
(1857) Intermediate 299
2-Amino-1-(1,3-Dimethyl-1H-Pyrazol-5-Yl)Ethanone Hydrochloride
(1858) ##STR00334##
(1859) methyl 5-(1,3-dimethyl-1H-pyrazol-5-yl)-1,3-oxazole-4-carboxylate (2.17 g, 9.81 mmol) was taken up in 49 ml of 6 N hydrochloric acid and stirred for 2 h at 100 C. The resulting mixture was concentrated in vacuo. 2.28 g of the title compound was obtained and used without further purification.
(1860) LC-MS (Method 9): R.sub.t=0.75 min; MS (ESIpos): m/z=154 [MHCl+H].sup.+
(1861) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.074 (0.56), 2.213 (13.73), 3.981 (0.52), 4.013 (16.00), 4.028 (0.44), 4.322 (0.88), 4.336 (2.45), 4.350 (2.49), 4.364 (0.98), 4.539 (0.66), 4.681 (0.72), 7.049 (4.23), 8.397 (1.22).
(1862) Intermediate 300
Tert-Butyl [2-(1,3-Dimethyl-1H-Pyrazol-5-Yl)-2-Oxoethyl]Carbamate
(1863) ##STR00335##
(1864) To a solution of 2-amino-1-(1,3-dimethyl-1H-pyrazol-5-yl)ethanone hydrochloride (2.28 g, 12.0 mmol) in dichloromethane (54 ml) was added di-tert-butyl dicarbonate (2.89 g, 13.2 mmol) and triethylamine (10 ml, 72 mmol). After 2 h of stirring at RT, the reaction mixture was diluted with dichlorometane and washed with water. After phase separation, the organic phase was dried; concentrated in vacuo and 2.77 g of the title compound was obtained and used without further purification.
(1865) LC-MS (Method 9): R.sub.t=1.37 min; MS (ESIpos): m/z=254 [M+H].sup.+
(1866) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.939 (0.43), 1.113 (1.13), 1.287 (0.64), 1.368 (1.90), 1.394 (12.03), 1.469 (16.00), 2.190 (6.38), 3.965 (5.13), 4.207 (1.38), 4.217 (1.35), 6.949 (1.37), 7.088 (0.49).
(1867) Intermediate 301
Rac-Tert-Butyl {[4-(1,3-Dimethyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1868) ##STR00336##
(1869) To a solution of tert-butyl [2-(1,3-dimethyl-1H-pyrazol-5-yl)-2-oxoethyl]carbamate (2.77 g, 10.9 mmol) in methanol (12 ml) was added potassium cyanide (2.85 g, 43.7 mmol) and ammonium carbonate (4.20 g, 43.7 mmol) at RT. The reaction mixture was stirred for 6 hours at 80 C., followed by 48 h at 40 C. into a sealed pressure flask. After filtration and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 3.25 g dissolved in a mixture of methanol/water; column: XBridge C18 5 m, 10030 mm; eluent: acetonitrile/water+1% ammonia solution; temperature: 40 C.; UV detection: 210 nm). 204 mg of the desired product was obtained and used without further purification.
(1870) LC-MS (Method 9): R.sub.t=0.35 min; MS (ESIpos): m/z=324 [M+H].sup.+
(1871) Intermediate 302
Rac-5-(Aminomethyl)-5-(1,3-Dimethyl-1H-Pyrazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1872) ##STR00337##
(1873) To a solution of rac-tert-butyl {[4-(1,3-dimethyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (200 mg, 619 mol) in dichloromethane (5 ml) were added 770 l of 4M hydrochloric acid (3.1 mmol) in dioxane at RT. The reaction mixture was stirred for 2 h and concentrated in vacuo. Due to incomplete conversion, the crude was diluted again in 5 ml DCM and 770 l of 4M hydrochloric acid (3.1 mmol) in dioxane were added. The reaction mixture was stirred overnight at RT and concentrated in vacuo. 197 mg of the title compound was obtained and used without further purification.
(1874) LC-MS (Method 9): R.sub.t=0.23 min; MS (ESIneg): m/z=222 [MHClH].sup.
(1875) Intermediate 303
Ethyl 5-(1-Chlorocyclopropyl)-1,3-Oxazole-4-Carboxylate
(1876) ##STR00338##
(1877) 1-chlorocyclopropane-1-carboxylic acid (4.12 g, 34.2 mmol) dissolved in 50 ml of THE was treated with 1,1,-carbonyl-diimidazole (6.65 g, 41.0 mmol) and stirred at room temperature. After 2 h, ethyl isocyanoacetate (4.1 ml, 38 mmol), dissolved in 50 ml of TH F, and a solution of lithium bis(trimethylsilyl)amide in THF (34 ml, 1.0 M, 34 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred overnight and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (340 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 10%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 3.38 g of the title compound was used without further purification.
(1878) LC-MS (Method 7): R.sub.t=1.50 min; MS (ESIpos): m/z=216 [M+H].sup.+
(1879) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.64), 0.008 (0.67), 1.314 (7.63), 1.332 (16.00), 1.350 (7.76), 1.533 (3.46), 1.540 (13.18), 1.543 (13.20), 1.550 (3.34), 2.524 (0.43), 4.298 (2.49), 4.315 (7.69), 4.333 (7.55), 4.351 (2.42), 8.489 (5.44).
(1880) Intermediate 304
2-Amino-1-(1-Chlorocyclopropyl)Ethanone Hydrochloride
(1881) ##STR00339##
(1882) ethyl 5-(1-chlorocyclopropyl)-1,3-oxazole-4-carboxylate (3.38 g, 15.7 mmol) was taken up in 77 ml of 6 N hydrochloric acid and stirred for 2 h at 100 C. The resulting mixture was concentrated in vacuo. 2.56 g of the title compound was obtained and used without further purification.
(1883) LC-MS (Method 9): R.sub.t=0.82 min; MS (ESIpos): m/z=134 [MHCl+H].sup.+
(1884) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.253 (0.53), 1.574 (4.17), 1.583 (12.73), 1.589 (12.55), 1.597 (5.57), 1.625 (0.64), 1.721 (0.61), 1.749 (5.48), 1.758 (12.77), 1.763 (12.59), 1.773 (4.38), 3.652 (0.41), 4.187 (16.00), 7.297 (1.22), 7.381 (1.40), 7.466 (1.22), 8.403 (5.29).
(1885) Intermediate 305
Tert-Butyl [2-(1-Chlorocyclopropyl)-2-Oxoethyl]Carbamate
(1886) ##STR00340##
(1887) To a solution of 2-amino-1-(1-chlorocyclopropyl)ethanone hydrochloride (2.56 g, 15.1 mmol) in dichloromethane (100 ml) was added di-tert-butyl dicarbonate (3.61 g, 16.6 mmol) and triethylamine (17 ml, 120 mmol). After 2 h of stirring at RT, the reaction mixture was washed with water. After phase separation, the organic phase was dried; concentrated in vacuo and 3.22 g of the title compound was obtained and used without further purification.
(1888) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.015 (0.44), 1.113 (1.18), 1.327 (0.64), 1.340 (0.71), 1.368 (4.07), 1.377 (9.45), 1.390 (0.93), 1.425 (0.51), 1.449 (0.50), 1.458 (1.39), 1.463 (1.83), 1.470 (16.00), 1.631 (0.53), 1.639 (1.01), 1.644 (0.90), 2.501 (1.09), 4.091 (1.08), 4.101 (1.07).
(1889) Intermediate 306
Rac-Tert-Butyl {[4-(1-Chlorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1890) ##STR00341##
(1891) To a solution of tert-butyl [2-(1-chlorocyclopropyl)-2-oxoethyl]carbamate (3.20 g, 13.7 mmol) in methanol (12 ml) was added potassium cyanide (3.57 g, 54.8 mmol) and ammonium carbonate (5.26 g, 54.8 mmol) at RT. The reaction mixture was stirred for 6 hours at 80 C., followed by 48 h at 40 C. into a sealed pressure flask. After filtration and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 5.14 g dissolved in acetonitrile; column: XBridge C18 5 m, 10030 mm; eluent: water.fwdarw.acetonitrile/water 80:20+1% ammonia solution.fwdarw.acetonitrile; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm). 342 mg of the desired product was obtained and used without further purification.
(1892) LC-MS (Method 9): R.sub.t=0.72 min; MS (ESIneg): m/z=302 [MH].sup.
(1893) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.007 (0.66), 1.025 (0.99), 1.153 (0.56), 1.165 (1.09), 1.362 (16.00), 1.409 (0.62), 7.833 (0.77).
(1894) Intermediate 307
Rac-5-(Aminomethyl)-5-(1-Chlorocyclopropyl)Imidazolidine-2,4-Dione Hydrochloride
(1895) ##STR00342##
(1896) To a solution of rac-tert-butyl {[4-(1-chlorocyclopropyl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (340 mg, 1.12 mmol) in dichloromethane (10 ml) were added 1.4 ml of 4M hydrochloric acid (5.6 mmol) in dioxane at RT. The reaction mixture was stirred for 2 h at room temperature and concentrated in vacuo. The crude was again diluted in 10 ml DCM after which extra portion of 4M hydrochloric acid (1.4 ml, 4.0 M, 5.6 mmol) was added due to incomplete conversion. After stirring overnight at RT, the precipitate was filtered off, washed with dichloromethane and dried in vacuo. 256 mg of the title compound was obtained and used without further purification.
(1897) LC-MS (Method 9): R.sub.t=0.27 min; MS (ESIpos): m/z=204 [MHCl+H].sup.+
(1898) Intermediate 308
Ethyl 5-(1-Methyl-1H-Imidazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(1899) ##STR00343##
(1900) 1-methyl-1H-imidazole-5-carboxylic acid (1.00 g, 7.93 mmol) dissolved in 10 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.54 g, 9.52 mmol) and stirred at room temperature. After 1 h, ethyl isocyanoacetate (950 l, 8.7 mmol), dissolved in 10 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (7.9 ml, 1.0 M, 7.9 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred for 2 days and concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product divided in 2 batches of 700 mg was purified by column chromatography (1.sup.st batch: Snap NH 110 g Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 20%.fwdarw.100%; 2.sup.nd batch: Snap ultra 25 g Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 20%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 911 mg of the title compound was used without further purification.
(1901) LC-MS (Method 9): R.sub.t=0.89 min; MS (ESIpos): m/z=222 [M+H].sup.+
(1902) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.50), 0.008 (0.48), 1.239 (4.81), 1.257 (10.07), 1.275 (4.86), 3.740 (16.00), 4.249 (1.57), 4.267 (4.86), 4.285 (4.79), 4.303 (1.52), 7.684 (2.40), 7.687 (2.59), 7.886 (2.53), 8.589 (3.64).
(1903) Intermediate 309
2-Amino-1-(1-Methyl-1H-Imidazol-5-Yl)Ethanone Hydrochloride
(1904) ##STR00344##
(1905) ethyl 5-(1-methyl-1H-imidazol-5-yl)-1,3-oxazole-4-carboxylate (911 mg, 4.12 mmol) was taken up in 20 ml of 6 N hydrochloric acid and stirred for 2 h at 100 C. The resulting mixture was concentrated in vacuo. 934 mg (84% purity) of the title compound was obtained and used without further purification.
(1906) LC-MS (Method 9): R.sub.t=0.43 min; MS (ESIpos): m/z=140 [MHCl+H].sup.+
(1907) Intermediate 310
Tert-Butyl [2-(1-Methyl-1H-Imidazol-5-Yl)-2-Oxoethyl]Carbamate
(1908) ##STR00345##
(1909) To a solution of 2-amino-1-(1-methyl-1H-imidazol-5-yl)ethanone hydrochloride (934 mg, 84% purity, 4.48 mmol) in dichloromethane (20 ml) was added di-tert-butyl dicarbonate (1.08 g, 4.93 mmol) and triethylamine (3.7 ml, 27 mmol). After 2 h of stirring at RT, the reaction mixture was diluted with dichloromethane and washed with water. After phase separation, the organic phase was dried; concentrated in vacuo and 883 mg (86% purity, 71% yield) of the title compound was obtained and used without further purification.
(1910) LC-MS (Method 9): R.sub.t=1.09 min; MS (ESIpos): m/z=240 [M+H].sup.+
(1911) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.909 (0.64), 0.927 (1.33), 0.945 (0.68), 1.110 (2.98), 1.277 (0.69), 1.366 (1.28), 1.390 (16.00), 1.409 (0.88), 1.422 (1.01), 1.438 (0.58), 1.449 (1.00), 1.473 (0.76), 1.481 (0.48), 1.574 (4.41), 2.411 (0.45), 2.429 (0.43), 3.311 (10.27), 4.192 (1.72), 4.207 (1.71), 7.088 (0.54), 7.932 (1.94), 7.987 (1.68).
(1912) Intermediate 311
Rac-Tert-Butyl {[4-(1-Methyl-1H-Imidazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1913) ##STR00346##
(1914) To a solution of tert-butyl [2-(1-methyl-1H-imidazol-5-yl)-2-oxoethyl]carbamate (883 mg, 86% purity, 3.17 mmol) in methanol (12 ml) was added potassium cyanide (826 mg, 12.7 mmol) and ammonium carbonate (1.22 g, 12.7 mmol) at RT. The reaction mixture was stirred overnight at 80 C. into a sealed pressure flask. After filtration and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 2.74 g dissolved in water/methanol; column: XBridge C18 5 m, 10030 mm; eluent: water.fwdarw.acetonitrile/water 80:20+1% ammonia solution.fwdarw.acetonitrile; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm). 220 mg of the desired product was obtained and used without further purification.
(1915) LC-MS (Method 9): R.sub.t=0.26 min; MS (ESIpos): m/z=310 [M+H].sup.+
(1916) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.359 (16.00), 1.754 (0.40), 3.276 (0.68), 3.289 (0.98), 3.441 (0.68), 3.465 (6.39), 3.489 (0.54), 6.419 (0.50), 6.739 (1.49), 7.418 (1.44).
(1917) Intermediate 312
Rac-5-(Aminomethyl)-5-(1-Methyl-1H-Imidazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1918) ##STR00347##
(1919) To a solution of rac-tert-butyl {[4-(1-methyl-1H-imidazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate in dichloromethane (6 ml) were added 890 l (3.6 mmol) of 4M hydrochloric acid in dioxane at RT. The reaction mixture was stirred for 2 h and then concentrated in vacuo. 204 mg of the title compound was used without further purification.
(1920) LC-MS (Method 9): R.sub.t=0.22 min; MS (ESIpos): m/z=210 [MHCl+H].sup.+
(1921) Intermediate 313
Ethyl 5-(1,4-Dimethyl-1H-Imidazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(1922) ##STR00348##
(1923) 1,4-dimethyl-1H-imidazole-5-carboxylic acid (2.00 g, 14.3 mmol) dissolved in 20.5 ml of THE was treated with 1,1,-carbonyl-diimidazole (2.78 g, 17.1 mmol) and stirred at room temperature. After 2 h, ethyl isocyanoacetate (1.7 ml, 16 mmol), dissolved in 20.5 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (14.3 ml, 1.0 M, 14.3 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred overnight and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (110 g Snap NH Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 20%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 1.07 g (96% purity, 30% yield) of the title compound was used without further purification.
(1924) LC-MS (Method 9): R.sub.t=0.93 min; MS (ESIpos): m/z=236 [M+H].sup.+
(1925) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.191 (4.57), 1.203 (9.62), 1.215 (4.51), 1.700 (0.50), 2.024 (16.00), 3.518 (14.03), 3.559 (0.45), 4.213 (1.46), 4.224 (4.53), 4.236 (4.37), 4.248 (1.39), 7.752 (3.50), 8.630 (6.11).
(1926) Intermediate 314
2-Amino-1-(1,4-Dimethyl-1H-Imidazol-5-Yl)Ethanone Hydrochloride
(1927) ##STR00349##
(1928) ethyl 5-(1,4-dimethyl-1H-imidazol-5-yl)-1,3-oxazole-4-carboxylate (1.07 g, 96% purity, 4.35 mmol) was taken up in 14.5 ml (87 mmol) of 6 N hydrochloric acid and stirred for 2 h at 100 C. The resulting mixture was concentrated in vacuo. 1.12 g (82% purity) of the title compound was obtained and used without further purification.
(1929) LC-MS (Method 9): R.sub.t=0.52 min; MS (ESIpos): m/z=154 [MHCl+H].sup.+
(1930) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.980 (0.41), 0.997 (0.86), 1.015 (0.43), 1.125 (0.53), 1.143 (1.10), 1.161 (0.55), 2.174 (1.46), 2.197 (0.51), 2.647 (11.73), 2.703 (0.95), 3.622 (0.44), 3.693 (1.27), 3.886 (1.23), 3.951 (16.00), 3.977 (0.40), 4.378 (2.85), 4.390 (2.84), 5.570 (0.44), 8.592 (2.36), 9.036 (0.84).
(1931) Intermediate 315
Tert-Butyl [2-(1,4-Dimethyl-1H-Imidazol-5-Yl)-2-Oxoethyl]Carbamate
(1932) ##STR00350##
(1933) To a solution of 2-amino-1-(1,4-dimethyl-1H-imidazol-5-yl)ethanone hydrochloride (1.12 g, 82% purity, 4.84 mmol) in dichloromethane (20 ml) was added di-tert-butyl dicarbonate (1.16 g, 5.32 mmol) and triethylamine (5.4 ml, 39 mmol). After 20 h of stirring at RT, the reaction mixture was diluted with dichloromethane and washed with water. After phase separation, the organic phase was dried; concentrated in vacuo and 1.10 g of the title compound was obtained and used without further purification.
(1934) LC-MS (Method 9): R.sub.t=1.17 min; MS (ESIpos): m/z=254 [M+H].sup.+
(1935) Intermediate 316
Rac-Tert-Butyl {[4-(1,4-Dimethyl-1H-Imidazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1936) ##STR00351##
(1937) To a solution of tert-butyl [2-(1,4-dimethyl-1H-imidazol-5-yl)-2-oxoethyl]carbamate (1.10 g, 4.34 mmol) in methanol (16 ml) was added potassium cyanide (1.13 g, 17.4 mmol) and ammonium carbonate (1.67 g, 17.4 mmol) at RT. The reaction mixture was first stirred overnight at 80 C. into a sealed pressure flask. Extra portion of potassium cyanide (566 mg, 8.69 mmol) and ammonium carbonate (835 mg, 8.69 mmol) were added due to incomplete conversion. The reaction mixture was then stirred for 2 days at 80 C.
(1938) After filtration and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo, and then taken up in a mixture of dichloromethane and methanol (1/1). The resulting suspension was filtered through a pad of celite and the filtrates were concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 2.4 g dissolved in acetonitrile, methanol and water; column: XBridge C18 5 m, 10030 mm; eluent: acetonitrile/water+0.07% ammonia solution; elution gradient 7.5%.fwdarw.92%; flow rate: 80 ml/min; UV detection: 210 nm). 134 mg (89% purity, 8% yield) of the desired product was obtained and used without further purification.
(1939) LC-MS (Method 9): R.sub.t=0.41 min; MS (ESIpos): m/z=324 [M+H].sup.+
(1940) Intermediate 317
Rac-5-(Aminomethyl)-5-(1,4-Dimethyl-1H-Imidazol-5-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1941) ##STR00352##
(1942) To a solution of rac-tert-butyl {[4-(1,4-dimethyl-1H-imidazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (134 mg, 89% purity, 368 mol) in dichloromethane (3 ml) were added 460 l of 4M hydrochloric acid (1.8 mmol mmol) in dioxane at RT. After stirring overnight at RT, the precipitate was filtered off, washed with dichloromethane and dried in vacuo. The filtrate was then taken up in water, concentrated and dried in vacuo. 120 mg (93% purity) of the title compound was obtained and used without further purification.
(1943) LC-MS (Method 9): R.sub.t=0.23 min; MS (ESIpos): m/z=224 [MHCl+H].sup.+
(1944) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.760 (1.93), 2.048 (0.62), 2.347 (1.96), 2.419 (0.54), 2.446 (0.42), 2.488 (16.00), 3.691 (0.49), 3.713 (0.85), 3.758 (0.88), 3.782 (0.54), 3.855 (1.74), 3.885 (0.62), 3.906 (0.43), 3.924 (0.62), 3.946 (0.54), 3.954 (0.57), 3.991 (0.56), 4.067 (12.91), 4.102 (0.46), 8.801 (1.30), 9.108 (3.51), 9.405 (1.53), 11.534 (1.99).
(1945) Intermediate 318
Rac-2-Nitro-1-(Pyridin-2-Yl)Ethan-1-Ol
(1946) ##STR00353##
(1947) 0.40 g (2.33 mmol) of barium hydroxide were added to a solution of 5.00 g (46.70 mmol) of pyridine-2-carbaldehyde and 25.00 mL (470.00 mmol) of nitromethane in 140 mL of water and the mixture was stirred at room temperature for 15 min. The reaction was the n extracted three times with ethyl acetate. The combined organic layers were dried over magnesium sulfate, filtered, and concentrated in vacuo to give 7.70 g (98%) of the crude product as a colourless oil.
(1948) The compound was used as such in the next step.
(1949) LC-MS (Method 3): R.sub.t=0.163 min. MS (Mass method 1): m/z=169 (M+H).sup.+
(1950) Intermediate 319
Rac-2-[1-{[Tert-Butyl(Dimethyl)Silyl]Oxy}-2-Nitroethyl]Pyridine
(1951) ##STR00354##
(1952) 24.20 g (160.00 mmol) of tert-butyldimethylsilyl chloride were added to a solution of 7.70 (45.80 mmol) of rac-2-nitro-1-(pyridin-2-yl)ethan-1-ol and 15.60 g (229.00 mmol) of imidazole in 240 m L of N,N-dimethylformamide at 0 C. and the mixture was allowed to stir at room temperature for 14 hours. The solution was diluted with ethyl acetate and washed with water and brine. The organic layer was dried over magnesium sulfate, filtered and evaporated to dryness to yield a residue, which was purified by flash chromatography on silica gel eluting with heptane/ethyl acetate mixtures to afford 11.85 g (92%) of the product as a colourless oil.
(1953) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.10 (s, 3H), 0.01 (s, 3H), 0.82 (s, 9H), 4.75 (dd, 1H), 4.95 (dd, 1H), 5.43 (dd, 1H), 7.36 (dd, 1H), 7.54 (d, 1H), 7.88 (t, 1H), 8.56 (d, 1H).
(1954) LC-MS (Method 3): R.sub.t=1.078 min. MS (Mass method 1): m/z=283 (M+H).sup.+
(1955) Intermediate 320
Rac-2-{[Tert-Butyl(Dimethyl)Silyl]Oxy}-2-(Pyridin-2-Yl)Ethan-1-Amine
(1956) ##STR00355##
(1957) A mixture of 11.80 g (41.90 mmol) of rac-2-[1-{[tert-butyl(dimethyl)silyl]oxy}-2-nitroethyl]pyridine and 0.04 g (0.42 mmol) of palladium on carbon (10% loading, Degussa type, wet basis) in 50 mL of methanol was stirred under hydrogen atmosphere at room temperature for 12 hours. After that time, the catalyst was removed by filtration through a pad of celite and the cake was thoroughly washed with methanol. Evaporation of the solvent furnished a residue which was purified by flash chromatography on silica gel eluting with dichloromethane/methanol mixtures to afford 4.52 g (43%) of the product as a colourless oil.
(1958) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=0.08 (s, 3H), 0.06 (s, 3H), 0.87 (s, 9H), 2.74 (ddd, 2H), 4.66 (dd, 1H), 7.25 (dd, 1H), 7.41 (d, 1H), 7.78 (t, 1H), 8.48 (d, 1H).
(1959) LC-MS (Method 3): R.sub.t=0.642 min. MS (Mass method 1): m/z=253 (M+H).sup.+
(1960) Intermediate 321
Rac-Tert-Butyl [2-{[Tert-Butyl(Dimethyl)Silyl]Oxy}-2-(Pyridin-2-Yl)Ethyl]Carbamate
(1961) ##STR00356##
(1962) 4.30 mL (19.00 mmol) of di-tert-butyl dicarbonate were added to a solution of 4.51 g (17.90 mmol) of rac-2-{[tert-butyl(dimethyl)silyl]oxy}-2-(pyridin-2-yl)ethanamine in 20 mL of dichloromethane and the mixture was stirred at room temperature for 12 hours. The reaction was washed with water and brine and the organic layer was dried over magnesium sulfate, filtered and evaporated to dryness to afford 6.31 g (99%) of the crude product as a light yellow oil. The compound was used as such in the next synthetic step.
(1963) LC-MS (Method 3): R.sub.t=1.084 min. MS (Mass method 1): m/z=353 (M+H).sup.+
(1964) Intermediate 322
Rac-Tert-Butyl [2-Hydroxy-2-(Pyridin-2-Yl)Ethyl]Carbamate
(1965) ##STR00357##
(1966) 27.00 mL (27.00 mmol) of 1 N tetra-n-butylammonium fluoride in tetrahydrofuran was added dropwise to a stirred solution of 6.31 g (17.90 mmol) of rac-tert-Butyl [2-{[tert-butyl(dimethyl)silyl]oxy}-2-(pyridin-2-yl)ethyl]carbamate in 100 mL of tetrahydrofuran and the mixture was stirred at room temperature for 14 hours. After that time, the solution was poured onto 50 mL of water, and extracted with ethyl acetate. The combined organic extracts were washed successively with water and brine, dried over magnesium sulfate, and concentrated in vacuo to furnish 4.26 g (99%) of the crude product as a colourless thick oil. The compound was used as such in the next step.
(1967) LC-MS (Method 3): R.sub.t=0.201 min. MS (Mass method 1): m/z=239 (M+H).sup.+
(1968) Intermediate 323
Tert-Butyl [2-Oxo-2-(Pyridin-2-Yl)Ethyl]Carbamate
(1969) ##STR00358##
(1970) 1.19 mL (16.90 mmol) of dimethyl sulfoxide were added drop wise to a solution of 0.73 mL (8.39 mmol) of oxalyl chloride in 20 mL of anhydrous dichloromethane at 78 C. and the mixture was stirred under nitrogen atmosphere under these conditions for 30 min. 1.00 g (4.20 mmol) of rac-tert-Butyl [2-hydroxy-2-(pyridin-2-yl)ethyl]carbamate was added to the cold solution and the resulting mixture was stirred for 15 additional min. After that, 2.92 mL (20.98 mmol) of triethylamine were added and the reaction was allowed to stir at 0 C. for 30 min. Finally, the mixture was diluted with ethyl acetate and the organic layer was washed once with water and brine, dried over magnesium sulfate, filtered and concentrated in vacuo. Flash chromatography of the resulting residue using heptane/ethyl acetate mixtures as eluent gave 0.41 g (41%) of the product as a light brown solid.
(1971) .sup.1H-NMR (300 MHz, DMSO-d.sub.6): [ppm]=1.39 (s, 9H), 4.58 (d, 2H), 7.00 (t, 1H), 7.70 (dd, 1H), 7.93-8.08 (m, 2H), 8.73 (d, 1H).
(1972) LC-MS (Method 3): R.sub.t=0.661 min. MS (Mass method 1): m/z=181 (MtBu+H).sup.+
(1973) Intermediate 324
Rac-Tert-Butyl {[2,5-Dioxo-4-(Pyridin-2-Yl)Imidazolidin-4-Yl]Methyl}Carbamate
(1974) ##STR00359##
(1975) To a stirring solution of 3.29 g (34.30 mmol) of ammonium carbonate and 0.49 g (9.14 mmol) of ammonium chloride in 6 mL of water was added 0.54 g (2.29 mmol) of tert-butyl [2-oxo-2-(pyridin-2-yl)ethyl]carbamate in 6 mL of ethanol. After 15 min, 0.67 g (10.30 mmol) of potassium cyanide were added and the mixture was heated up to 60 C. for 16 hours into a sealed pressure flask. The yellow solution was concentrated until only a small fraction of water remained (a white precipitate appeared). Then, more water was added and the suspension was allowed to stand at 0 C. for 2 hour. After that time, the resulting solid was filtered off and washed with cold water and diethyl ether to give 0.70 g (98%) of the product as an off-white powder. The compound was used as such in the next step.
(1976) LC-MS (Method 3): R.sub.t=0.466 min. MS (Mass method 1): m/z=307 (M+H).sup.+
(1977) Intermediate 325
Rac-5-(Aminomethyl)-5-(Pyridin-2-Yl)Imidazolidine-2,4-Dione Hydrochloride
(1978) ##STR00360##
(1979) 2.90 mL (11.00 mmol) of 4N hydrochloric acid in dioxane were added to a solution of 0.70 g (2.29 mmol) of rac-tert-Butyl {[2,5-dioxo-4-(pyridin-2-yl)imidazolidin-4-yl]methyl}carbamate in 10 mL of dichloromethane and the mixture was allowed to stir at room temperature for 16 hours.
(1980) The resulting precipitate was collected by filtration and washed with dichloromethane, ethyl acetate and diethyl ether to give 0.55 g (99%) of the product as a white solid. The compound was used as such in the next step.
(1981) LC-MS (Method 3): R.sub.t=0.091 min. MS (Mass method 1): m/z=207 (M+H).sup.+
(1982) Intermediate 326
Ethyl 5-(2-Methyl-2H-Indazol-3-Yl)-1,3-Oxazole-4-Carboxylate
(1983) ##STR00361##
(1984) 2-methyl-2H-indazole-3-carboxylic acid (5.00 g, 28.4 mmol) dissolved in 41 ml of THE was treated with 1,1,-carbonyl-diimidazole (5.52 g, 34.1 mmol) and stirred at room temperature. After 2 h, ethyl isocyanoacetate (3.4 ml, 31 mmol), dissolved in 41 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (28.4 ml, 1.0 M, 28.4 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred overnight and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (340 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 16%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 5.12 g (97% purity, 65% yield) of the title compound was used without further purification.
(1985) LC-MS (Method 9): R.sub.t=1.32 min; MS (ESIpos): m/z=272 [M+H].sup.+
(1986) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.058 (4.12), 1.070 (8.63), 1.081 (4.09), 1.176 (0.56), 1.988 (1.02), 4.136 (16.00), 4.171 (1.29), 4.183 (4.05), 4.195 (4.05), 4.207 (1.24), 7.165 (0.80), 7.166 (0.79), 7.177 (0.98), 7.178 (1.02), 7.179 (0.98), 7.181 (0.89), 7.191 (0.99), 7.334 (0.84), 7.336 (0.87), 7.345 (0.80), 7.347 (0.86), 7.349 (0.99), 7.350 (0.93), 7.360 (0.82), 7.361 (0.77), 7.522 (1.70), 7.536 (1.56), 7.718 (1.72), 7.733 (1.62), 8.812 (5.48).
(1987) Intermediate 327
2-Amino-1-(2-Methyl-2H-Indazol-3-Yl)Ethanone Hydrochloride
(1988) ##STR00362##
(1989) ethyl 5-(2-methyl-2H-indazol-3-yl)-1,3-oxazole-4-carboxylate (5.12 g, 97% purity, 18.3 mmol) was taken up in 61 ml (370 mmol) of 6 N hydrochloric acid and stirred for 2 h at 100 C. The resulting mixture was concentrated in vacuo. 5.19 g (38% purity, 48% yield) of the title compound was obtained and used without further purification.
(1990) LC-MS (Method 9): R.sub.t=0.99 min; MS (ESIpos): m/z=190 [M+H].sup.+
(1991) Intermediate 328
Tert-Butyl [2-(2-Methyl-2H-Indazol-3-Yl)-2-Oxoethyl]Carbamate
(1992) ##STR00363##
(1993) To a solution of 2-amino-1-(2-methyl-2H-indazol-3-yl)ethanone hydrochloride (5.19 g, 38% purity, 8.77 mmol) in dichloromethane (40 ml) was added di-tert-butyl dicarbonate (2.11 g, 9.65 mmol) and triethylamine (9.8 ml, 70 mmol). After overnight stirring at RT, the reaction mixture was diluted with dichloromethane and washed with water. After phase separation, the organic phase was dried; concentrated in vacuo and 5.06 g (28% purity, 56% yield) of the title compound was obtained and used without further purification.
(1994) LC-MS (Method 9): R.sub.t=1.56 min; MS (ESIpos): m/z=290 [M+H].sup.+
(1995) Intermediate 329
Rac-Tert-Butyl {[4-(2-Methyl-2H-Indazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(1996) ##STR00364##
(1997) To a solution of tert-butyl [2-(2-methyl-2H-indazol-3-yl)-2-oxoethyl]carbamate (5.06 g, 28% purity, 4.88 mmol) in methanol (18 ml) was added potassium cyanide (1.27 g, 19.5 mmol) and ammonium carbonate (1.87 g, 19.5 mmol) at RT. The reaction mixture was first stirred overnight at 80 C. into a sealed pressure flask. Extra portion of potassium cyanide (635 mg, 9.75 mmol) and ammonium carbonate (937 mg, 9.75 mmol) were added due to incomplete conversion. The reaction mixture was then stirred for 2 days at 80 C.
(1998) After filtration and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo, and then taken up in a mixture of dichloromethane and methanol (1/1). The resulting suspension was filtered through a pad of celite and the filtrates were concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 1.23 g dissolved in acetonitrile, methanol and water; column: XBridge C18 5 m, 10030 mm; eluent: acetonitrile/water+0.07% ammonia solution; elution gradient 7.5%.fwdarw.92%; flow rate: 80 ml/min; UV detection: 210 nm). 164 mg (98% purity, 9% yield) of the desired product was obtained and used without further purification.
(1999) LC-MS (Method 7): R.sub.t=1.27 min; MS (ESIpos): m/z=360 [M+H].sup.+
(2000) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.355 (16.00), 1.379 (2.50), 1.756 (0.41), 2.101 (0.81), 4.037 (0.51), 4.049 (0.74), 4.256 (15.15), 7.037 (0.79), 7.049 (1.00), 7.051 (0.93), 7.062 (0.90), 7.123 (0.48), 7.212 (0.96), 7.225 (0.95), 7.227 (1.09), 7.238 (0.92), 7.562 (1.80), 7.577 (1.65), 7.822 (0.96), 7.836 (0.92).
(2001) Intermediate 330
Rac-5-(Aminomethyl)-5-(2-Methyl-2H-Indazol-3-Yl)Imidazolidine-2,4-Dione Hydrochloride
(2002) ##STR00365##
(2003) To a solution of rac-tert-butyl {[4-(2-methyl-2H-indazol-3-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (164 mg, 98% purity, 447 mol) in dichloromethane (2.4 ml) were added 560 l of 4M hydrochloric acid (2.2 mmol) in dioxane at RT. The reaction mixture was stirred for 2 h at room temperature. Extra portion of 4M hydrochloric acid (340 l, 4.0 M, 1.3 mmol) was added due to incomplete conversion. After stirring overnight at RT, the precipitate was filtered off, washed with dichloromethane. The filtrate was then taken up in water, concentrated and dried in vacuo. 133 mg (96% purity, 97% yield) of the title compound was obtained and used without further purification.
(2004) LC-MS (Method 9): R.sub.t=0.25 min; MS (ESIneg): m/z=258 [MHClH].sup.
(2005) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.771 (0.77), 2.119 (1.16), 3.482 (0.44), 3.492 (0.43), 3.914 (1.49), 4.368 (16.00), 4.875 (1.13), 7.083 (1.03), 7.095 (1.35), 7.097 (1.26), 7.108 (1.18), 7.245 (1.17), 7.259 (1.40), 7.270 (1.10), 7.601 (2.21), 7.615 (2.01), 7.809 (2.12), 7.823 (2.04), 8.672 (2.17), 9.331 (2.38), 11.489 (2.08).
(2006) Intermediate 331
Methyl 4-Chloro-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzoate
(2007) ##STR00366##
(2008) To a suspension of [6-(trifluoromethyl)pyridin-3-yl]boronic acid (750 mg, 3.93 mmol) and methyl 2-bromo-4-chlorobenzoate (1.23 g, 4.91 mmol) in 1,2-dimethoxyethane (22 ml) was added, under argon, a solution of sodium carbonate in water (9.8 ml, 2.0 M, 20 mmol) and Tetrakis(triphenylphosphine)palladium(0) (228 mg, 196 mol). The reaction mixture was first stirred for 8 h at 90 C., then for 2 days at RT. The reaction mixture was diluted with ethyl acetate and washed with water. After phase separation, the combined organic phases were washed with brine, dried and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 8f). After lyophilization, 814 mg (100% purity, 66% yield) of the desired product were obtained.
(2009) LC-MS (Method 7): R.sub.t=2.15 min; MS (ESIpos): m/z=316 [M+H].sup.+
(2010) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.655 (16.00), 7.648 (2.33), 7.651 (2.60), 7.701 (1.53), 7.705 (1.30), 7.715 (1.64), 7.719 (1.45), 7.954 (1.37), 7.967 (1.77), 7.992 (2.61), 8.006 (2.37), 8.058 (0.93), 8.061 (0.91), 8.072 (0.71), 8.075 (0.71), 8.724 (1.44), 8.727 (1.41).
(2011) Intermediate 332
4-Chloro-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzoic Acid
(2012) ##STR00367##
(2013) To a solution of methyl 4-chloro-2-[6-(trifluoromethyl)pyridin-3-yl]benzoate (774 mg, 2.45 mmol)
(2014) In THF (33 ml) was added a solution of lithium hydroxide in water (12.3 ml, 1.0 M, 12.3 mmol). The reaction mixture was stirred for 3 days at RT then diluted with a small amount of water and acidified with 1 N aqueous HCl. The resulting mixture was washed 3 times with ethyl acetate, dried and concentrated in vacuo. 720 mg (100% purity, 97% yield) of the desired product were obtained,
(2015) LC-MS (Method 8): R.sub.t=0.94 min; MS (ESIpos): m/z=302 [M+H].sup.+
(2016) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.007 (0.60), 0.006 (0.44), 1.161 (0.51), 1.170 (1.18), 1.175 (1.02), 1.182 (0.83), 1.189 (0.49), 1.760 (0.44), 1.988 (1.70), 3.601 (0.42), 7.594 (12.81), 7.598 (14.13), 7.658 (7.93), 7.663 (6.76), 7.675 (8.53), 7.679 (7.62), 7.948 (7.61), 7.962 (16.00), 7.979 (11.50), 8.063 (5.29), 8.067 (5.11), 8.079 (3.94), 8.083 (3.88), 8.725 (8.48), 8.729 (8.11).
(2017) Intermediate 333
Methyl 4-Fluoro-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzoate
(2018) ##STR00368##
(2019) To a suspension of [6-(trifluoromethyl)pyridin-3-yl]boronic acid (750 mg, 3.93 mmol) and methyl 2-bromo-4-fluorobenzoate (1.14 g, 4.91 mmol) in 1,2-dimethoxyethane (22 ml) was added, under argon, a solution of sodium carbonate in water (9.8 ml, 2.0 M, 20 mmol) and Tetrakis(triphenylphosphine)palladium(0) (228 mg, 196 mol). The reaction mixture was stirred for 8 h at 90 C., then diluted with ethyl acetate and washed with water. After phase separation, the combined organic phases were washed with brine, dried and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 2f). After lyophilization, 986 mg (100% purity, 84% yield) of the desired product were obtained.
(2020) LC-MS Method 7): R.sub.t=2.02 min, MS (ESIpos): m/z=300 [M+H].sup.+
(2021) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.552 (0.46), 3.650 (16.00), 7.445 (0.84), 7.449 (1.26), 7.465 (1.47), 7.477 (1.30), 7.481 (0.98), 7.491 (0.68), 7.496 (0.55), 7.957 (1.64), 7.970 (2.17), 8.049 (1.13), 8.053 (1.76), 8.064 (1.79), 8.068 (1.31), 8.078 (1.05), 8.721 (1.69), 8.724 (1.69).
(2022) Intermediate 334
4-Fluoro-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzoic Acid
(2023) ##STR00369##
(2024) To a solution of methyl 4-fluoro-2-[6-(trifluoromethyl)pyridin-3-yl]benzoate (937 mg, 3.13 mmol) in THF (42 ml) was added a solution of lithium hydroxide in water (15.6 ml, 1.0 M, 15.6 mmol). The reaction mixture was stirred for 3 days at RT then diluted with a small amount of water and acidified with 1 N aqueous HCl. The resulting mixture was washed 3 times with ethyl acetate, dried and concentrated in vacuo. 832 mg (100% purity, 93% yield) of the desired product were obtained,
(2025) LC-MS (Method 7): R.sub.t=1.65 min; MS (ESIpos): m/z=286 [M+H].sup.+
(2026) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.007 (0.80), 0.006 (0.71), 1.170 (3.83), 1.271 (0.62), 6.580 (0.55), 7.392 (8.00), 7.398 (11.16), 7.411 (8.11), 7.417 (10.86), 7.424 (6.03), 7.430 (4.92), 7.441 (10.47), 7.447 (8.72), 7.458 (5.87), 7.464 (5.01), 7.550 (0.74), 7.556 (0.70), 7.564 (0.79), 7.571 (0.69), 7.603 (0.95), 7.616 (0.89), 7.623 (1.01), 7.626 (1.17), 7.642 (0.76), 7.953 (11.78), 7.969 (16.00), 8.035 (9.28), 8.047 (9.92), 8.053 (14.07), 8.058 (9.07), 8.064 (9.77), 8.071 (6.26), 8.074 (6.18), 8.723 (13.16), 8.727 (12.86), 13.054 (1.84).
(2027) Intermediate 335
Methyl 5-Fluoro-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzoate
(2028) ##STR00370##
(2029) To a suspension of [6-(trifluoromethyl)pyridin-3-yl]boronic acid (750 mg, 3.93 mmol) and methyl 2-bromo-5-fluorobenzoate (1.14 g, 4.91 mmol) in 1,2-dimethoxyethane (22 ml) was added, under argon, a solution of sodium carbonate in water (9.8 ml, 2.0 M, 20 mmol) and Tetrakis(triphenylphosphine)palladium(0) (228 mg, 196 mol). The reaction mixture was first stirred for 8 h at 90 C., then for 2 days at RT. The reaction mixture was diluted with ethyl acetate and washed with water. After phase separation, the combined organic phases were washed with brine, dried and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 841 mg (100% purity, 72% yield) of the desired product were obtained.
(2030) LC-MS (Method 7): R.sub.t=2.00 min; MS (ESIpos): m/z=300 [M+H].sup.+
(2031) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.672 (16.00), 7.579 (0.54), 7.589 (0.65), 7.594 (1.50), 7.603 (1.47), 7.607 (0.93), 7.612 (0.96), 7.621 (1.06), 7.626 (1.15), 7.640 (0.41), 7.764 (1.00), 7.768 (0.99), 7.779 (1.04), 7.784 (1.00), 7.945 (1.31), 7.958 (1.86), 8.018 (0.97), 8.022 (0.95), 8.032 (0.68), 8.035 (0.68), 8.695 (1.42), 8.698 (1.41).
(2032) Intermediate 336
5-Fluoro-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzoic Acid
(2033) ##STR00371##
(2034) To a solution of methyl 5-fluoro-2-[6-(trifluoromethyl)pyridin-3-yl]benzoate (785 mg, 2.62 mmol) in THF (35 ml) was added a solution of lithium hydroxide in water (13.1 ml, 1.0 M, 13.1 mmol).
(2035) The reaction mixture was stirred for 3 days at RT then diluted with a small amount of water and acidified with 1 N aqueous HCl. The resulting mixture was washed 3 times with ethyl acetate, dried and concentrated in vacuo. 742 mg (100% purity, 99% yield) of the desired product were obtained.
(2036) LC-MS (Method 8): R.sub.t=0.85 min, MS (ESIpos): m/z=286 [M+H].sup.+
(2037) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.007 (0.42), 1.161 (0.45), 1.175 (0.92), 1.189 (0.47), 1.760 (0.65), 1.988 (1.59), 3.602 (0.56), 7.530 (2.49), 7.541 (3.71), 7.546 (10.63), 7.553 (8.00), 7.558 (16.00), 7.569 (7.10), 7.575 (7.56), 7.587 (1.77), 7.592 (2.30), 7.722 (6.44), 7.727 (6.19), 7.741 (6.79), 7.746 (6.37), 7.941 (8.95), 7.942 (9.22), 7.957 (12.91), 7.959 (12.92), 8.026 (6.97), 8.030 (6.63), 8.043 (4.67), 8.046 (4.59), 8.699 (10.47), 8.704 (10.03).
(2038) Intermediate 337
Ethyl 5-(3-Fluorobicyclo[1.1.1]Pentan-1-Yl)-1,3-Oxazole-4-Carboxylate
(2039) ##STR00372##
(2040) 3-fluorobicyclo[1.1.1]pentane-1-carboxylic acid (5.00 g, 38.4 mmol) dissolved in 55 ml of THE was treated with 1,1,-carbonyl-diimidazole (7.48 g, 46.1 mmol) and stirred at room temperature. After 2 h, ethyl isocyanoacetate (4.6 ml, 42 mmol), dissolved in 55 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (38.4 ml, 1.0 M, 38.4 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred for 5 days and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (340 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 16%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 5.60 g (71% purity, 46% yield) of the title compound was used without further purification.
(2041) LC-MS (Method 9): R.sub.t=1.44 min; MS (ESIpos): m/z=226 [M+H].sup.+
(2042) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.285 (7.64), 1.303 (16.00), 1.321 (7.74), 2.322 (1.14), 2.595 (5.82), 2.602 (5.79), 4.266 (2.49), 4.284 (7.72), 4.301 (7.60), 4.319 (2.39), 8.430 (7.28), 8.590 (1.67).
(2043) Intermediate 338
2-Amino-1-(3-Fluorobicyclo[1.1.1]Pentan-1-Yl)Ethanone Hydrochloride
(2044) ##STR00373##
(2045) ethyl 5-(3-fluorobicyclo[1.1.1]pentan-1-yl)-1,3-oxazole-4-carboxylate (5.73 g, 71% purity, 18.0 mmol) was taken up in 60 ml (360 mmol) of 6 N hydrochloric acid and stirred for 2 h at 100 C. The resulting mixture was concentrated in vacuo. 4.30 g of the title compound was obtained and used without further purification.
(2046) LC-MS (Method 9): R.sub.t=0.82 min; MS (ESIpos): m/z=144 [MHCl+H].sup.+
(2047) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.64), 0.007 (0.51), 0.008 (0.77), 1.242 (0.78), 1.260 (1.63), 1.278 (0.80), 1.909 (4.05), 2.292 (0.48), 2.299 (0.49), 2.408 (15.91), 2.415 (16.00), 2.484 (2.16), 4.039 (1.63), 4.251 (0.51), 4.269 (0.49), 5.436 (0.42), 8.264 (0.65).
(2048) Intermediate 339
Tert-Butyl [2-(3-Fluorobicyclo[1.1.1]Pentan-1-Yl)-2-Oxoethyl]Carbamate
(2049) ##STR00374##
(2050) To a solution of 2-amino-1-(3-fluorobicyclo[1.1.1]pentan-1-yl)ethanone hydrochloride (4.30 g, 23.9 mmol) in dichloromethane (110 ml) was added di-tert-butyl dicarbonate (5.75 g, 26.3 mmol) and triethylamine (27 ml, 190 mmol). After overnight stirring at RT, the reaction mixture was diluted with dichloromethane and washed with water. After phase separation, the organic phase was dried, concentrated in vacuo and 3.96 g of the unpurified compound was obtained and used without further purification.
(2051) Intermediate 340
Rac-Tert-Butyl {[4-(3-Fluorobicyclo[1.1.1]Pentan-1-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(2052) ##STR00375##
(2053) To a solution of tert-butyl [2-(3-fluorobicyclo[1.1.1]pentan-1-yl)-2-oxoethyl]carbamate (3.96 g, 16.3 mmol) in methanol (62 ml) was added potassium cyanide (4.24 g, 65.1 mmol) and ammonium carbonate (6.26 g, 65.1 mmol) at RT. The reaction mixture was stirred overnight at 80 C. into a sealed pressure flask. After filtration through celite and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 7.4 g dissolved in DMSO/water/methanol; column: XBridge C18 5 m, 10030 mm; eluent: acetonitrile/water 7.5:92.5.fwdarw.acetonitrile/water 35:65+1% ammonia solution.fwdarw.acetonitrile; flow rate: 80 ml/min; temperature: 30 C.; UV detection: 210 nm). 786 mg (100% purity, 15% yield) of the desired product was obtained and used without further purification.
(2054) LC-MS (Method 7): R.sub.t=1.25 min; MS (ESIneg): m/z=312 [MH].sup.
(2055) .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 10.63 (bs, 1H), 7.69 (bs, 1H), 6.70-6.94 (m, 1H), 3.17-3.26 (m, 2H), 1.93-2.08 (m, 6H), 1.37 (s, 9H).
(2056) Intermediate 341
Rac-5-(Aminomethyl)-5-(3-Fluorobicyclo[1.1.1]Pentan-1-Yl)Imidazolidine-2,4-Dione Hydrochloride
(2057) ##STR00376##
(2058) To a solution of rac-tert-butyl {[4-(3-fluorobicyclo[1.1.1]pentan-1-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (786 mg, 2.51 mmol) in dichloromethane (19 ml) were added 3.1 ml of 4M hydrochloric acid (12.5 mmol) in dioxane at RT. The reaction mixture was stirred for 6 h at room temperature. Extra portion of 4M hydrochloric acid (310 l, 4.0 M, 1.3 mmol) was added due to incomplete conversion. After stirring overnight at RT, the precipitate was filtered off, washed with dichloromethane and dried in vacuo. 626 mg (100% purity, 99.9% yield) of the title compound was obtained and used without further purification.
(2059) LC-MS (Method 9): R.sub.t=0.26 min; MS (ESIpos): m/z=214 [MHCl+H].sup.+
(2060) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 2.061 (16.00), 2.066 (15.48), 2.918 (0.88), 2.945 (1.09), 3.124 (1.16), 3.151 (0.90), 5.756 (5.27), 8.227 (3.01), 8.406 (2.45), 11.074 (1.71).
(2061) Intermediate 342
Ethyl 5-[5-Methyl-2-(Trifluoromethyl)-1,3-Thiazol-4-Yl]-1,3-Oxazole-4-Carboxylate
(2062) ##STR00377##
(2063) 5-methyl-2-(trifluoromethyl)-1,3-thiazole-4-carboxylicacid (2.00 g, 9.47 mmol) dissolved in 15 ml of THE was treated with 1,1,-carbonyl-diimidazole (1.84 g, 11.4 mmol) and stirred at room temperature. After 2 h, ethyl isocyanoacetate (1.1 ml, 10 mmol), dissolved in 15 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (9.47 ml, 1.0 M, 9.47 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred for 2 h at room temperature, then stored overnight at 20 C. and finally concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. 2.63 g (84% purity, 76% yield) of the title compound was used without further purification.
(2064) LC-MS (Method 7): R.sub.t=1.76 min; MS (ESIpos): m/z=307 [M+H].sup.+
(2065) Intermediate 343
2-Amino-1-[5-Methyl-2-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Ethanone Hydrochloride
(2066) ##STR00378##
(2067) ethyl 5-[5-methyl-2-(trifluoromethyl)-1,3-thiazol-4-yl]-1,3-oxazole-4-carboxylate (2.63 g, 84% purity, 7.21 mmol) was taken up in 52 ml (310 mmol) of 6 N hydrochloric acid and stirred for 3 h at 100 C. The resulting mixture was concentrated in vacuo and 2.80 g (65% purity) of the title compound was obtained and used without further purification.
(2068) LC-MS (Method 9): R.sub.t=1.26 min; MS (ESIpos): m/z=225 [MHCl+H].sup.+
(2069) Intermediate 344
Tert-Butyl {2-[5-Methyl-2-(Trifluoromethyl)-1,3-Thiazol-4-Yl]-2-Oxoethyl}Carbamate
(2070) ##STR00379##
(2071) To a solution of 2-amino-1-[5-methyl-2-(trifluoromethyl)-1,3-thiazol-4-yl]ethanone hydrochloride (1.22 g, 65% purity, 3.01 mmol) in dichloromethane (15 ml) was added di-tert-butyl dicarbonate (723 mg, 3.31 mmol) and triethylamine (2.5 ml, 18 mmol). The reaction mixture was stirred for 3 h at RT, diluted with dichloromethane and washed with water. After phase separation, the organic phase was dried; concentrated in vacuo and 1.09 g of the title compound was obtained and used without further purification.
(2072) LC-MS (Method 9): R.sub.t=1.78 min; MS (ESIneg): m/z=323 [MH].sup.
(2073) Intermediate 345
Rac-Tert-Butyl({4-[5-Methyl-2-(Trifluoromethyl)-1,3-Thiazol-4-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)Carbamate
(2074) ##STR00380##
(2075) To a solution of tert-butyl {2-[5-methyl-2-(trifluoromethyl)-1,3-thiazol-4-yl]-2-oxoethyl}carbamate (1.09 g, 3.36 mmol) in methanol (20 ml) was added potassium cyanide (875 mg, 13.4 mmol) and ammonium carbonate (1.29 g, 13.4 mmol) at RT. The reaction mixture was stirred for 5 h at 60 C. into a sealed pressure flask. After filtration through celite and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 1.2 g dissolved in water/acetonitrile; column: XBridge C18 5 m, 10030 mm; eluent: acetonitrile/water/1% ammonia solution 1:94:5.fwdarw.acetonitrile/water 52:43+1% ammonia solution.fwdarw.acetonitrile+1% ammonia solution; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm). 330 mg (100% purity, 25% yield) of the desired product was obtained and used without further purification.
(2076) LC-MS (Method 7): R.sub.t=1.58 min; MS (ESIneg): m/z=393 [MH].sup.
(2077) Intermediate 346
Rac-5-(Aminomethyl)-5-[5-Methyl-2-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Imidazolidine-2,4-Dione Hydrochloride
(2078) ##STR00381##
(2079) To a solution of rac-tert-butyl({4-[5-methyl-2-(trifluoromethyl)-1,3-thiazol-4-yl]-2,5-dioxoimidazolidin-4-yl}methyl)carbamate (330 mg, 837 mol) in dichloromethane (7.2 ml) were added 1.05 ml of 4M hydrochloric acid (4.2 mmol) in dioxane at RT. The reaction mixture was stirred overnight at room temperature. Extra portion of 4M hydrochloric acid (1.05 ml, 4.0 M, 4.2 mmol) was added due to incomplete conversion. After stirring at RT then for 30 min at 40 C., the resulting mixture was concentrated in vacuo. 276 mg (90% purity, 90% yield) of the title compound was obtained and used without further purification.
(2080) LC-MS (Method 11): R.sub.t=0.41 min; MS (ESIneg): m/z=293 [MHClH].sup.
(2081) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.367 (0.88), 1.755 (2.19), 2.113 (5.64), 2.516 (16.00), 3.568 (0.51), 3.581 (0.92), 3.604 (1.29), 3.690 (1.35), 3.711 (0.91), 8.439 (3.07), 8.590 (0.58), 8.808 (4.23), 9.005 (0.55), 11.524 (2.03).
(2082) Intermediate 347
Ethyl 5-(1,5-Dimethyl-1H-Imidazol-4-Yl)-1,3-Oxazole-4-Carboxylate
(2083) ##STR00382##
(2084) 1,5-dimethyl-1H-imidazole-4-carboxylic acid (2.50 g, 17.8 mmol) dissolved in 26 ml of THE was treated with 1,1,-carbonyl-diimidazole (3.47 g, 21.4 mmol) and stirred at room temperature. After 2 h, ethyl isocyanoacetate (2.1 ml, 20 mmol), dissolved in 26 ml of THF, and a solution of lithium bis(trimethylsilyl)amide in THF (17.8 ml, 1.0 M, 17.8 mmol) were added at 0 C. The mixture was allowed to warm to room temperature, stirred overnight and then concentrated in vacuo. The residue was taken up with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (50 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 20%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 3.19 g of the non pure compound was used without further purification.
(2085) Intermediate 348
2-Amino-1-(1,5-Dimethyl-1H-Imidazol-4-Yl)Ethanone Hydrochloride
(2086) ##STR00383##
(2087) ethyl 5-(1,5-dimethyl-1H-imidazol-4-yl)-1,3-oxazole-4-carboxylate (3.19 g) was taken up in 45 ml, (6.0 M, 270 mmol) of 6 N hydrochloric acid and stirred for 2 h at 100 C. The resulting mixture was concentrated in vacuo and 2.55 g of the title compound was obtained and used without further purification.
(2088) LC-MS (Method 9): R.sub.t=0.64 min; MS (ESIpos): m/z=153 [MHCl+H].sup.+
(2089) Intermediate 349
Tert-Butyl [2-(1,5-Dimethyl-1H-Imidazol-4-Yl)-2-Oxoethyl]Carbamate
(2090) ##STR00384##
(2091) To a solution of 2-amino-1-(1,5-dimethyl-1H-imidazol-4-yl)ethanone hydrochloride (2.50 g, 13.2 mmol) in dichloromethane (88 ml) was added di-tert-butyl dicarbonate (2.88 g, 13.2 mmol) and triethylamine (15 ml, 110 mmol). The reaction mixture was stirred overnight at RT, diluted with dichloromethane and washed with water. After phase separation, the organic phase was dried; concentrated in vacuo and 2.06 g of the crude compound was obtained and used without further purification.
(2092) Intermediate 350
Rac-Tert-Butyl {[4-(1,5-Dimethyl-1H-Imidazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}Carbamate
(2093) ##STR00385##
(2094) To a solution of tert-butyl [2-(1,5-dimethyl-1H-imidazol-4-yl)-2-oxoethyl]carbamate (2.06 g, 8.12 mmol) in methanol (31 ml) was added potassium cyanide (2.11 g, 32.5 mmol) and ammonium carbonate (3.12 g, 32.5 mmol) at RT. The reaction mixture was first stirred for 8 h at 80 C., then for 2 days at RT, into a sealed pressure flask. Due to incomplete conversion, the reaction mixture was further stirred at 80 C. for 24 h. After filtration through celite and washing of the suspension with methanol at RT, the resulting filtrate was concentrated in vacuo. The residue was purified by preparative HPLC (sample preparation: 4.27 g dissolved in water/acetonitrile; column: XBridge C18 5 m, 10030 mm; eluent: acetonitrile/water/1% ammonia solution 1:94:5.fwdarw.acetonitrile/water 36:59+1% ammonia solution.fwdarw.acetonitrile+1% ammonia solution; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm). 810 mg (100% purity, 31% yield) of the desired product was obtained and used without further purification.
(2095) LC-MS (Method 9): R.sub.t=0.45 min; MS (ESIpos): m/z=324 [M+H].sup.+
(2096) .sup.1H NMR (600 MHz, DMSO-d.sub.6) ppm 10.6 (bs, 1H), 7.88 (s, 1H), 7.48 (s, 1H), 6.44-6.59 (m, 1H), 3.61-3.84 (m, 2H), 3.49 (s, 3H), 2.05 (s, 3H), 1.36 (s, 9H).
(2097) Intermediate 351
Rac-5-(Aminomethyl)-5-(1,5-Dimethyl-1H-Imidazol-4-Yl)Imidazolidine-2,4-Dione Hydrochloride
(2098) ##STR00386##
(2099) To a solution of rac-tert-butyl {[4-(1,5-dimethyl-1H-imidazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}carbamate (810 mg, 2.50 mmol) in dichloromethane (22 ml) were added 3.1 ml of 4M hydrochloric acid (12.5 mmol) in dioxane at RT. The reaction mixture was stirred overnight at room temperature, concentrated in vacuo and dried. 919 mg of the title compound was obtained and used without further purification.
(2100) LC-MS (Method 9): R.sub.t=0.22 min, MS (ESIpos): m/z=224 [M+H].sup.+
(2101) .sup.1H NMR (600 MHz, DMSO-d.sub.6) ppm 11.46 (s, 1H), 9.20 (s, 1H), 9.02 (s, 1H), 8.76 (bs, 3H), 3.59-3.75 (m, 5H), 2.35 (s, 3H).
(2102) Intermediate 352
Ethyl 5-(1,5-Dimethyl-1H-Pyrazol-3-Yl)-1,3-Oxazole-4-Carboxylate
(2103) ##STR00387##
(2104) 1,5-dimethyl-1H-pyrazole-3-carboxylic acid (1.00 g, 7.14 mmol) and 1,1-carbonyldiimidazole (1.39 g, 8.56 mmol) in 11 ml of THE were stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (860 l, 7.8 mmol) in 11 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (7.1 ml, 1.0 M, 7.1 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 100 ml/min). Product containing samples were united, the solvents were removed on a rotary evaporator and the residue was dried in vacuo. 1.01 g (100% purity, 60% yield) of the title compound were obtained.
(2105) LC-MS (Method 7): R.sub.t=1.16 min; MS (ESIpos): m/z=236 [M+H].sup.+
(2106) Intermediate 353
2-Amino-1-(1,5-Dimethyl-1H-Pyrazol-3-Yl)Ethan-1-One-Hydrogenchloride
(2107) ##STR00388##
(2108) Ethyl 5-(1,5-dimethyl-1H-pyrazol-3-yl)-1,3-oxazole-4-carboxylate (1.01 g, 4.29 mmol) were taken up in 20 ml of 6 N hydrochloric acid and stirred 1 h at 100 C. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 903 mg (85% purity, 95% yield) of the title compound were obtained.
(2109) LC-MS (Method 9): R.sub.t=0.73 min; MS (ESIpos): m/z=154 [MHCl+H].sup.+
(2110) Intermediate 354
N-[2-(1,5-Dimethyl-1H-Pyrazol-3-Yl)-2-Oxoethyl]-5,6-Difluoro-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(2111) ##STR00389##
(2112) 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (226 mg, 747 mol) dissolved in 7.5 ml of acetonitrile was treated with N-ethyl-N-isopropylpropan-2-amine (520 l, 3.0 mmol) and 2,4,6-tripropyl-1,3,5,2,4,6-trioxatriphosphinane-2,4,6-trioxide in ethyl acetate (580 l, 50% purity, 970 mol) and the mixture was stirred at room temperature for 15 min. After that time, 2-amino-1-(1,5-dimethyl-1H-pyrazol-3-yl)ethan-1-one-hydrogenchloride (250 mg, 85% purity, 1.12 mmol) was added and the resulting mixture was stirred at room temperature for 30 min. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B, 4.5 min 50% B, 11.5 min 70% B, 12 min 100% B, 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 140 mg (100% purity, 43% yield) of the title compound were obtained.
(2113) LC-MS (Method 7): R.sub.t=1.93 min; MS (ESIpos): m/z=438 [M+H].sup.+
(2114) Intermediate 355
Ethyl 5-(1-Methyl-1H-Pyrazol-3-Yl)-1,3-Oxazole-4-Carboxylate
(2115) ##STR00390##
(2116) 1-methyl-1H-pyrazole-3-carboxylic acid (1.00 g, 7.93 mmol) and 1,1-carbonyldiimidazole (1.54 g, 9.52 mmol) in 11 ml of THE were stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (950 l, 8.7 mmol) in 11 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (7.9 ml, 1.0 M, 7.9 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 16% EE-100% EE; flow: 100 ml/min). Product containing samples were united, the solvents were removed on a rotary evaporator and the residue was dried in vacuo. 1.09 g (100% purity, 62% yield) of the title compound were obtained.
(2117) LC-MS (Method 7): R.sub.t=1.03 min; MS (ESIpos): m/z=222 [M+H].sup.+
(2118) Intermediate 356
2-Amino-1-(1-Methyl-1H-Pyrazol-3-Yl)Ethan-1-One-Hydrogenchloride
(2119) ##STR00391##
(2120) Ethyl 5-(1-methyl-1H-pyrazol-3-yl)-1,3-oxazole-4-carboxylate (1.09 g, 4.93 mmol) was taken up in 20 ml of 6 N hydrochloric acid and stirred 2 h at 100 C. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 826 mg (100% purity, 95% yield) of the title compound were obtained.
(2121) LC-MS (Method 9): R.sub.t=0.52 min; MS (ESIpos): m/z=140 [MHCl+H].sup.+
(2122) Intermediate 357
5,6-Difluoro-N-[2-(1-Methyl-1H-Pyrazol-3-Yl)-2-Oxoethyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2123) ##STR00392##
(2124) 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (430 mg, 1.42 mmol) dissolved in 7.5 ml DMF was treated with N,N-diisopropylethylamine (740 l, 4.3 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (355 mg, 1.85 mmol) and 1-hydroxybenzotriazole hydrate (283 mg, 1.85 mmol) and stirred for 5 min at room temperature before 2-amino-1-(1-methyl-1H-pyrazol-3-yl)ethan-1-one-hydrogenchloride (250 mg, 1.42 mmol) was added. The mixture was stirred at room temperature over night. The reaction mixture was diluted with water and extracted with ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united, the solvents were removed on a rotary evaporator and the residue was dried in vacuo. 382 mg (93% purity, 59% yield) of the title compound were obtained.
(2125) LC-MS (Method 7): R.sub.t=1.88 min; MS (ESIpos): m/z=424 [M+H].sup.+
(2126) Intermediate 358
5-(Difluoromethyl)-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(2127) ##STR00393##
(2128) [4-(trifluoromethyl)phenyl]boronic acid (200 mg, 1.05 mmol) and 2-bromo-4 (difluoromethyl)benzoic acid (176 mg, 702 mol) dissolved in 5 ml 1,2-dimethoxethane were treated with potassium phosphate in water (1.4 ml, 1.5 M, 2.1 mmol). The mixture was degassed with argon. Then dichlorobis(triphenylphosphine)palladium(II) (49.3 mg, 70.2 mol) and XPhos (33.5 mg, 70.2 mol) were added and the mixture was stirred at 80 C. over night. The reaction mixture was filtered over Celite and the filtrate was concentrated in vacuo. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 25 g; gradient: DCM/MeOH-gradient, 5% MeOH-20% MeOH; flow: 75 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 53.0 mg (100% purity, 16% yield) of the title compound were obtained.
(2129) LC-MS (Method 8): R.sub.t=0.97 min; MS (ESIneg): m/z=315 [MH].sup.
(2130) Intermediate 359
6-Chloro-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxylic Acid
(2131) ##STR00394##
(2132) [4-(trifluoromethyl)phenyl]boronic acid (200 mg, 1.05 mmol) and 2-bromo-3-chlorobenzoic acid (165 mg, 702 mol) dissolved in 5 ml 1,2-dimethoxethane were treated with potassium phosphate in water (1.4 ml, 1.5 M, 2.1 mmol). The mixture was degassed with argon. Then dichlorobis(triphenylphosphine)palladium(II) (49.3 mg, 70.2 mol) and XPhos (33.5 mg, 70.2 mol) were added and the mixture was stirred at 80 C. over night. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 51.0 mg (63% purity, 10% yield) of the title compound were obtained.
(2133) LC-MS (Method 7): R.sub.t=1.97 min; MS (ESIpos): m/z=301 [M+H].sup.+
(2134) Intermediate 360
Ethyl 5-(1-Phenyl-1H-Pyrazol-5-Yl)-1,3-Oxazole-4-Carboxylate
(2135) ##STR00395##
(2136) 1-phenyl-1H-pyrazole-5-carboxylic acid (1.00 g, 5.31 mmol) and 1,1-carbonyldiimidazole (1.03 g, 6.38 mmol) in 11 ml of THE was stirred for 2 h at room temperature. After that time, a solution of ethyl isocyanoacetate (640 l, 5.8 mmol) in 11 ml of THE and a solution of lithium bis(trimethylsilyl)amide in THF (5.3 ml, 1.0 M, 5.3 mmol) were added dropwise at 0 C. When the addition was complete the resulting mixture was stirred at room temperature for 1 h. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 50 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 100 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 1.03 g (100% purity, 68% yield) of the title compound were obtained.
(2137) LC-MS (Method 7): R.sub.t=1.53 min; MS (ESIpos): m/z=284 [M+H].sup.+
(2138) Intermediate 361
2-Amino-1-(1-Phenyl-1H-Pyrazol-5-Yl)Ethan-1-One Hydrogen Chloride
(2139) ##STR00396##
(2140) Ethyl 5-(1-phenyl-1H-pyrazol-5-yl)-1,3-oxazole-4-carboxylate (1.03 g, 3.64 mmol) was treated with 15 ml of 6 N hydrochloric acid and stirred for 2 h at 100 C. The solvent was removed on a rotary evaporator and the residue was dried in vacuo. 816 mg (63% purity, 59% yield) of the title compound were obtained.
(2141) LC-MS (Method 9): R.sub.t=0.97 min; MS (ESIpos): m/z=202 [M+HHCl].sup.+
(2142) Intermediate 362
5,6-Difluoro-N-[2-Oxo-2-(1-Phenyl-1H-Pyrazol-5-Yl)Ethyl]-4-(Trifluoromethyl)[1,1-Biphenyl]-3-Carboxamide
5,6-difluoro-N-[2-oxo-2-(1-phenyl-1H-pyrazol-5-yl)ethyl]-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(2143) ##STR00397##
(2144) 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (315 mg, 1.04 mmol) dissolved in 5.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (550 l, 3.1 mmo), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (260 mg, 1.36 mmol), 1H-benzotriazol-1-ol hydrate (208 mg, 1.36 mmol) and 2-amino-1-(1-phenyl-1H-pyrazol-5-yl)ethan-1-one hydrogen chloride (400 mg, 62% purity, 1.04 mmol). The mixture was stirred over night at room temperature. The reaction mixture was diluted with water an extracted with ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 25 g; gradient: Cy/EE-gradient, 12% EE-100% EE: flow: 75 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 444 mg (66% purity, 58% yield) of the title compound were obtained.
(2145) LC-MS (Method 7): R.sub.t=2.11 min; MS (ESIpos): m/z=486 [M+H].sup.+
(2146) Intermediate 363
N-[2-(1,5-Dimethyl-1H-Pyrazol-4-Yl)-2-Oxoethyl]-5,6-Difluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2147) ##STR00398##
(2148) 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (637 mg, 2.11 mmol) dissolved in 10 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (1.1 ml, 6.3 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (526 mg, 2.74 mmol), 1H-benzotriazol-1-ol hydrate (420 mg, 2.74 mmol) and 2-amino-1-(1,5-dimethyl-1H-pyrazol-4-yl)ethan-1-one hydrogen chloride (400 mg, 2.11 mmol). The mixture was stirred 1.5 h at room temperature. The reaction mixture was diluted with water and extracted with ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP NH 55 g; gradient: Cy/EE-gradient, 12% EE-100% EE; flow: 50 ml/min). Product containing samples were united and the solvents were removed on a rotary evaporator. 253 mg (100% purity, 27% yield) of the title compound were obtained.
(2149) LC-MS (Method 7): R.sub.t=1.85 min; MS (ESIpos): m/z=438 [M+H].sup.+
EXPERIMENTAL SECTIONEXAMPLES
Example 1
Rac-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2150) ##STR00399##
(2151) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (129 mg, 485 mol) dissolved in 10 ml dichloromethane was treated with N,N-diisopropylethylamine (240 l, 1.4 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 631 mol) and 1-hydroxybenzotriazole hydrate (96.6 mg, 631 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (150 mg, 85% purity, 485 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B, 4.5 min 50% B, 11.5 min 70% B, 12 min 100% B, 14.75 min 30% B; flow: 50 ml/min). Further purification was needed and done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm, At-Column Injektion. Gradient: eluent A0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 56.0 mg (100% purity, 24% yield) of the title compound were obtained.
(2152) LC-MS (Method 7): R.sub.t=1.63 min; MS (ESIpos): m/z=475 [M+H].sup.+
(2153) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.69), 0.008 (0.74), 2.364 (16.00), 2.524 (0.51), 4.071 (1.72), 4.077 (1.76), 4.087 (1.77), 4.092 (1.82), 7.420 (0.77), 7.424 (0.92), 7.439 (4.10), 7.442 (2.14), 7.457 (3.03), 7.472 (1.92), 7.475 (1.37), 7.491 (0.82), 7.494 (0.64), 7.535 (1.27), 7.539 (1.22), 7.553 (1.58), 7.557 (1.45), 7.571 (3.05), 7.591 (3.05), 7.762 (3.18), 7.783 (2.60), 8.263 (3.37), 8.602 (0.68), 8.618 (1.47), 8.633 (0.67), 8.846 (5.58), 11.038 (1.22).
Example 2
Ent-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2154) ##STR00400##
(2155) Enantiomeric separation of rac-N-{[4-(5-methyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (52.0 mg, 110 mol) was done using the following method: Column: Daicel Chiralpak ID 5 m 25020 mm Solvent: 70% iso-propanole/30% n-heptane Flow: 20 ml/min Column temperature: 40 C. UV-detection: 210 nm
(2156) Further purification was needed and done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 16.0 mg (100% purity, 31% yield) of the title compound were obtained.
(2157) LC-MS (Method 7): R.sub.t=1.63 min; MS (ESIpos): m/z=475 [M+H].sup.+
(2158) Chiral HPLC (Column: Daicel ID-3 3 m 504.6 mm; solvent: 50% n-heptane-50% iso-propanole; flow: 1 ml/min; UV-detection: 220 nm): R.sub.t=1.812 min, >99.0% ee
(2159) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.364 (16.00), 4.072 (2.17), 4.077 (2.25), 4.091 (2.37), 7.424 (1.11), 7.439 (4.37), 7.456 (3.82), 7.472 (2.10), 7.491 (0.89), 7.535 (1.32), 7.538 (1.30), 7.553 (1.72), 7.557 (1.67), 7.571 (3.83), 7.591 (3.86), 7.763 (3.95), 7.783 (3.27), 8.262 (3.71), 8.602 (0.86), 8.618 (1.81), 8.634 (0.86), 8.846 (5.00), 11.040 (1.80).
Example 3
Ent-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2160) ##STR00401##
(2161) Enantiomeric separation of rac-N-{[4-(5-methyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (52.0 mg, 110 mol) was done using the following method: Column: Daicel Chiralpak ID 5 m 25020 mm Solvent: 70% iso-propnanole/30% n-heptane Flow: 20 ml/min Column temperature: 40 C. UV-detection: 210 nm
(2162) Further purification was needed and done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B, 4.5 min 50% B, 11.5 min 70% B, 12 min 100% B, 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 16.0 mg (100% purity, 31% yield) of the title compound were obtained.
(2163) LC-MS (Method 7): R.sub.t=1.63 min; MS (ESIpos): m/z=475 [M+H].sup.+
(2164) Chiral HPLC (Column: Daicel ID-3 3 m 504.6 mm; solvent: 50% n-heptane-50% iso-propanole; flow: 1 ml/min; UV detection: 220 nm): R.sub.t=5.126 min, >99.0% ee
(2165) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.43), 2.364 (16.00), 2.523 (0.77), 4.071 (1.85), 4.077 (1.91), 4.087 (1.95), 4.092 (1.99), 7.420 (0.84), 7.423 (0.97), 7.439 (4.13), 7.457 (3.21), 7.472 (1.98), 7.491 (0.83), 7.534 (1.28), 7.539 (1.22), 7.553 (1.63), 7.557 (1.49), 7.571 (3.27), 7.591 (3.27), 7.762 (3.41), 7.783 (2.81), 8.262 (2.49), 8.602 (0.74), 8.618 (1.61), 8.633 (0.72), 8.847 (5.22), 11.039 (2.15).
Example 4
Rac-N-{[4-(1-Ethyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2166) ##STR00402##
(2167) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (101 mg, 381 mol) dissolved in 10 ml dichloromethane was treated with N,N-diisopropylethylamine (190 l, 1.1 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (95.0 mg, 496 mol) and 1-hydroxybenzotriazole hydrate (75.9 mg, 496 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(1-ethyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (110 mg, 90% purity, 381 mol) was added. The mixture was stirred at room temperature for 3 h. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B, 4.5 min 50% B, 11.5 min 70% B, 12 min 100% B, 14.75 min 30% B; flow: 50 ml/min) for two times. Further purification was needed by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm, At-Column Injektion; gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 9.00 mg (100% purity, 5% yield) of the title compound were obtained.
(2168) LC-MS (Method 7): R.sub.t=1.57 min; MS (ESIpos): m/z=472 [M+H].sup.+
(2169) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.61), 0.015 (0.73), 0.008 (5.14), 0.006 (3.55), 0.008 (5.14), 0.021 (0.42), 0.146 (0.61), 1.286 (6.92), 1.304 (16.00), 1.322 (7.02), 2.323 (0.54), 2.327 (0.76), 2.332 (0.56), 2.366 (0.64), 2.523 (2.91), 2.526 (2.18), 2.557 (0.81), 2.560 (0.64), 2.565 (0.44), 2.665 (0.56), 2.669 (0.78), 2.674 (0.54), 2.709 (0.66), 3.854 (0.86), 3.869 (1.00), 3.888 (2.37), 3.903 (2.20), 3.916 (2.30), 3.933 (2.32), 3.950 (0.93), 3.967 (0.91), 4.010 (1.35), 4.028 (3.52), 4.032 (3.40), 4.045 (3.38), 4.050 (3.45), 4.063 (1.13), 4.068 (1.30), 6.453 (6.48), 6.457 (6.58), 7.433 (10.15), 7.438 (7.73), 7.447 (4.43), 7.451 (6.87), 7.468 (2.18), 7.471 (2.18), 7.486 (3.50), 7.489 (2.81), 7.505 (1.57), 7.508 (1.44), 7.531 (5.04), 7.551 (7.95), 7.565 (3.16), 7.569 (2.74), 7.584 (1.10), 7.588 (1.15), 7.748 (6.12), 7.768 (5.09), 8.436 (4.82), 8.759 (1.30), 8.774 (2.64), 8.790 (1.27), 11.259 (3.13).
Example 5
Rac-N-{[4-(4-Methyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2170) ##STR00403##
(2171) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (101 mg, 381 mol) dissolved in 10 ml dichloromethane was treated with N,N-diisopropylethylamine (190 l, 1.1 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (94.9 mg, 495 mol) and 1-hydroxybenzotriazole hydrate (75.8 mg, 495 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(4-methyl-1,3-thiazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 381 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B, 4.5 min 50% B, 11.5 min 70% B, 12 min 100% B, 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 135 mg (100% purity, 75% yield) of the title compound were obtained.
(2172) LC-MS (Method 7): R.sub.t=1.54 min; MS (ESIpos): m/z=475 [M+H].sup.+
(2173) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.456 (16.00), 3.895 (2.35), 3.912 (2.18), 7.403 (1.39), 7.422 (2.25), 7.437 (1.72), 7.456 (2.35), 7.469 (1.12), 7.486 (5.09), 7.506 (4.53), 7.546 (1.33), 7.550 (1.38), 7.565 (1.72), 7.568 (1.73), 7.587 (0.67), 7.746 (3.72), 7.767 (3.21), 8.530 (2.93), 8.747 (0.83), 8.763 (1.70), 8.778 (0.81), 8.939 (4.22), 11.198 (2.44).
Example 6
Rac-N-({2,5-Dioxo-4-[1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-5-Yl]Imidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2174) ##STR00404##
(2175) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (102 mg, 383 mol) dissolved in 10 ml dichloromethane was treated with N,N-diisopropylethylamine (190 l, 1.1 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (95.3 mg, 497 mol) and 1-hydroxybenzotriazole hydrate (76.2 mg, 497 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-[1-(2,2,2-trifluoroethyl)-1H-pyrazol-5-yl]imidazolidine-2,4-dione hydrochloride (120 mg, 383 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B, 4.5 min 50% B, 11.5 min 70% B, 12 min 100% B, 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 39.0 mg (100% purity, 19% yield) of the title compound were obtained.
(2176) LC-MS (Method 7): R.sub.t=1.71 min; MS (ESIpos): m/z=526 [M+H].sup.+
(2177) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.328 (0.58), 2.366 (0.95), 2.669 (0.64), 2.710 (0.92), 3.767 (2.93), 3.784 (3.21), 3.801 (5.01), 3.818 (4.76), 3.882 (4.76), 3.897 (5.28), 3.917 (3.18), 3.932 (2.87), 5.125 (3.27), 5.147 (9.40), 5.169 (9.31), 5.191 (3.08), 6.589 (14.29), 6.593 (14.81), 7.412 (6.02), 7.432 (10.81), 7.456 (9.92), 7.473 (4.89), 7.489 (8.27), 7.511 (5.74), 7.518 (13.53), 7.539 (15.60), 7.550 (6.69), 7.553 (6.35), 7.569 (7.30), 7.572 (7.51), 7.591 (3.05), 7.604 (13.92), 7.609 (14.14), 7.745 (16.00), 7.765 (13.37), 8.465 (12.76), 8.808 (3.42), 8.823 (6.96), 8.839 (3.39), 11.302 (10.50).
Example 7
Ent-5-Chloro-N-{[4-(4-Methyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2178) ##STR00405##
(2179) 5-chloro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (85.8 mg, 285 mol) dissolved in 2 ml DMF was treated with N,N-diisopropylethylamine (150 l, 860 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (71.1 mg, 371 mol) and 1-hydroxybenzotriazole hydrate (56.8 mg, 371 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(4-methyl-1,3-thiazol-5-yl)imidazolidine-2,4-dione hydrochloride (Enantiomer 2) (75.0 mg, 285 mol) was added. The mixture was stirred at room temperature overnight. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 75.0 mg (100% purity, 52% yield) of the title compound were obtained.
(2180) LC-MS (Method 7): R.sub.t=1.72 min; MS (ESIpos): m/z=509 [M+H].sup.+
(2181) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.073 (0.58), 2.449 (16.00), 2.523 (0.64), 3.881 (2.75), 3.896 (2.89), 7.416 (2.81), 7.436 (3.48), 7.516 (2.86), 7.528 (3.64), 7.533 (5.78), 7.577 (2.32), 7.583 (1.86), 7.598 (1.74), 7.603 (1.51), 7.760 (3.33), 7.781 (2.83), 8.565 (3.09), 8.826 (0.73), 8.841 (1.58), 8.857 (0.72), 8.937 (4.68).
Example 8
Ent-5-Methyl-N-{[4-(4-Methyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2182) ##STR00406##
(2183) 5-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (80.0 mg, 285 mol) dissolved in 2 ml DMF was treated with N,N-diisopropylethylamine (150 l, 860 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (71.1 mg, 371 mol) and 1-hydroxybenzotriazole hydrate (56.8 mg, 371 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(4-methyl-1,3-thiazol-5-yl)imidazolidine-2,4-dione hydrochloride (Enantiomer 2) (75.0 mg, 285 mol) was added. The mixture was stirred at room temperature overnight. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 75.0 mg (100% purity, 54% yield) of the title compound were obtained.
(2184) LC-MS (Method 7): R.sub.t=1.67 min; MS (ESIpos): m/z=489 [M+H].sup.+
(2185) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.386 (10.99), 2.452 (16.00), 3.836 (0.50), 3.850 (0.59), 3.870 (1.41), 3.884 (1.27), 3.899 (1.31), 3.915 (1.37), 3.932 (0.54), 3.949 (0.51), 7.254 (2.90), 7.274 (0.93), 7.294 (2.16), 7.317 (3.78), 7.337 (1.45), 7.453 (2.91), 7.473 (3.26), 7.729 (3.42), 7.750 (2.98), 8.509 (2.24), 8.641 (0.75), 8.656 (1.42), 8.671 (0.74), 8.934 (4.86).
Example 9
Ent-4-Chloro-N-{[4-(4-Methyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2186) ##STR00407##
(2187) 4-chloro[1,1-biphenyl]-2-carboxylic acid (66.4 mg, 285 mol) dissolved in 2 ml DMF was treated with N,N-diisopropylethylamine (150 l, 860 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (71.1 mg, 371 mol) and 1-hydroxybenzotriazole hydrate (56.8 mg, 371 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(4-methyl-1,3-thiazol-5-yl)imidazolidine-2,4-dione hydrochloride (Enantiomer 2) (75.0 mg, 285 mol) was added. The mixture was stirred at room temperature overnight. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 65.0 mg (100% purity, 52% yield) of the title compound were obtained.
(2188) LC-MS (Method 7): R.sub.t=1.44 min; MS (ESIpos): m/z=441 [M+H].sup.+
(2189) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.57), 0.008 (0.54), 2.461 (16.00), 2.523 (0.86), 2.526 (0.65), 3.878 (1.93), 3.883 (1.95), 3.893 (1.82), 3.899 (1.83), 7.285 (0.50), 7.292 (4.18), 7.297 (1.49), 7.308 (1.69), 7.313 (5.64), 7.320 (0.77), 7.344 (1.23), 7.347 (1.31), 7.363 (1.98), 7.366 (1.91), 7.383 (1.43), 7.385 (1.57), 7.402 (1.89), 7.404 (2.05), 7.416 (1.06), 7.419 (1.09), 7.438 (7.21), 7.443 (1.79), 7.454 (2.40), 7.459 (4.36), 7.466 (0.51), 7.505 (1.32), 7.509 (1.31), 7.524 (1.71), 7.527 (1.66), 7.543 (0.69), 7.546 (0.65), 8.504 (2.56), 8.660 (0.72), 8.676 (1.51), 8.691 (0.71), 8.939 (4.30).
Example 10
Ent-5-Fluoro-N-{[4-(4-Methyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2190) ##STR00408##
(2191) 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (81.1 mg, 285 mol) dissolved in 2 ml DMF was treated with N,N-diisopropylethylamine (150 l, 860 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (71.1 mg, 371 mol) and 1-hydroxybenzotriazole hydrate (56.8 mg, 371 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(4-methyl-1,3-thiazol-5-yl)imidazolidine-2,4-dione hydrochloride (Enantiomer 2) (75.0 mg, 285 mol) was added. The mixture was stirred at room temperature overnight. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 78.0 mg (100% purity, 55% yield) of the title compound were obtained.
(2192) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=493 [M+H].sup.+
(2193) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.41), 0.008 (0.41), 2.451 (16.00), 2.523 (0.75), 3.885 (2.70), 3.902 (2.55), 7.320 (1.04), 7.326 (1.80), 7.337 (0.94), 7.344 (1.28), 7.351 (1.88), 7.358 (1.88), 7.364 (1.18), 7.379 (1.00), 7.385 (0.79), 7.449 (1.47), 7.464 (1.52), 7.470 (1.20), 7.485 (1.05), 7.508 (2.90), 7.529 (3.29), 7.760 (3.44), 7.781 (2.96), 8.551 (2.84), 8.782 (0.76), 8.798 (1.64), 8.813 (0.76), 8.938 (4.18).
Example 11
Ent-4-Fluoro-N-{[4-(4-Methyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2194) ##STR00409##
(2195) 4-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (81.1 mg, 285 mol) dissolved in 2 ml DMF was treated with N,N-diisopropylethylamine (150 l, 860 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (71.1 mg, 371 mol) and 1-hydroxybenzotriazole hydrate (56.8 mg, 371 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(4-methyl-1,3-thiazol-5-yl)imidazolidine-2,4-dione hydrochloride (Enantiomer 2) (75.0 mg, 285 mol) was added. The mixture was stirred at room temperature overnight. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion: Gradient: eluent A0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 88.0 mg (100% purity, 63% yield) of the title compound were obtained.
(2196) LC-MS (Method 7): R.sub.t=1.59 min; MS (ESIpos): m/z=493 [M+H].sup.+
(2197) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.073 (0.57), 2.455 (16.00), 3.890 (2.90), 3.906 (3.04), 7.222 (1.32), 7.229 (1.54), 7.245 (1.33), 7.251 (1.46), 7.403 (0.55), 7.410 (0.56), 7.424 (1.38), 7.431 (1.43), 7.446 (0.94), 7.452 (0.96), 7.476 (3.00), 7.485 (2.03), 7.498 (3.98), 7.507 (1.28), 7.521 (0.97), 7.746 (3.46), 7.767 (2.98), 8.590 (2.54), 8.891 (0.76), 8.906 (1.62), 8.922 (0.76), 8.943 (5.15).
Example 12
Rac-N-[(2,5-Dioxo-4-Phenylimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2198) ##STR00410##
(2199) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (55.1 mg, 207 mol) dissolved in 2 ml DMF was treated with N,N-diisopropylethylamine (100 l, 580 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (51.6 mg, 269 mol) and 1-hydroxybenzotriazole hydrate (41.2 mg, 269 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-phenylimidazolidine-2,4-dione hydrochloride (50.0 mg, 207 mol) was added. The mixture was stirred at room temperature for 2 h. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A 0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 69.0 mg (98% purity, 72% yield) of the title compound were obtained.
(2200) LC-MS (Method 7): R.sub.t=1.76 min; MS (ESIpos): m/z=454 [M+H].sup.+
(2201) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.422 (0.83), 2.511 (3.30), 2.573 (0.73), 2.651 (0.79), 2.783 (2.20), 3.330 (0.83), 3.725 (2.99), 3.737 (3.19), 3.748 (5.38), 3.759 (5.08), 3.799 (5.10), 3.808 (5.49), 3.821 (3.19), 3.831 (2.86), 7.347 (2.50), 7.355 (7.69), 7.359 (7.93), 7.367 (9.10), 7.396 (9.39), 7.410 (14.22), 7.423 (11.71), 7.436 (8.64), 7.449 (3.94), 7.461 (7.63), 7.473 (4.04), 7.502 (12.35), 7.516 (13.58), 7.534 (4.81), 7.546 (7.17), 7.561 (16.00), 7.574 (12.00), 7.719 (13.96), 7.733 (12.33), 7.790 (0.50), 7.805 (0.44), 8.437 (13.85), 8.630 (3.25), 8.640 (5.65), 8.650 (3.14), 10.835 (0.75).
Example 13
Diamix-N-{[4-(2-Methylcyclobutyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2202) ##STR00411##
(2203) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (171 mg, 642 mol) dissolved in 15 ml dichloromethane was treated with N,N-diisopropylethylamine (310 l, 1.8 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (160 mg, 834 mol) and 1-hydroxybenzotriazole hydrate (128 mg, 834 mol) and stirred for 5 min at room temperature before diamix-5-(aminomethyl)-5-(2-methylcyclobutyl)imidazolidine-2,4-dione hydrochloride (150 mg, 642 mol) was added. The mixture was stirred at room temperature for 5 h. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 162 mg (96% purity, 55% yield) of the title compound were obtained.
(2204) LC-MS (Method 8): R.sub.t=0.95 min; MS (ESIpos): m/z=446 [M+H].sup.+
(2205) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (3.07), 0.008 (3.37), 0.883 (11.77), 0.899 (11.66), 1.007 (12.84), 1.024 (13.35), 1.050 (1.32), 1.069 (1.23), 1.324 (1.44), 1.347 (2.95), 1.369 (3.13), 1.391 (1.95), 1.415 (0.51), 1.581 (1.39), 1.602 (1.65), 1.607 (1.60), 1.634 (1.72), 1.658 (2.02), 1.683 (1.32), 1.708 (0.53), 1.732 (0.88), 1.751 (2.18), 1.771 (3.13), 1.792 (1.72), 1.828 (2.21), 1.850 (2.60), 1.870 (1.35), 2.108 (1.23), 2.113 (1.25), 2.130 (3.34), 2.150 (4.64), 2.170 (3.79), 2.191 (2.07), 2.214 (0.91), 2.238 (1.32), 2.255 (1.44), 2.276 (1.02), 2.323 (0.51), 2.327 (0.70), 2.332 (0.49), 2.366 (0.56), 2.523 (2.76), 2.587 (0.42), 2.665 (0.56), 2.669 (0.74), 2.674 (0.56), 2.710 (0.58), 3.295 (7.64), 3.328 (4.34), 3.343 (3.16), 3.375 (2.62), 3.391 (2.74), 3.409 (1.28), 3.425 (1.21), 7.402 (4.04), 7.406 (4.62), 7.424 (16.00), 7.443 (10.96), 7.465 (7.87), 7.484 (3.53), 7.524 (5.64), 7.528 (5.78), 7.543 (9.24), 7.547 (14.05), 7.570 (12.47), 7.760 (10.68), 7.778 (9.15), 7.853 (4.88), 7.904 (4.95), 8.474 (1.70), 8.490 (3.39), 8.505 (2.95), 8.520 (3.18), 8.535 (1.53), 10.639 (4.18), 10.673 (4.30), 10.735 (0.49).
Example 14
Rac-N-{[4-(1,5-Dimethyl-1H-Pyrazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2206) ##STR00412##
(2207) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (103 mg, 385 mol) dissolved in 2.5 ml DMF was treated with N,N-diisopropylethylamine (200 l, 1.2 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (96.0 mg, 501 mol) and 1-hydroxybenzotriazole hydrate (76.7 mg, 501 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(1,5-dimethyl-1H-pyrazol-4-yl)imidazolidine-2,4-dione hydrochloride (150 mg, 642 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 91.0 mg (100% purity, 50% yield) of the title compound were obtained.
(2208) LC-MS (Method 7): R.sub.t=1.48 min; MS (ESIpos): m/z=472 [M+H].sup.+
(2209) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.27), 0.008 (1.41), 2.252 (15.96), 2.523 (0.83), 3.703 (16.00), 3.769 (2.31), 3.784 (2.70), 7.374 (5.99), 7.398 (1.24), 7.401 (1.34), 7.417 (2.38), 7.420 (2.37), 7.429 (1.84), 7.448 (2.66), 7.454 (1.41), 7.469 (2.15), 7.472 (1.79), 7.488 (1.10), 7.491 (0.91), 7.533 (4.50), 7.552 (5.22), 7.570 (0.84), 7.573 (0.74), 7.741 (3.77), 7.762 (3.15), 8.159 (2.66), 8.162 (2.68), 8.621 (0.81), 8.637 (1.69), 8.652 (0.80), 10.878 (2.42).
Example 15
Rac-N-{[4-(2,4-Dimethyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2210) ##STR00413##
(2211) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (96.2 mg, 361 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (190 l, 1.1 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (90.1 mg, 470 mol), 1H-benzotriazol-1-ol hydrate (71.9 mg, 470 mol) and rac-5-(aminomethyl)-5-(2,4-dimethyl-1,3-thiazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 361 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (column: Chromatorex C18 10 m 25030 mm; eluent A=water, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min; 0.1% formic acid). After lyophilization, 67.0 mg (90% purity, 34% yield) of the title compound were obtained.
(2212) LC-MS (Method 7): R.sub.t=1.57 min; MS (ESIpos): m/z=489 [M+H].sup.+
(2213) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.64), 0.008 (0.73), 2.351 (16.00), 3.837 (2.13), 3.840 (2.13), 3.851 (2.00), 3.857 (2.00), 7.410 (1.21), 7.412 (1.32), 7.429 (2.37), 7.432 (2.93), 7.455 (2.23), 7.467 (1.14), 7.469 (1.14), 7.485 (2.27), 7.488 (2.40), 7.495 (3.27), 7.504 (1.56), 7.514 (3.54), 7.545 (1.39), 7.548 (1.36), 7.563 (1.73), 7.567 (1.68), 7.582 (0.69), 7.585 (0.65), 7.744 (3.60), 7.765 (3.11), 8.483 (2.65), 8.723 (0.79), 8.738 (1.64), 8.754 (0.78), 11.154 (2.33).
Example 16
Ent-5-Chloro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2214) ##STR00414##
(2215) 5-chloro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (85.8 mg, 285 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (150 l, 860 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (71.1 mg, 371 mol), 1H-benzotriazol-1-ol hydrate (56.8 mg, 371 mol) and ent-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (75.0 mg, 285 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 47 ml, eluent B 0 bis 2 min 23 ml, eluent A 2 bis 10 min from 47 ml to 23 ml and eluent B from 23 ml to 47 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 65.0 mg (100% purity, 45% yield) of the title compound were obtained.
(2216) LC-MS (Method 7): R.sub.t=1.80 min; MS (ESIpos): m/z=509 [M+H].sup.+
(2217) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.44), 0.008 (0.40), 2.359 (16.00), 2.522 (0.74), 4.063 (1.70), 4.070 (1.77), 4.079 (1.77), 4.085 (1.78), 7.428 (2.57), 7.448 (3.36), 7.526 (2.77), 7.531 (3.54), 7.557 (2.32), 7.562 (1.75), 7.577 (1.73), 7.583 (1.63), 7.592 (2.75), 7.612 (3.27), 7.777 (3.34), 7.797 (2.75), 8.299 (3.58), 8.686 (0.74), 8.702 (1.56), 8.718 (0.72), 8.844 (5.70).
Example 17
Ent-4,5-Difluoro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2218) ##STR00415##
(2219) 4,5-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (86.3 mg, 285 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (150 l, 860 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (71.1 mg, 371 mol), 1H-benzotriazol-1-ol hydrate (56.8 mg, 371 mol) and ent-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (75.0 mg, 285 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 70.0 mg (100% purity, 48% yield) of the title compound were obtained.
(2220) LC-MS (Method 7): R.sub.t=1.74 min; MS (ESIpos): m/z=511 [M+H].sup.+
(2221) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.364 (16.00), 2.523 (0.67), 4.079 (2.40), 4.094 (2.56), 7.456 (0.92), 7.476 (1.09), 7.483 (1.07), 7.503 (1.01), 7.568 (2.58), 7.588 (3.90), 7.608 (1.14), 7.617 (1.10), 7.637 (1.03), 7.775 (3.18), 7.796 (2.62), 8.346 (3.43), 8.760 (0.67), 8.776 (1.46), 8.791 (0.67), 8.851 (6.97).
Example 18
Ent-4-Chloro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2222) ##STR00416##
(2223) 4-chloro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (85.8 mg, 285 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (150 l, 860 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (71.1 mg, 371 mol), 1H-benzotriazol-1-ol hydrate (56.8 mg, 371 mol) and ent-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (75.0 mg, 285 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 47 ml, eluent B 0 bis 2 min 23 ml, eluent A 2 bis 10 min from 47 ml to 23 ml and eluent B from 23 ml to 47 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 57.0 mg (100% purity, 39% yield) of the title compound were obtained.
(2224) LC-MS (Method 7): R.sub.t=1.78 min; MS (ESIpos): m/z=509 [M+H].sup.+
(2225) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.52), 0.008 (0.50), 2.367 (16.00), 2.518 (1.13), 2.523 (0.83), 2.525 (0.61), 4.080 (1.92), 4.083 (1.89), 4.098 (2.08), 7.463 (3.11), 7.469 (4.71), 7.491 (3.43), 7.559 (2.58), 7.579 (3.07), 7.612 (2.18), 7.617 (1.94), 7.632 (1.55), 7.638 (1.47), 7.773 (3.19), 7.793 (2.63), 8.329 (3.52), 8.806 (0.69), 8.822 (1.50), 8.837 (0.70), 8.852 (5.70).
Example 19
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-3-(4-Methylphenyl)Isonicotinamide
(2226) ##STR00417##
(2227) 3-(4-methylphenyl)pyridine-4-carboxylic acid (51.8 mg, 243 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (130 l, 730 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (60.6 mg, 316 mol), 1H-benzotriazol-1-ol hydrate (48.4 mg, 316 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 bis 2 min 7 ml, eluent A 2 bis 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A an d 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 46.0 mg (100% purity, 52% yield) of the title compound were obtained.
(2228) LC-MS (Method 7): R.sub.t=1.10 min; MS (ESIpos): m/z=365 [M+H].sup.+
(2229) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.128 (0.77), 0.136 (1.25), 0.144 (1.29), 0.152 (0.94), 0.161 (0.43), 0.317 (0.83), 0.325 (1.06), 0.332 (0.93), 0.340 (0.68), 0.347 (0.47), 0.389 (0.73), 0.397 (0.83), 0.404 (1.19), 0.412 (0.91), 0.418 (0.56), 0.436 (0.45), 0.444 (1.00), 0.453 (1.24), 0.461 (1.21), 0.469 (0.84), 1.059 (0.80), 1.064 (0.89), 1.073 (1.49), 1.081 (0.83), 1.086 (0.77), 2.338 (16.00), 3.266 (0.45), 3.332 (0.86), 3.497 (2.49), 3.502 (2.73), 3.507 (2.73), 3.512 (2.72), 3.524 (0.40), 7.241 (3.74), 7.254 (5.31), 7.284 (3.34), 7.292 (3.34), 7.316 (6.09), 7.329 (4.29), 7.538 (3.66), 8.598 (6.65), 8.601 (4.43), 8.610 (3.81), 8.619 (1.15), 8.629 (2.18), 8.639 (1.06), 10.624 (2.54).
Example 20
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4,5-Difluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2230) ##STR00418##
(2231) 4,5-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (73.5 mg, 243 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (120 l, 680 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (60.6 mg, 316 mol), 1H-benzotriazol-1-ol hydrate (48.4 mg, 316 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B.
(2232) Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 25.0 mg (100% purity, 23% yield) of the title compound were obtained.
(2233) LC-MS (Method 9): R.sub.t=1.44 min; MS (ESIpos): m/z=454 [M+H].sup.+
(2234) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.95), 0.008 (1.91), 0.131 (2.17), 0.142 (3.86), 0.155 (4.12), 0.166 (2.89), 0.178 (1.26), 0.295 (0.76), 0.318 (2.49), 0.331 (3.07), 0.339 (2.93), 0.352 (2.31), 0.363 (1.88), 0.370 (1.66), 0.381 (2.42), 0.395 (2.71), 0.404 (3.50), 0.417 (2.67), 0.426 (1.59), 0.439 (0.98), 0.449 (1.44), 0.462 (2.96), 0.474 (3.94), 0.486 (3.68), 0.498 (2.35), 0.512 (0.90), 1.050 (1.23), 1.064 (2.60), 1.071 (2.71), 1.084 (4.73), 1.098 (2.53), 1.105 (2.35), 1.118 (1.01), 2.072 (0.51), 2.327 (1.44), 2.366 (1.34), 2.665 (1.08), 2.670 (1.37), 2.710 (1.37), 3.461 (1.16), 3.476 (1.55), 3.495 (7.15), 3.506 (8.52), 3.509 (8.42), 3.521 (6.93), 3.540 (1.41), 3.555 (1.30), 7.493 (4.48), 7.513 (5.31), 7.520 (5.27), 7.543 (13.72), 7.564 (14.48), 7.580 (4.80), 7.599 (5.63), 7.613 (16.00), 7.628 (5.42), 7.765 (15.24), 7.785 (12.57), 8.689 (3.11), 8.705 (6.43), 8.720 (3.03), 10.602 (0.79).
Example 21
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethoxy)[Biphenyl]-2-Carboxamide
(2235) ##STR00419##
(2236) 4-(trifluoromethoxy)[1,1-biphenyl]-2-carboxylic acid (68.6 mg, 243 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (130 l, 730 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (60.6 mg, 316 mol), 1H-benzotriazol-1-ol hydrate (48.4 mg, 316 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 90.0 mg (100% purity, 85% yield) of the title compound were obtained.
(2237) LC-MS (Method 7): R.sub.t=1.63 min; MS (ESIpos): m/z=434 [M+H].sup.+
(2238) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.103 (0.51), 0.117 (1.25), 0.128 (2.21), 0.141 (2.35), 0.151 (1.66), 0.165 (0.76), 0.285 (0.43), 0.299 (0.76), 0.307 (1.40), 0.319 (1.72), 0.329 (1.65), 0.342 (1.30), 0.352 (1.02), 0.362 (0.85), 0.373 (1.40), 0.387 (1.55), 0.395 (2.06), 0.409 (1.61), 0.417 (0.93), 0.430 (1.23), 0.443 (1.76), 0.454 (2.19), 0.467 (2.10), 0.478 (1.29), 0.492 (0.45), 1.044 (0.72), 1.057 (1.48), 1.065 (1.57), 1.070 (1.13), 1.078 (2.72), 1.086 (1.12), 1.091 (1.44), 1.098 (1.32), 1.112 (0.57), 2.072 (0.43), 2.522 (0.98), 2.525 (0.93), 2.557 (0.47), 3.477 (0.55), 3.497 (5.11), 3.501 (5.14), 3.512 (4.90), 3.516 (4.97), 3.535 (0.53), 3.551 (0.43), 7.375 (5.05), 7.396 (10.55), 7.410 (6.15), 7.414 (6.20), 7.421 (8.76), 7.439 (4.99), 7.442 (3.76), 7.452 (2.38), 7.458 (16.00), 7.464 (4.50), 7.475 (3.42), 7.480 (8.83), 7.488 (1.29), 7.500 (3.71), 7.505 (3.99), 7.514 (7.26), 7.518 (6.85), 7.523 (4.29), 7.537 (1.63), 7.541 (1.59), 8.475 (1.74), 8.491 (3.73), 8.506 (1.74), 10.643 (5.31).
Example 22
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4,5-Dimethyl[Biphenyl]-2-Carboxamide
(2239) ##STR00420##
(2240) 4,5-dimethyl[1,1-biphenyl]-2-carboxylic acid (55.0 mg, 243 mol) dissolved in 7 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (120 l, 680 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (60.6 mg, 316 mol), 1H-benzotriazol-1-ol hydrate (48.4 mg, 316 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 5.00 mg (100% purity, 5% yield) of the title compound were obtained.
(2241) LC-MS (Method 9): R.sub.t=1.33 min; MS (ESIpos): m/z=378 [M+H].sup.+
(2242) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.48), 0.008 (1.37), 0.096 (0.68), 0.107 (1.23), 0.120 (1.28), 0.131 (0.91), 0.145 (0.48), 0.290 (0.77), 0.303 (0.97), 0.314 (0.94), 0.325 (0.71), 0.335 (0.57), 0.353 (0.43), 0.364 (0.80), 0.378 (0.86), 0.386 (1.23), 0.399 (1.20), 0.410 (1.37), 0.421 (1.45), 0.434 (1.11), 0.446 (0.68), 1.005 (0.43), 1.018 (0.88), 1.026 (0.88), 1.039 (1.54), 1.052 (0.83), 1.059 (0.74), 2.315 (16.00), 2.327 (1.54), 2.332 (1.08), 2.359 (15.60), 2.523 (3.39), 2.526 (2.60), 2.557 (1.14), 2.560 (0.83), 2.562 (0.63), 2.565 (0.60), 2.567 (0.51), 2.569 (0.43), 2.665 (0.71), 2.669 (0.94), 2.674 (0.68), 2.709 (0.97), 3.413 (0.68), 3.428 (0.80), 3.447 (2.11), 3.462 (2.00), 3.473 (2.00), 3.489 (2.08), 3.507 (0.74), 3.523 (0.71), 7.168 (8.64), 7.189 (8.24), 7.228 (7.99), 7.248 (4.16), 7.256 (4.45), 7.274 (2.68), 7.435 (4.56), 8.150 (1.00), 8.166 (2.08), 8.181 (1.00), 10.608 (1.34).
Example 23
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5,6-Difluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2243) ##STR00421##
(2244) 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (28.0 mg, 92.7 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (45 l, 260 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (23.1 mg, 120 mol), 1H-benzotriazol-1-ol hydrate (18.4 mg, 120 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (19.1 mg, 92.7 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min f rom 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 29.0 mg (100% purity, 69% yield) of the title compound were obtained.
(2245) LC-MS (Method 9): R.sub.t=1.41 min; MS (ESIpos): m/z=454 [M+H].sup.+
(2246) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.98), 0.008 (1.02), 0.095 (0.54), 0.109 (1.35), 0.120 (2.45), 0.133 (2.61), 0.144 (1.84), 0.156 (0.84), 0.270 (0.46), 0.293 (1.56), 0.305 (1.91), 0.316 (1.86), 0.328 (1.49), 0.338 (1.33), 0.354 (1.56), 0.367 (1.77), 0.376 (2.26), 0.389 (1.77), 0.397 (0.96), 0.415 (1.07), 0.429 (1.91), 0.440 (2.49), 0.453 (2.37), 0.464 (1.44), 0.478 (0.51), 1.005 (0.77), 1.018 (1.61), 1.025 (1.75), 1.031 (1.24), 1.039 (3.00), 1.046 (1.23), 1.052 (1.58), 1.059 (1.44), 1.072 (0.61), 2.323 (0.47), 2.327 (0.67), 2.332 (0.47), 2.366 (0.65), 2.524 (2.63), 2.665 (0.51), 2.670 (0.68), 2.674 (0.51), 2.710 (0.65), 3.432 (8.50), 3.448 (8.48), 7.297 (1.84), 7.306 (2.00), 7.310 (1.98), 7.315 (2.38), 7.318 (2.28), 7.327 (2.28), 7.331 (2.09), 7.544 (16.00), 7.563 (7.94), 7.577 (1.79), 7.598 (2.51), 7.603 (2.21), 7.623 (2.54), 7.643 (1.47), 7.800 (9.17), 7.820 (7.92), 8.578 (1.91), 8.594 (4.15), 8.609 (1.91).
Example 24
Rac-N-[(2,5-Dioxo-4-Propylimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2247) ##STR00422##
(2248) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (51.3 mg, 193 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (94 l, 540 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (48.0 mg, 250 mol), 1H-benzotriazol-1-ol hydrate (38.3 mg, 250 mol) and rac-5-(aminomethyl)-5-propylimidazolidine-2,4-dione hydrochloride (40.0 mg, 193 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 63.0 mg (100% purity, 78% yield) of the title compound were obtained.
(2249) LC-MS (Method 7): R.sub.t=1.64 min; MS (ESIpos): m/z=420 [M+H].sup.+
(2250) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (3.02), 0.008 (3.25), 0.815 (6.05), 0.833 (16.00), 0.851 (7.76), 1.040 (0.74), 1.058 (1.14), 1.073 (1.11), 1.088 (1.20), 1.105 (0.77), 1.120 (0.54), 1.236 (0.46), 1.248 (0.77), 1.266 (1.20), 1.279 (1.03), 1.297 (1.23), 1.315 (0.68), 1.327 (0.48), 1.424 (0.71), 1.434 (0.83), 1.457 (1.77), 1.469 (1.48), 1.486 (1.65), 1.503 (1.88), 1.516 (1.74), 1.532 (1.48), 1.544 (1.40), 1.566 (0.74), 1.579 (0.54), 2.328 (0.51), 2.366 (0.97), 2.523 (2.62), 2.670 (0.57), 2.710 (1.00), 3.298 (2.77), 3.331 (3.85), 3.346 (3.05), 3.387 (2.80), 3.403 (2.97), 3.421 (1.60), 3.437 (1.48), 7.424 (4.31), 7.443 (5.36), 7.452 (1.25), 7.463 (8.96), 7.470 (6.53), 7.474 (6.47), 7.494 (0.94), 7.519 (0.63), 7.529 (3.17), 7.538 (2.80), 7.543 (2.20), 7.548 (2.62), 7.551 (2.37), 7.556 (2.99), 7.563 (7.87), 7.583 (7.96), 7.675 (5.79), 7.746 (8.24), 7.767 (6.73), 8.512 (1.63), 8.527 (3.28), 8.543 (1.65), 10.685 (4.85).
Example 25
Rac-N-[(4-Tert-Butyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2251) ##STR00423##
(2252) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (43.1 mg, 162 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (79 l, 450 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (40.4 mg, 211 mol), 1H-benzotriazol-1-ol hydrate (32.2 mg, 211 mol) and rac-5-(aminomethyl)-5-tert-butylimidazolidine-2,4-dione (30.0 mg, 162 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 56.0 mg (100% purity, 80% yield) of the title compound were obtained.
(2253) LC-MS (Method 7): R.sub.t=1.72 min; MS (ESIpos): m/z=434 [M+H].sup.+
(2254) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.66), 0.008 (0.75), 0.982 (16.00), 3.537 (0.59), 3.552 (0.57), 3.580 (0.59), 3.595 (0.64), 7.361 (0.65), 7.364 (0.69), 7.380 (1.03), 7.421 (0.79), 7.440 (1.52), 7.456 (1.03), 7.459 (0.83), 7.475 (0.53), 7.522 (0.69), 7.525 (0.72), 7.544 (2.15), 7.563 (2.32), 7.757 (1.78), 7.778 (1.46), 8.480 (0.74), 10.664 (0.99).
Example 26
Ent-N-{[4-(2-Methylcyclobutyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2255) ##STR00424##
(2256) Enantiomeric separation of diamix-N-{[4-(2-methylcyclobutyl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (150 mg, 337 mol) using the following two methods. At first Diacel Chiralpak IA 5 m 250*20 mm Eluent A: 80% n-heptane, eluent B: 20% ethanol Flow: 15 ml/min UV-detection: 220 nm Temperature: 35 C.
(2257) then Chiralcel OZ-H 5 m 250*20 mm Eluent A: 80% n-heptane, eluent B: 20% ethanol Flow: 15 ml/min UV-detection: 220 nm Temperature: 35 C.
(2258) 34.0 mg (100% purity, 23% yield) of the title compound were obtained.
(2259) Chiral-HPLC (Column: Diacel Chiralcel OZ-H 5 m 250*4.6 mm, eluent A: 80% iso-hexane, eluent B: 20% ethanol, flow: 1 ml/min, temperature: 30 C., UV-detection: 220 nm): R.sub.t=5.529 min; 99.64% ee
(2260) LC-MS (Method 7): R.sub.t=1.78 min; MS (ESIpos): m/z=446 [M+H].sup.+
(2261) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.887 (16.00), 0.897 (15.47), 1.352 (1.87), 1.368 (2.93), 1.383 (2.13), 1.400 (0.67), 1.739 (1.20), 1.754 (3.47), 1.768 (4.60), 1.783 (2.40), 1.845 (1.93), 1.857 (1.80), 2.085 (1.33), 2.123 (1.47), 2.137 (1.80), 2.148 (1.73), 2.157 (2.40), 2.171 (3.73), 2.185 (2.73), 2.200 (0.80), 2.383 (0.93), 2.423 (1.00), 2.467 (1.80), 2.611 (1.00), 2.652 (1.00), 3.266 (5.07), 3.340 (0.60), 3.363 (0.47), 7.408 (3.33), 7.422 (9.00), 7.436 (5.53), 7.452 (2.60), 7.465 (4.80), 7.477 (2.33), 7.529 (2.93), 7.543 (4.47), 7.552 (8.40), 7.565 (8.67), 7.756 (8.87), 7.769 (7.87), 7.875 (8.73), 8.447 (1.93), 8.457 (4.13), 8.467 (2.07), 10.650 (1.47).
Example 27
Ent-N-{[4-(4-Methyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2262) ##STR00425##
(2263) Enantiomeric separation of rac-N-{[4-(4-methyl-1,3-thiazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (130 mg, 274 mol) using the following method Chiralcel OZ-H 5 m 250*20 mm Eluent A: 80% n-heptane, eluent B: 20% iso-propanol Flow: 20 ml/min UV-detection: 220 nm Temperature: 40 C.
(2264) 22.0 mg (100% purity, 17% yield) of the title compound were obtained.
(2265) Chiral-HPLC (Column: Diacel Chrialpak OZ-3 3 m 250*4.6 mm, eluent A: 80% n-heptane, eluent B: 20% iso-propanol, flow: 1 ml/min, UV-detection: 220 nm): R.sub.t=2.785 min; 100% ee
(2266) LC-MS (Method 7): R.sub.t=1.53 min; MS (ESIpos): m/z=475 [M+H].sup.+
(2267) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.109 (0.46), 1.119 (0.46), 2.458 (16.00), 3.879 (0.41), 3.892 (1.84), 3.901 (2.93), 3.911 (1.78), 7.406 (1.59), 7.419 (2.20), 7.437 (1.87), 7.449 (2.25), 7.472 (1.06), 7.485 (2.42), 7.490 (3.43), 7.503 (3.59), 7.552 (1.25), 7.564 (1.83), 7.576 (0.76), 7.746 (3.64), 7.759 (3.32), 8.505 (2.84), 8.723 (0.86), 8.734 (1.69), 8.744 (0.85), 8.935 (5.65), 11.179 (2.43).
Example 28
Ent-N-({2,5-Dioxo-4-[1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-5-Yl]Imidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2268) ##STR00426##
(2269) Enantiomeric separation of rac-N-({2,5-dioxo-4-[1-(2,2,2-trifluoroethyl)-1H-pyrazol-5-yl]imidazolidin-4-yl}methyl)-4-(trifluoromethyl)[biphenyl]-2-carboxamide (35.0 mg, 66.6 mol) using the following method Diacel Chiralcel OX-H 5 m 250*20 mm Eluent A: 50% n-heptane, eluent B: 50% iso-propanol Flow: 20 ml/min UV-detection: 220 nm Temperature: 40 C.
(2270) 12.0 mg (100% purity, 34% yield) of the title compound were obtained.
(2271) Chiral-HPLC (Column: Diacel OX-3 3 m 50*4.6 mm, eluent A: 50% n-heptane, eluent B: 50% iso-propanol, flow: 1 ml/min, UV-detection: 220 nm): R.sub.t=2.483 min; 99.54% ee
(2272) LC-MS (Method 7): R.sub.t=1.71 min; MS (ESIpos): m/z=526 [M+H].sup.+
(2273) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.107 (0.49), 1.118 (0.52), 1.159 (0.72), 1.171 (0.40), 2.084 (16.00), 2.422 (0.52), 2.465 (0.64), 2.651 (0.46), 3.777 (0.61), 3.788 (0.64), 3.799 (0.87), 3.811 (0.84), 3.883 (0.86), 3.893 (0.94), 3.907 (0.65), 3.916 (0.59), 5.134 (0.43), 5.148 (1.06), 5.162 (1.02), 5.175 (0.44), 6.583 (2.31), 6.586 (2.33), 7.414 (1.11), 7.426 (1.59), 7.436 (1.34), 7.449 (1.60), 7.475 (0.77), 7.487 (1.45), 7.499 (0.75), 7.521 (2.31), 7.534 (2.56), 7.554 (0.85), 7.566 (1.30), 7.579 (0.53), 7.601 (2.34), 7.604 (2.30), 7.743 (2.59), 7.757 (2.33), 8.438 (2.04), 8.781 (0.60), 8.791 (1.20), 8.802 (0.61), 11.282 (1.78).
Example 29
Rac-N-{[2,5-Dioxo-4-(Tetrahydro-2H-Pyran-4-Yl)Imidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2274) ##STR00427##
(2275) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (53.3 mg, 200 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (98 l, 560 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (49.9 mg, 260 mol), 1H-benzotriazol-1-ol hydrate (39.9 mg, 260 mol) and rac-5-(aminomethyl)-5-(tetrahydro-2H-pyran-4-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 200 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 26.0 mg (100% purity, 28% yield) of the title compound were obtained.
(2276) LC-MS (Method 7): R.sub.t=1.51 min; MS (ESIpos): m/z=462 [M+H].sup.+
(2277) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.280 (2.51), 1.299 (4.09), 1.320 (2.60), 1.328 (2.79), 1.341 (2.88), 1.348 (2.70), 1.362 (1.12), 1.369 (1.02), 1.385 (1.12), 1.393 (1.21), 1.405 (2.79), 1.413 (2.88), 1.426 (2.70), 1.434 (2.51), 1.447 (0.93), 1.454 (0.84), 1.560 (3.07), 1.580 (2.60), 1.861 (1.21), 1.867 (2.14), 1.873 (1.30), 1.881 (2.23), 1.887 (3.72), 1.893 (2.05), 1.901 (1.12), 1.907 (1.77), 2.084 (1.02), 2.384 (0.56), 2.422 (1.12), 2.477 (0.84), 2.515 (1.30), 2.517 (1.21), 2.521 (1.12), 2.612 (0.56), 2.652 (1.02), 3.191 (3.44), 3.197 (3.07), 3.212 (6.70), 3.227 (3.16), 3.232 (3.72), 3.273 (0.65), 3.276 (2.70), 3.279 (1.77), 3.284 (1.77), 3.288 (2.14), 3.331 (0.56), 3.338 (1.02), 3.342 (1.12), 3.345 (0.65), 3.362 (0.56), 3.366 (0.84), 3.390 (3.72), 3.400 (4.09), 3.413 (5.40), 3.423 (4.84), 3.515 (4.93), 3.526 (5.30), 3.538 (4.00), 3.549 (3.63), 3.817 (2.88), 3.824 (3.07), 3.835 (2.79), 3.842 (2.79), 3.854 (2.98), 3.861 (3.07), 3.873 (2.79), 3.879 (2.60), 7.422 (7.53), 7.434 (15.16), 7.444 (9.95), 7.447 (10.05), 7.458 (5.95), 7.459 (5.95), 7.470 (8.74), 7.472 (7.81), 7.482 (3.72), 7.484 (3.53), 7.532 (5.95), 7.535 (5.58), 7.545 (7.91), 7.548 (7.72), 7.560 (15.53), 7.574 (14.51), 7.748 (15.35), 7.762 (13.30), 7.796 (16.00), 8.480 (3.35), 8.490 (6.88), 8.500 (3.35), 10.707 (4.37).
Example 30
Rac-N-{[2,5-Dioxo-4-(Pyrazin-2-Yl)Imidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2278) ##STR00428##
(2279) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (53.5 mg, 201 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (98 l, 560 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (50.1 mg, 261 mol), 1H-benzotriazol-1-ol hydrate (40.0 mg, 261 mol) and rac-5-(aminomethyl)-5-(pyrazin-2-yl)imidazolidine-2,4-dione hydrochloride (53.5 mg, 201 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 16.0 mg (96% purity, 17% yield) of the title compound were obtained.
(2280) LC-MS (Method 7): R.sub.t=1.49 min; MS (ESIpos): m/z=456 [M+H].sup.+
(2281) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.085 (0.88), 2.384 (0.53), 2.423 (0.80), 2.515 (1.06), 2.518 (1.06), 2.521 (0.97), 2.572 (3.09), 2.612 (0.53), 2.652 (0.80), 2.732 (0.44), 2.890 (0.53), 3.275 (2.56), 3.280 (2.65), 3.286 (2.48), 3.289 (3.36), 3.318 (2.56), 3.337 (0.53), 3.340 (12.55), 3.343 (1.59), 3.950 (3.01), 3.960 (3.18), 3.973 (4.42), 3.983 (4.15), 4.056 (4.15), 4.066 (4.60), 4.079 (3.27), 4.089 (2.92), 5.798 (0.44), 5.806 (0.44), 7.415 (4.33), 7.418 (4.42), 7.429 (13.70), 7.441 (6.63), 7.458 (3.89), 7.461 (3.62), 7.471 (6.54), 7.473 (6.01), 7.483 (3.09), 7.485 (2.74), 7.527 (9.64), 7.540 (14.41), 7.551 (6.28), 7.553 (5.75), 7.563 (2.83), 7.565 (2.65), 7.576 (0.62), 7.714 (0.53), 7.734 (10.96), 7.748 (9.46), 8.380 (11.58), 8.545 (0.53), 8.662 (3.09), 8.665 (11.40), 8.669 (16.00), 8.682 (2.74), 8.689 (8.49), 8.692 (9.02), 8.693 (6.90), 8.696 (6.36), 8.709 (0.53), 8.809 (12.46), 8.811 (11.85), 11.050 (2.74).
Example 31
Ent-N-{[4-(1,5-Dimethyl-1H-Pyrazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2282) ##STR00429##
(2283) Enantiomeric separation of rac-N-{[4-(1,5-dimethyl-1H-pyrazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (85.0 mg, 180 mol) using the following method: Diacel Chiralpak IA 5 m 250*20 mm Eluent A: 40% n-heptane, eluent B: 60% iso-propanol Flow: 15 ml/min UV-detection: 220 nm Temperature: 40 C.
(2284) Further purification was needed bei preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min; 0.1% formic acid). After lyophilisation 16.0 mg (97% purity, 18% yield) of the title compound were obtained.
(2285) Chiral-HPLC (Column: DiacellC-3 3 m 50*4.6 mm, eluent A: 50% n-heptane, eluent B: 50% iso-propanol, flow: 1 ml/min, UV-detection: 220 nm): R.sub.t=1.787 min; 100% ee
(2286) LC-MS (Method 7): R.sub.t=1.48 min; MS (ESIpos): m/z=472 [M+H].sup.+
(2287) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.253 (15.10), 2.470 (0.44), 3.266 (1.35), 3.333 (0.66), 3.702 (16.00), 3.767 (2.04), 3.770 (1.98), 3.780 (2.23), 7.371 (5.13), 7.402 (1.19), 7.404 (1.27), 7.415 (1.94), 7.417 (1.87), 7.429 (1.58), 7.442 (1.91), 7.455 (1.08), 7.457 (1.05), 7.467 (1.90), 7.469 (1.63), 7.480 (0.92), 7.482 (0.79), 7.536 (3.61), 7.549 (4.69), 7.561 (0.69), 7.564 (0.63), 7.740 (3.18), 7.754 (2.76), 8.132 (3.14), 8.592 (0.76), 8.602 (1.51), 8.612 (0.71), 10.858 (1.72).
Example 32
Rac-N-{[4-(4-Methyl-1,2,5-Oxadiazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2288) ##STR00430##
(2289) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (80.0 mg, 300 mol) dissolved in 2.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (80.0 mg, 300 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (74.9 mg, 391 mol), 1H-benzotriazol-1-ol hydrate (59.8 mg, 391 mol) and rac-5-(aminomethyl)-5-(4-methyl-1,2,5-oxadiazol-3-yl)imidazolidine-2,4-dione hydrochloride (80.0 mg, 93% purity, 300 mol). The mixture was stirred at room temperature for 3 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 42.0 mg (98% purity, 30% yield) of the title compound were obtained.
(2290) LC-MS (Method 7): R.sub.t=1.73 min; MS (ESIpos): m/z=460 [M+H].sup.+
(2291) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.51), 0.008 (0.57), 2.363 (16.00), 2.525 (0.43), 4.015 (1.81), 4.022 (1.86), 4.030 (1.82), 4.038 (1.76), 7.443 (2.33), 7.462 (4.14), 7.474 (1.21), 7.477 (1.22), 7.492 (1.96), 7.496 (1.42), 7.511 (0.79), 7.514 (0.96), 7.524 (2.78), 7.544 (3.25), 7.552 (1.68), 7.556 (1.35), 7.571 (1.61), 7.575 (1.35), 7.590 (0.53), 7.593 (0.59), 7.749 (3.32), 7.770 (2.75), 8.550 (2.71), 8.868 (0.72), 8.883 (1.52), 8.899 (0.71).
Example 33
Rac-5-Chloro-N-{[4-(1,5-Dimethyl-1H-Pyrazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2292) ##STR00431##
(2293) 5-chloro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (139 mg, 462 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (240 l, 1.4 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (115 mg, 601 mol), 1H-benzotriazol-1-ol hydrate (92.0 mg, 601 mol) and rac-5-(aminomethyl)-5-(1,5-dimethyl-1H-pyrazol-4-yl)imidazolidine-2,4-dione hydrochloride (120 mg, 462 mol). The mixture was stirred at room temperature over night. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 130 mg (100% purity, 56% yield) of the title compound were obtained.
(2294) LC-MS (Method 7): R.sub.t=1.67 min; MS (ESIpos): m/z=506 [M+H].sup.+
(2295) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.068 (1.02), 2.250 (15.24), 3.699 (16.00), 3.742 (0.44), 3.754 (1.51), 3.766 (2.69), 3.776 (1.59), 3.788 (0.44), 7.369 (5.50), 7.413 (2.83), 7.427 (3.31), 7.514 (3.10), 7.517 (3.48), 7.558 (3.48), 7.561 (4.09), 7.572 (3.57), 7.575 (3.99), 7.756 (3.19), 7.770 (2.77), 8.168 (2.91), 8.678 (0.76), 8.688 (1.51), 8.698 (0.74), 10.865 (1.79).
Example 34
Rac-N-{[4-(2,4-Dimethyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2296) ##STR00432##
(2297) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (96.6 mg, 361 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (190 l, 1.1 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (90.1 mg, 470 mol), 1H-benzotriazol-1-ol hydrate (71.9 mg, 470 mol) and rac-5-(aminomethyl)-5-(2,4-dimethyl-1,3-thiazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 361 mol). The mixture was stirred at room temperature over night. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 bis 2 min 7 ml, eluent A 2 bis 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 110 mg (100% purity, 62% yield) of the title compound were obtained.
(2298) LC-MS (Method 7): R.sub.t=1.37 min; MS (ESIpos): m/z=490 [M+H].sup.+
(2299) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.346 (16.00), 3.832 (2.05), 3.835 (2.00), 3.842 (1.84), 3.845 (1.93), 7.480 (1.27), 7.481 (1.32), 7.492 (1.81), 7.494 (1.77), 7.520 (1.35), 7.521 (1.46), 7.534 (1.93), 7.542 (0.93), 7.544 (0.91), 7.555 (1.83), 7.557 (1.60), 7.567 (0.96), 7.569 (0.83), 7.603 (1.25), 7.606 (1.22), 7.616 (1.68), 7.618 (1.60), 7.628 (0.65), 7.631 (0.60), 7.911 (2.89), 7.913 (5.90), 8.469 (3.34), 8.721 (2.45), 8.767 (0.76), 8.777 (1.53), 8.787 (0.73), 11.139 (1.13).
Example 35
Rac-N-{[4-(1,4-Dimethyl-1H-Pyrazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2300) ##STR00433##
(2301) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (170 mg, 635 mol) dissolved in 2.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (330 l, 1.9 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (158 mg, 826 mol), 1H-benzotriazol-1-ol hydrate (126 mg, 826 mol) and rac-5-(aminomethyl)-5-(1,4-dimethyl-1H-pyrazol-3-yl)imidazolidine-2,4-dione hydrochloride (165 mg, 635 mol). The mixture was stirred at room temperature over night. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 bis 2 min 7 ml, eluent A 2 bis 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 200 mg (100% purity, 67% yield) of the title compound were obtained.
(2302) LC-MS (Method 7): R.sub.t=1.35 min; MS (ESIpos): m/z=473 [M+H].sup.+
(2303) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.883 (11.89), 2.068 (0.53), 3.269 (0.49), 3.742 (16.00), 3.943 (0.44), 3.955 (1.60), 3.966 (2.89), 3.976 (1.64), 3.988 (0.41), 7.458 (3.53), 7.471 (1.21), 7.484 (1.97), 7.523 (2.44), 7.536 (3.79), 7.548 (1.02), 7.551 (0.70), 7.587 (1.32), 7.589 (1.24), 7.600 (1.28), 7.602 (1.61), 7.612 (0.64), 7.614 (0.59), 7.932 (1.65), 7.945 (2.62), 7.986 (1.41), 7.990 (1.37), 8.000 (0.85), 8.003 (0.83), 8.106 (3.26), 8.558 (0.73), 8.568 (1.52), 8.579 (0.71), 8.744 (2.06), 8.747 (2.03), 10.898 (1.36).
Example 36
Rac-N-{[2,5-Dioxo-4-(Tetrahydro-2H-Pyran-4-Yl)Imidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2304) ##STR00434##
(2305) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (53.5 mg, 200 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (98 l, 560 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (49.9 mg, 260 mol), 1H-benzotriazol-1-ol hydrate (39.9 mg, 260 mol) and rac-5-(aminomethyl)-5-(tetrahydro-2H-pyran-4-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 200 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 bis 2 min 7 ml, eluent A 2 bis 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 43.0 mg (99% purity, 46% yield) of the title compound were obtained.
(2306) LC-MS (Method 7): R.sub.t=1.28 min; MS (ESIpos): m/z=463 [M+H].sup.+
(2307) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.77), 1.281 (3.18), 1.300 (5.21), 1.312 (4.06), 1.320 (3.56), 1.333 (3.75), 1.340 (3.52), 1.353 (1.53), 1.361 (1.34), 1.378 (1.38), 1.386 (1.61), 1.399 (3.52), 1.406 (3.75), 1.419 (3.33), 1.426 (3.29), 1.440 (1.30), 1.447 (1.11), 1.570 (3.98), 1.591 (3.37), 1.868 (1.45), 1.873 (2.60), 1.879 (1.61), 1.887 (2.79), 1.893 (4.71), 1.899 (2.68), 1.908 (1.45), 1.913 (2.22), 2.069 (4.13), 2.383 (0.50), 2.422 (0.80), 2.514 (1.11), 2.517 (1.11), 2.520 (1.03), 2.571 (1.99), 2.611 (0.46), 2.651 (0.73), 3.201 (5.74), 3.221 (10.60), 3.241 (5.74), 3.261 (0.57), 3.325 (0.88), 3.329 (3.87), 3.385 (4.48), 3.395 (5.09), 3.407 (6.55), 3.418 (6.01), 3.516 (5.93), 3.527 (6.28), 3.539 (4.71), 3.550 (4.40), 3.812 (3.67), 3.819 (3.94), 3.831 (3.64), 3.837 (3.48), 3.853 (3.83), 3.859 (4.02), 3.871 (3.64), 3.878 (3.41), 7.500 (6.24), 7.502 (7.08), 7.508 (9.68), 7.512 (12.78), 7.515 (12.52), 7.520 (12.40), 7.529 (6.55), 7.531 (6.39), 7.542 (10.91), 7.544 (9.19), 7.554 (5.01), 7.556 (4.17), 7.588 (7.46), 7.591 (7.16), 7.600 (9.68), 7.603 (8.88), 7.613 (3.56), 7.615 (3.52), 7.827 (13.59), 7.926 (10.26), 7.939 (16.00), 7.982 (8.73), 7.985 (8.34), 7.995 (5.24), 7.998 (5.09), 8.547 (4.33), 8.557 (8.61), 8.568 (4.13), 8.735 (13.01), 8.738 (12.52), 10.711 (11.79).
Example 37
Ent-N-{[4-(4-Methyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2308) ##STR00435##
(2309) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (50.9 mg, 190 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (99 l, 570 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (47.4 mg, 247 mol), 1H-benzotriazol-1-ol hydrate (37.9 mg, 247 mol) and ent-5-(aminomethyl)-5-(4-methyl-1,3-thiazol-5-yl)imidazolidine-2,4-dione hydrochloride (Enantiomer 2) (50.0 mg, 190 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 bis 2 min 7 ml, eluent A 2 bis 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 65.0 mg (100% purity, 72% yield) of the title compound were obtained.
(2310) LC-MS (Method 7): R.sub.t=1.31 min; MS (ESIpos): m/z=476 [M+H].sup.+
(2311) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.069 (0.41), 2.451 (16.00), 3.886 (3.09), 3.897 (3.18), 7.467 (1.28), 7.469 (1.36), 7.480 (1.78), 7.482 (1.76), 7.521 (1.32), 7.522 (1.48), 7.535 (1.96), 7.541 (0.96), 7.543 (0.92), 7.553 (1.87), 7.555 (1.62), 7.566 (0.99), 7.568 (0.85), 7.604 (1.25), 7.606 (1.25), 7.617 (1.68), 7.619 (1.65), 7.629 (0.65), 7.631 (0.62), 7.886 (0.58), 7.890 (0.56), 7.900 (1.75), 7.903 (1.83), 7.912 (3.02), 7.913 (3.16), 7.926 (0.95), 7.927 (0.92), 8.517 (2.61), 8.723 (1.99), 8.726 (2.07), 8.798 (0.73), 8.808 (1.52), 8.818 (0.72), 8.927 (5.41), 11.179 (1.75).
Example 38
Diamix-N-[(4-Sec-Butyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2312) ##STR00436##
(2313) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (60.0 mg, 226 mol) dissolved in 2.2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (110 l, 630 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (56.2 mg, 293 mol), 1H-benzotriazol-1-ol hydrate (44.9 mg, 293 mol) and diamix-5-(aminomethyl)-5-sec-butylimidazolidine-2,4-dione hydrochloride (50.0 mg, 226 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 46.0 mg (100% purity, 47% yield) and 16.0 mg (97% purity, 16% yield) of the title compound were obtained.
(2314) LC-MS (Method 7): R.sub.t=1.77 min; MS (ESIpos): m/z=434 [M+H].sup.+
(2315) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.802 (9.99), 0.813 (12.49), 0.823 (13.69), 0.836 (7.92), 0.839 (11.43), 0.851 (5.56), 0.880 (11.36), 0.891 (11.71), 0.950 (0.62), 0.962 (0.64), 0.968 (0.76), 0.972 (0.86), 0.980 (0.76), 0.990 (0.75), 1.002 (0.53), 1.038 (0.70), 1.050 (0.75), 1.055 (0.84), 1.060 (0.97), 1.068 (0.84), 1.072 (0.81), 1.078 (0.96), 1.090 (0.75), 1.274 (0.76), 1.279 (0.86), 1.287 (0.89), 1.291 (0.96), 1.296 (0.84), 1.301 (0.81), 1.309 (0.67), 1.314 (0.62), 1.532 (0.64), 1.536 (0.72), 1.548 (0.86), 1.558 (0.88), 1.566 (0.75), 1.572 (1.31), 1.578 (0.88), 1.584 (1.21), 1.590 (1.10), 1.595 (0.89), 1.601 (0.83), 1.606 (0.69), 1.621 (0.86), 1.627 (1.02), 1.633 (1.00), 1.638 (1.47), 1.644 (0.97), 1.650 (0.92), 1.655 (0.76), 2.383 (0.48), 2.422 (0.46), 2.466 (0.61), 2.514 (1.04), 2.517 (0.96), 2.520 (0.81), 2.611 (0.41), 3.260 (1.31), 3.324 (0.56), 3.381 (1.61), 3.391 (1.80), 3.399 (1.72), 3.404 (2.49), 3.409 (1.93), 3.414 (2.22), 3.422 (2.09), 3.432 (1.82), 3.520 (2.17), 3.530 (2.23), 3.544 (2.60), 3.555 (2.52), 3.567 (1.53), 3.578 (1.39), 7.411 (2.29), 7.413 (2.68), 7.419 (7.94), 7.423 (4.94), 7.426 (4.56), 7.432 (10.41), 7.449 (2.33), 7.451 (2.28), 7.453 (2.23), 7.455 (2.10), 7.461 (3.79), 7.463 (3.62), 7.466 (3.63), 7.474 (1.83), 7.476 (1.75), 7.480 (1.51), 7.528 (2.69), 7.530 (4.08), 7.542 (5.83), 7.559 (10.44), 7.572 (11.33), 7.632 (5.66), 7.746 (16.00), 7.759 (8.51), 8.402 (2.04), 8.413 (3.98), 8.421 (1.93), 10.654 (3.35).
Example 39
Rac-N-{[4-(1,4-Dimethyl-1H-Pyrazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2316) ##STR00437##
(2317) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (103 mg, 385 mol) dissolved in 3 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (200 l, 1.2 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (96.0 mg, 501 mol), 1H-benzotriazol-1-ol hydrate (76.7 mg, 501 mol) and rac-5-(aminomethyl)-5-(1,4-dimethyl-1H-pyrazol-3-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 385 mol). The mixture was stirred at room temperature for 3 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C185 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 125 mg (100% purity, 69% yield) of the title compound were obtained.
(2318) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=472 [M+H].sup.+
(2319) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.886 (14.96), 2.071 (0.73), 2.499 (3.55), 3.739 (16.00), 3.912 (0.76), 3.928 (0.74), 3.947 (1.73), 3.962 (1.62), 3.981 (1.65), 3.997 (1.80), 4.016 (0.81), 4.032 (0.71), 7.407 (1.20), 7.410 (1.35), 7.426 (2.80), 7.428 (2.83), 7.435 (2.18), 7.454 (3.44), 7.465 (5.58), 7.486 (1.11), 7.529 (1.46), 7.532 (1.51), 7.548 (1.84), 7.551 (1.86), 7.570 (4.08), 7.591 (4.20), 7.762 (4.30), 7.783 (3.58), 8.119 (4.76), 8.512 (1.00), 8.528 (2.02), 8.543 (0.94), 10.902 (0.42).
Example 40
Rac-N-{[4-(1-Cyclopropyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2320) ##STR00438##
(2321) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (98.3 mg, 368 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (190 l, 1.1 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (91.7 mg, 478 mol), 1H-benzotriazol-1-ol hydrate (73.3 mg, 478 mol) and rac-5-(aminomethyl)-5-(1-cyclopropyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 368 mol). The mixture was stirred at room temperature for 3 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 bis 2 min 7 ml, eluent A 2 bis 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 65.0 mg (100% purity, 36% yield) of the title compound were obtained.
(2322) LC-MS (Method 7): R.sub.t=1.36 min; MS (ESIpos): m/z=485 [M+H].sup.+
(2323) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.831 (0.97), 0.839 (2.04), 0.846 (2.04), 0.849 (2.81), 0.851 (2.52), 0.857 (3.39), 0.860 (2.13), 0.863 (2.04), 0.867 (2.23), 0.875 (1.75), 0.881 (1.26), 0.893 (2.72), 0.897 (2.23), 0.901 (2.23), 0.905 (3.01), 0.909 (4.17), 0.917 (3.39), 0.921 (2.42), 0.929 (1.65), 0.950 (1.94), 0.959 (2.52), 0.963 (3.39), 0.967 (1.65), 0.971 (3.98), 0.975 (3.30), 0.979 (2.42), 0.984 (2.04), 0.987 (2.52), 1.000 (1.07), 1.260 (1.55), 1.268 (2.23), 1.272 (1.94), 1.275 (2.23), 1.278 (3.10), 1.286 (3.20), 1.292 (1.75), 1.295 (1.75), 1.304 (1.16), 2.383 (0.68), 2.422 (1.07), 2.517 (1.45), 2.571 (2.33), 2.611 (0.58), 2.651 (1.07), 3.264 (1.94), 3.312 (2.62), 3.322 (1.55), 3.331 (8.63), 3.443 (1.65), 3.449 (3.01), 3.455 (4.07), 3.461 (5.72), 3.467 (4.17), 3.473 (3.10), 3.479 (1.45), 3.892 (2.91), 3.902 (3.39), 3.914 (5.53), 3.924 (4.85), 3.962 (5.04), 3.973 (5.33), 3.984 (3.10), 3.996 (2.91), 6.526 (14.45), 6.529 (14.64), 7.339 (16.00), 7.342 (15.42), 7.513 (4.27), 7.515 (4.85), 7.525 (14.84), 7.527 (8.92), 7.536 (8.82), 7.544 (4.95), 7.546 (4.56), 7.556 (7.95), 7.558 (6.79), 7.569 (3.78), 7.571 (3.10), 7.606 (5.43), 7.609 (5.14), 7.619 (7.18), 7.621 (6.40), 7.632 (2.42), 7.634 (2.81), 7.918 (7.56), 7.931 (11.44), 7.979 (6.11), 7.982 (6.01), 7.992 (3.88), 7.995 (3.98), 8.324 (10.18), 8.738 (9.12), 8.741 (9.12), 8.827 (3.20), 8.837 (6.30), 8.848 (3.20), 11.186 (8.63).
Example 41
Rac-N-{[4-(3-Methyl-1,2-Oxazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2324) ##STR00439##
(2325) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (179 mg, 669 mol) dissolved in 2.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (350 l, 2.0 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (167, 870 mol), 1H-benzotriazol-1-ol hydrate (133 mg, 870 mol) and rac-5-(aminomethyl)-5-(3-methyl-1,2-oxazol-4-yl)imidazolidine-2,4-dione hydrochloride (165 mg, 669 mol). The mixture was stirred at room temperature for 3 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 bis 2 min 7 ml, eluent A 2 bis 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 180 mg (100% purity, 59% yield) of the title compound were obtained.
(2326) LC-MS (Method 7): R.sub.t=1.36 min; MS (ESIpos): m/z=460 [M+H].sup.+
(2327) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.069 (5.93), 2.230 (16.00), 3.777 (0.74), 3.786 (0.82), 3.799 (1.54), 3.809 (1.38), 3.833 (1.42), 3.844 (1.49), 3.856 (0.75), 3.867 (0.70), 7.485 (1.40), 7.487 (1.46), 7.497 (2.10), 7.499 (2.03), 7.517 (1.52), 7.518 (1.65), 7.530 (1.98), 7.531 (2.14), 7.541 (1.08), 7.543 (1.05), 7.554 (2.13), 7.556 (1.79), 7.566 (1.12), 7.568 (0.92), 7.602 (1.46), 7.605 (1.40), 7.615 (1.96), 7.617 (1.84), 7.628 (0.75), 7.630 (0.69), 7.895 (1.50), 7.907 (3.24), 7.928 (1.83), 7.931 (1.74), 7.942 (0.80), 7.945 (0.82), 8.273 (2.63), 8.726 (2.33), 8.729 (2.27), 8.804 (0.83), 8.815 (1.54), 8.825 (0.80), 8.959 (5.13), 11.141 (2.11).
Example 42
Rac-N-{[2,5-Dioxo-4-(Pyridazin-3-Yl)Imidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2328) ##STR00440##
(2329) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (62.3 mg, 234 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (110 l, 660 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (58.3 mg, 304 mol), 1H-benzotriazol-1-ol hydrate (46.6 mg, 304 mol) and rac-5-(aminomethyl)-5-(pyridazin-3-yl)imidazolidine-2,4-dione hydrochloride (57.0 mg, 234 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 2.50 mg (87% purity, 2% yield) of the title compound were obtained.
(2330) LC-MS (Method 7): R.sub.t=1.47 min; MS (ESIpos): m/z=456 [M+H].sup.+
(2331) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.150 (1.56), 0.008 (14.63), 0.008 (16.00), 0.146 (1.95), 0.960 (1.76), 2.327 (2.73), 2.366 (2.73), 2.524 (9.76), 2.669 (2.73), 2.710 (2.54), 2.821 (1.17), 2.934 (2.15), 3.776 (3.71), 3.790 (2.73), 3.941 (0.98), 4.000 (1.37), 4.017 (1.37), 4.035 (1.95), 4.051 (1.95), 4.122 (1.76), 4.137 (2.15), 4.157 (1.56), 4.171 (1.17), 7.412 (1.95), 7.428 (6.24), 7.448 (5.27), 7.472 (4.49), 7.494 (3.12), 7.528 (5.27), 7.538 (3.71), 7.549 (7.22), 7.572 (2.93), 7.634 (2.54), 7.654 (4.29), 7.705 (3.51), 7.739 (8.39), 7.751 (3.71), 7.761 (8.59), 7.773 (5.07), 7.817 (4.68), 7.821 (4.88), 7.838 (2.54), 7.842 (2.34), 8.490 (4.88), 8.720 (2.73), 9.245 (3.51), 9.249 (3.71), 9.257 (3.51), 9.261 (3.12), 11.105 (2.34).
Example 43
Rac-N-{[4-(4-Methyl-1,3-Oxazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2332) ##STR00441##
(2333) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (6.99 mg, 26.3 mol) dissolved in 0.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (14 l, 79 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (6.55 mg, 34.2 mol), 1H-benzotriazol-1-ol hydrate (5.23 mg, 34.2 mol) and rac-5-(aminomethyl)-5-(4-methyl-1,3-oxazol-5-yl)imidazolidine-2,4-dione hydrochloride (8.00 mg, 81% purity, 26.3 mol). The mixture was stirred at room temperature for 3 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 bis 2 min 7 ml, eluent A 2 bis 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 5.00 mg (100% purity, 42% yield) of the title compound were obtained.
(2334) LC-MS (Method 8): R.sub.t=0.82 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2335) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.46), 0.008 (0.56), 2.121 (16.00), 2.328 (0.64), 2.366 (0.51), 2.670 (0.59), 2.710 (0.48), 3.893 (3.05), 3.909 (3.05), 7.415 (1.17), 7.435 (3.15), 7.458 (2.54), 7.478 (1.98), 7.496 (0.97), 7.529 (2.85), 7.541 (1.81), 7.549 (3.43), 7.559 (1.88), 7.563 (1.68), 7.578 (0.71), 7.581 (0.64), 7.750 (3.51), 7.770 (2.85), 8.292 (4.58), 8.466 (3.15), 8.737 (0.71), 8.752 (1.58), 8.768 (0.74), 11.143 (1.04).
Example 44
Rac-N-{[4-(4-Methyl-1,2-Oxazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2336) ##STR00442##
(2337) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (92.8 mg, 349 mol) dissolved in 3 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (180 l, 1.0 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (86.9 mg, 453 mol), 1H-benzotriazol-1-ol hydrate (69.4 mg, 453 mol) and rac-5-(aminomethyl)-5-(4-methyl-1,2-oxazol-3-yl)imidazolidine-2,4-dione hydrochloride (86.0 mg, 349 mol). The mixture was stirred at room temperature for 3 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 bis 2 min 15 ml, eluent A 2 bis 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 80.0 mg (100% purity, 50% yield) of the title compound were obtained.
(2338) LC-MS (Method 7): R.sub.t=1.66 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2339) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.55), 0.008 (0.66), 1.927 (16.00), 2.072 (1.37), 3.994 (4.56), 4.010 (4.58), 7.423 (1.39), 7.427 (1.59), 7.442 (5.88), 7.462 (4.78), 7.480 (2.73), 7.499 (1.23), 7.502 (1.07), 7.543 (2.18), 7.551 (4.42), 7.561 (3.00), 7.565 (3.51), 7.572 (4.99), 7.583 (1.07), 7.759 (5.07), 7.780 (4.14), 8.454 (4.98), 8.745 (4.22), 8.747 (4.89), 8.765 (2.43), 8.780 (1.09).
Example 45
Rac-N-{[4-(1-Cyclopropyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2340) ##STR00443##
(2341) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (98.0 mg, 368 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (190 l, 1.1 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (91.7 mg, 478 mol), 1H-benzotriazol-1-ol hydrate (73.3 mg, 478 mol) and rac-5-(aminomethyl)-5-(1-cyclopropyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 368 mol). The mixture was stirred at room temperature for 2 h. The product was purified by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). After lyophilisation 69.0 mg (100% purity, 39% yield) of the title compound were obtained.
(2342) LC-MS (Method 7): R.sub.t=1.58 min; MS (ESIpos): m/z=484 [M+H].sup.+
(2343) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.14), 0.008 (2.72), 0.815 (0.91), 0.828 (2.07), 0.837 (2.15), 0.843 (2.92), 0.846 (3.04), 0.855 (3.63), 0.860 (2.47), 0.863 (2.41), 0.871 (3.98), 0.881 (2.39), 0.890 (2.83), 0.896 (2.67), 0.902 (1.91), 0.908 (3.43), 0.913 (4.69), 0.925 (3.72), 0.931 (2.90), 0.945 (3.12), 0.957 (2.83), 0.964 (3.79), 0.976 (4.26), 0.981 (3.43), 0.987 (2.20), 0.994 (2.26), 0.999 (2.47), 1.005 (1.29), 1.018 (1.07), 1.059 (1.27), 1.076 (2.22), 1.133 (0.54), 1.256 (1.61), 1.268 (2.67), 1.273 (2.20), 1.277 (2.43), 1.282 (3.60), 1.294 (3.55), 1.299 (2.15), 1.304 (1.97), 1.309 (2.00), 1.321 (1.21), 1.757 (0.49), 2.370 (1.73), 2.572 (1.69), 2.710 (0.49), 2.890 (0.43), 3.449 (1.54), 3.458 (3.04), 3.467 (4.13), 3.476 (5.63), 3.485 (4.22), 3.494 (3.02), 3.503 (1.46), 3.890 (2.22), 3.905 (2.52), 3.924 (5.71), 3.939 (5.24), 3.958 (5.29), 3.974 (5.49), 3.991 (2.33), 4.008 (2.15), 4.376 (0.97), 4.390 (0.96), 5.364 (1.03), 5.387 (1.03), 6.517 (14.19), 6.522 (14.53), 7.061 (0.44), 7.188 (0.47), 7.317 (0.52), 7.342 (14.22), 7.347 (14.32), 7.438 (7.21), 7.448 (2.94), 7.458 (9.93), 7.466 (11.09), 7.471 (16.00), 7.488 (8.42), 7.507 (3.20), 7.509 (3.01), 7.529 (0.50), 7.547 (6.34), 7.558 (13.35), 7.565 (8.49), 7.571 (9.55), 7.578 (15.21), 7.588 (3.48), 7.753 (15.00), 7.773 (12.33), 8.350 (11.33), 8.353 (11.33), 8.792 (3.29), 8.807 (6.74), 8.823 (3.26), 11.205 (9.93).
Example 46
Ent-N-{[4-(1-Cyclopropyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2344) ##STR00444##
(2345) Enantiomeric separation of rac-N-{[4-(1-cyclopropyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (65.0 mg, 134 mol) using the following method: Diacel Chiralcel OX-H 5 m 25020 mm Eluent A: 70% n-heptane, eluent B: 30% ethanol Flow: 25 ml/min UV-detection: 220 nm Temperature: 40 C.
(2346) Further purification was necessary and done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). After lyophilisation 21.0 mg (100% purity, 32% yield) of the title compound were obtained.
(2347) Chiral-HPLC: (Column: Diacel Chiralpak OX-3 3 m 50*4.6 mm, eluent A: 70% i-hexane, eluent B: 30% ethanol, flow: 1 ml/min, UV-detection: 220 nm): R.sub.t=1.600 min; 99.05% ee
(2348) LC-MS (Method 7): R.sub.t=1.59 min; MS (ESIpos): m/z=484 [M+H].sup.+
(2349) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.833 (1.19), 0.841 (2.29), 0.847 (2.39), 0.851 (3.15), 0.859 (3.87), 0.865 (2.29), 0.869 (2.53), 0.877 (1.91), 0.885 (1.43), 0.897 (2.91), 0.901 (2.48), 0.905 (2.39), 0.909 (3.30), 0.913 (4.54), 0.921 (3.68), 0.925 (2.58), 0.933 (1.81), 0.954 (2.01), 0.962 (2.72), 0.966 (3.73), 0.970 (1.81), 0.974 (4.30), 0.978 (3.53), 0.982 (2.63), 0.987 (2.10), 0.991 (2.58), 1.003 (1.05), 1.266 (1.72), 1.274 (2.48), 1.278 (2.10), 1.284 (3.49), 1.292 (3.53), 1.298 (1.96), 1.302 (2.01), 1.310 (1.34), 2.352 (1.10), 2.383 (0.57), 2.422 (1.15), 2.570 (1.29), 2.611 (0.57), 2.651 (1.05), 3.261 (0.81), 3.272 (2.24), 3.333 (3.15), 3.366 (0.43), 3.459 (1.72), 3.466 (3.20), 3.472 (4.44), 3.478 (5.92), 3.484 (4.39), 3.490 (3.15), 3.496 (1.53), 3.900 (3.10), 3.909 (3.49), 3.922 (6.16), 3.932 (5.59), 3.961 (5.54), 3.972 (5.87), 3.983 (3.15), 3.994 (2.96), 6.510 (14.85), 6.513 (14.95), 7.339 (16.00), 7.342 (16.00), 7.439 (7.74), 7.452 (12.32), 7.465 (10.03), 7.467 (10.13), 7.473 (6.45), 7.475 (6.21), 7.485 (8.21), 7.498 (3.49), 7.551 (5.68), 7.554 (5.87), 7.561 (14.19), 7.563 (12.90), 7.566 (8.64), 7.574 (15.62), 7.751 (15.28), 7.765 (13.37), 8.313 (11.22), 8.315 (11.22), 8.756 (3.58), 8.766 (6.97), 8.777 (3.49), 11.182 (9.79).
Example 47
Ent-N-{[4-(2,4-Dimethyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2350) ##STR00445##
(2351) Enantiomeric separation of rac-N-{[4-(2,4-dimethyl-1,3-thiazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (60.0 mg, 123 mol) using the following method: Diacel Chiralpak IC 5 m 25020 mm Eluent A: 50% n-heptane, eluent B: 50% iso-propanol Flow: 30 ml/min UV-detection: 220 nm Temperature: 40 C.
(2352) Further purification was necessary and done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). After lyophilisation 21.0 mg (100% purity, 35% yield) of the title compound were obtained.
(2353) Chiral-HPLC: (Column: Diacel Chiralpak IC-3 3 m 50*4.6 mm, eluent A: 50% n-heptane, eluent B: 50% iso-propanol, flow: 1 ml/min, UV-detection: 220 nm): R.sub.t=1.078 min; 96.21% ee
(2354) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=489 [M+H].sup.+
(2355) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.352 (16.00), 3.333 (0.47), 3.835 (1.65), 3.844 (2.49), 3.854 (1.60), 7.413 (1.25), 7.415 (1.31), 7.426 (1.90), 7.428 (1.85), 7.436 (1.57), 7.449 (1.86), 7.471 (0.97), 7.473 (0.94), 7.483 (1.82), 7.485 (1.66), 7.498 (3.55), 7.511 (2.96), 7.549 (1.17), 7.551 (1.12), 7.561 (1.66), 7.563 (1.58), 7.574 (0.68), 7.576 (0.65), 7.743 (3.13), 7.757 (2.79), 8.453 (2.97), 8.696 (0.75), 8.707 (1.45), 8.717 (0.72), 11.135 (0.46).
Example 48
Rac-N-[(4-Cyclopentyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2356) ##STR00446##
(2357) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (57.0 mg, 214 mol) dissolved in 2 ml DMF was treated with N,N-diisopropylethylamine (110 l, 640 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (53.3 mg, 278 mol) and 1-hydroxybenzotriazole hydrate (42.6 mg, 278 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-cyclopentylimidazolidine-2,4-dione hydrochloride (50.0 mg, 214 mol) was added. The mixture was stirred at room temperature for 2 h. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A 0 to 2 min 47 ml, eluent B 0 to 2 min 23 ml, eluent A 2 to 10 min from 47 ml to 23 ml and eluent B from 23 ml to 47 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 62.0 mg (100% purity, 65% yield) and 8.00 mg (95% purity, 8% yield) of the title compound were obtained.
(2358) LC-MS (Method 7): R.sub.t=1.78 min; MS (ESIpos): m/z=446 [M+H].sup.+
(2359) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.87), 0.008 (0.90), 1.187 (1.27), 1.217 (2.48), 1.241 (1.44), 1.312 (2.17), 1.328 (1.82), 1.355 (1.04), 1.456 (7.68), 1.484 (4.53), 1.531 (4.62), 1.544 (3.90), 1.679 (2.43), 1.698 (2.02), 2.072 (1.27), 2.093 (2.14), 2.112 (2.97), 2.132 (1.96), 2.156 (0.61), 2.327 (0.78), 2.332 (0.55), 2.366 (0.61), 2.523 (3.06), 2.665 (0.55), 2.670 (0.78), 2.710 (0.61), 3.376 (2.60), 3.392 (2.92), 3.411 (5.69), 3.426 (5.23), 3.458 (5.17), 3.474 (5.46), 3.492 (2.66), 3.508 (2.51), 7.410 (4.39), 7.413 (5.52), 7.421 (7.65), 7.428 (10.57), 7.432 (10.95), 7.439 (10.86), 7.447 (5.92), 7.449 (5.78), 7.465 (8.69), 7.468 (7.16), 7.483 (3.96), 7.487 (3.32), 7.524 (6.06), 7.528 (5.98), 7.542 (7.91), 7.546 (8.17), 7.555 (13.72), 7.565 (4.71), 7.575 (15.34), 7.750 (16.00), 7.770 (14.38), 7.779 (12.27), 8.500 (3.23), 8.516 (6.82), 8.531 (3.21), 10.667 (9.99).
Example 49
Rac-N-{[4-(3-Methyl-1,2-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2360) ##STR00447##
(2361) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (102 mg, 381 mol) dissolved in 2 ml DMF was treated with N,N-diisopropylethylamine (200 l, 1.1 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (94.9 mg, 495 mol) and 1-hydroxybenzotriazole hydrate (75.8 mg, 495 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(3-methyl-1,2-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 381 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 73.0 mg (100% purity, 40% yield) of the title compound were obtained.
(2362) LC-MS (Method 7): R.sub.t=1.37 min; MS (ESIpos): m/z=476 [M+H].sup.+
(2363) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.406 (16.00), 3.891 (0.50), 3.906 (0.59), 3.925 (1.57), 3.940 (1.51), 3.950 (1.53), 3.966 (1.51), 3.984 (0.55), 4.000 (0.51), 7.483 (1.24), 7.486 (1.34), 7.502 (2.36), 7.505 (2.28), 7.521 (1.64), 7.539 (3.55), 7.554 (2.30), 7.558 (1.70), 7.573 (1.19), 7.576 (0.90), 7.599 (1.61), 7.603 (1.57), 7.618 (1.79), 7.622 (1.72), 7.637 (0.65), 7.640 (0.60), 7.905 (1.32), 7.925 (3.64), 7.945 (2.15), 7.949 (2.06), 7.965 (0.76), 7.970 (0.78), 8.286 (2.87), 8.732 (2.43), 8.736 (2.37), 8.827 (0.83), 8.843 (1.72), 8.858 (0.83), 9.117 (5.62), 11.175 (2.50).
Example 50
Rac-N-[(2,5-Dioxo-4-Phenylimidazolidin-4-Yl)Methyl]-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2364) ##STR00448##
(2365) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (55.3 mg, 207 mol) dissolved in 2 ml DMF was treated with N,N-diisopropylethylamine (100 l, 580 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (51.6 mg, 269 mol) and 1-hydroxybenzotriazole hydrate (41.2 mg, 269 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-phenylimidazolidine-2,4-dione hydrochloride (50.0 mg, 207 mol) was added. The mixture was stirred at room temperature for 2 h. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A 0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 71.0 mg (99% purity, 75% yield) of the title compound were obtained.
(2366) LC-MS (Method 7): R.sub.t=1.55 min; MS (ESIpos): m/z=455 [M+H].sup.+
(2367) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.76), 2.383 (0.61), 2.422 (0.76), 2.463 (0.58), 2.466 (0.47), 2.514 (1.34), 2.517 (1.30), 2.520 (1.16), 2.570 (0.72), 2.611 (0.47), 2.651 (0.65), 3.253 (0.94), 3.258 (0.72), 3.261 (2.17), 3.326 (1.55), 3.334 (0.47), 3.729 (3.25), 3.741 (3.47), 3.752 (6.07), 3.764 (5.74), 3.795 (5.71), 3.804 (6.32), 3.817 (3.47), 3.827 (3.07), 7.340 (2.60), 7.349 (1.91), 7.352 (8.49), 7.356 (2.56), 7.365 (6.43), 7.392 (10.22), 7.405 (16.00), 7.414 (2.85), 7.417 (7.26), 7.424 (6.47), 7.426 (6.57), 7.436 (8.13), 7.438 (7.87), 7.507 (6.83), 7.519 (13.18), 7.532 (8.78), 7.534 (7.44), 7.545 (5.74), 7.547 (5.74), 7.551 (15.10), 7.563 (14.05), 7.566 (9.90), 7.586 (5.71), 7.588 (5.74), 7.598 (7.77), 7.601 (7.73), 7.611 (3.14), 7.613 (3.07), 7.885 (3.25), 7.897 (15.31), 7.898 (15.42), 7.903 (10.62), 7.906 (9.61), 7.917 (1.91), 7.920 (2.17), 8.452 (14.59), 8.701 (12.89), 8.713 (3.47), 10.872 (7.15).
Example 51
Diamix-N-[(4-Sec-Butyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2368) ##STR00449##
(2369) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (60.3 mg, 226 mol) dissolved in 2 ml DMF was treated with N,N-diisopropylethylamine (110 l, 630 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (56.2 mg, 293 mol) and 1-hydroxybenzotriazole hydrate (44.9 mg, 293 mol) and stirred for 5 min at room temperature before diamix-5-(aminomethyl)-5-sec-butylimidazolidine-2,4-dione hydrochloride (50.0 mg, 226 mol) was added. The mixture was stirred at room temperature for 2 h. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 78.0 mg (100% purity, 80% yield) of the title compound were obtained.
(2370) LC-MS (Method 7): R.sub.t=1.52 min; MS (ESIpos): m/z=435 [M+H].sup.+
(2371) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.800 (12.82), 0.812 (16.00), 0.825 (14.31), 0.829 (7.30), 0.838 (8.74), 0.841 (14.62), 0.853 (7.22), 0.882 (11.63), 0.893 (11.98), 0.950 (0.77), 0.962 (0.79), 0.968 (0.98), 0.972 (1.09), 0.980 (0.98), 0.984 (0.96), 0.990 (1.00), 1.002 (0.69), 1.035 (0.71), 1.047 (0.79), 1.053 (0.86), 1.057 (0.98), 1.065 (0.92), 1.069 (0.82), 1.074 (0.96), 1.087 (0.77), 1.272 (0.79), 1.277 (0.86), 1.285 (0.94), 1.290 (1.00), 1.294 (0.88), 1.299 (0.84), 1.307 (0.67), 1.312 (0.63), 1.537 (0.79), 1.542 (0.94), 1.554 (1.13), 1.559 (0.92), 1.564 (1.11), 1.572 (1.07), 1.576 (1.05), 1.581 (1.28), 1.586 (1.17), 1.592 (1.36), 1.599 (1.42), 1.604 (1.11), 1.610 (1.05), 1.615 (0.82), 1.622 (0.54), 1.634 (0.86), 1.639 (1.05), 1.645 (1.07), 1.651 (1.48), 1.656 (1.00), 1.663 (0.96), 1.668 (0.77), 2.422 (0.42), 2.517 (0.59), 2.520 (0.54), 2.570 (0.63), 3.262 (0.50), 3.283 (0.90), 3.327 (1.30), 3.370 (1.72), 3.380 (1.84), 3.392 (2.45), 3.397 (2.24), 3.403 (2.38), 3.407 (2.26), 3.420 (2.59), 3.430 (2.34), 3.528 (2.07), 3.538 (2.38), 3.543 (2.57), 3.551 (2.18), 3.554 (2.78), 3.561 (1.88), 3.566 (1.99), 3.577 (1.76), 7.472 (2.45), 7.474 (2.57), 7.481 (3.01), 7.484 (5.04), 7.486 (4.08), 7.493 (4.58), 7.495 (4.45), 7.505 (6.13), 7.517 (8.39), 7.522 (3.05), 7.524 (3.07), 7.526 (2.66), 7.532 (4.31), 7.536 (5.31), 7.538 (3.91), 7.545 (2.28), 7.548 (2.66), 7.551 (1.92), 7.584 (5.04), 7.586 (3.49), 7.596 (6.71), 7.609 (2.55), 7.661 (4.94), 7.768 (4.39), 7.923 (6.30), 7.937 (10.21), 7.977 (5.61), 7.991 (3.45), 8.487 (1.69), 8.497 (4.06), 8.505 (3.97), 8.515 (1.53), 8.733 (8.97), 8.736 (8.93), 10.654 (4.41), 10.664 (4.02).
Example 52
Rac-N-{[4-(1,4-Dimethyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2372) ##STR00450##
(2373) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (97.3 mg, 364 mol) dissolved in 1.5 ml DMF was treated with N,N-diisopropylethylamine (190 l, 1.1 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (90.8 mg, 474 mol) and 1-hydroxybenzotriazole hydrate (72.5 mg, 474 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(1,4-dimethyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 226 mol) was added. The mixture was stirred at room temperature overnight. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 17.0 mg (100% purity, 10% yield) of the title compound were obtained.
(2374) LC-MS (Method 7): R.sub.t=1.34 min; MS (ESIpos): m/z=473 [M+H].sup.+
(2375) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.51), 0.008 (0.54), 2.102 (13.39), 2.523 (1.32), 3.836 (16.00), 3.966 (0.58), 3.981 (0.65), 4.000 (1.27), 4.014 (1.16), 4.043 (1.16), 4.060 (1.21), 4.077 (0.59), 4.094 (0.55), 7.198 (4.44), 7.482 (1.10), 7.485 (1.21), 7.501 (2.02), 7.503 (1.97), 7.519 (1.31), 7.522 (1.46), 7.538 (2.61), 7.540 (3.18), 7.556 (2.08), 7.559 (1.55), 7.574 (1.09), 7.578 (0.83), 7.603 (1.49), 7.606 (1.44), 7.621 (1.66), 7.625 (1.61), 7.640 (0.61), 7.643 (0.55), 7.891 (0.50), 7.896 (0.47), 7.911 (2.08), 7.916 (2.33), 7.923 (3.44), 7.925 (3.63), 7.943 (0.76), 7.945 (0.73), 8.373 (2.94), 8.738 (2.19), 8.797 (0.73), 8.812 (1.46), 8.828 (0.70), 11.201 (1.86).
Example 53
Rac-N-{[4-(4-Methyl-1,2,5-Thiadiazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2376) ##STR00451##
(2377) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (101 mg, 379 mol) dissolved in 1.5 ml DMF was treated with N,N-diisopropylethylamine (200 l, 1.1 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (200 l, 1.1 mmol) and 1-hydroxybenzotriazole hydrate (75.5 mg, 493 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(4-methyl-1,2,5-thiadiazol-3-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 379 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 46.0 mg (100% purity, 25% yield) of the title compound were obtained.
(2378) LC-MS (Method 7): R.sub.t=1.47 min; MS (ESIpos): m/z=477 [M+H].sup.+
(2379) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.48), 2.069 (3.00), 2.471 (16.00), 2.518 (0.48), 3.274 (2.00), 3.279 (1.24), 3.340 (0.97), 3.344 (0.79), 4.117 (2.14), 4.129 (2.07), 7.499 (1.03), 7.501 (1.07), 7.512 (1.83), 7.531 (1.34), 7.544 (2.59), 7.555 (1.79), 7.557 (1.38), 7.567 (0.86), 7.569 (0.69), 7.605 (1.17), 7.607 (1.10), 7.618 (1.52), 7.620 (1.45), 7.630 (0.59), 7.632 (0.55), 7.925 (1.41), 7.939 (2.55), 7.970 (1.38), 7.973 (1.38), 7.984 (0.76), 7.987 (0.76), 8.382 (2.93), 8.743 (1.93), 8.746 (1.90), 8.825 (0.69), 8.835 (1.41), 8.845 (0.66), 11.369 (1.21).
Example 54
4-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-Fluoro[Biphenyl]-2-Carboxamide
(2380) ##STR00452##
(2381) 4-chloro-2-fluoro[1,1-biphenyl]-2-carboxylic acid (48.8 mg, 195 mol) dissolved in 2 ml of DMF was treated with N,N-diisopropylethylamine (95 l, 540 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol) and 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and stirred for 5 min at room temperature before (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) was added. The mixture was stirred at room temperature overnight. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 69.0 mg (100% purity, 88% yield) of the title compound were obtained.
(2382) LC-MS (Method 7): R.sub.t=1.54 min; MS (ESIpos): m/z=402 [M+H].sup.+
(2383) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.88), 0.087 (0.94), 0.101 (2.35), 0.112 (4.05), 0.125 (4.27), 0.136 (3.08), 0.149 (1.40), 0.277 (0.79), 0.300 (2.59), 0.312 (3.23), 0.323 (3.08), 0.334 (2.38), 0.345 (1.74), 0.363 (1.43), 0.374 (2.50), 0.388 (2.80), 0.396 (3.87), 0.409 (2.99), 0.423 (2.16), 0.437 (3.44), 0.448 (3.99), 0.461 (3.84), 0.473 (2.41), 0.486 (0.82), 1.035 (1.31), 1.048 (2.68), 1.056 (2.90), 1.061 (2.13), 1.069 (4.97), 1.076 (2.07), 1.082 (2.65), 1.090 (2.44), 1.103 (1.07), 2.072 (0.67), 2.327 (0.79), 2.366 (0.58), 2.669 (0.85), 2.674 (0.64), 2.710 (0.58), 3.429 (2.38), 3.444 (2.68), 3.463 (6.28), 3.478 (5.88), 3.497 (5.88), 3.513 (6.10), 3.531 (2.53), 3.548 (2.41), 7.285 (0.91), 7.305 (15.54), 7.310 (12.04), 7.316 (16.00), 7.330 (1.34), 7.337 (1.04), 7.355 (6.77), 7.373 (7.89), 7.405 (6.06), 7.432 (6.13), 7.465 (12.04), 7.488 (5.73), 7.503 (8.53), 7.506 (8.50), 7.516 (12.89), 7.527 (8.26), 7.532 (7.38), 7.545 (6.74), 7.550 (5.52), 7.563 (2.86), 7.568 (2.41), 8.392 (3.20), 8.408 (6.64), 8.423 (3.23), 10.615 (9.30).
Example 55
Rac-N-{[4-(1,3-Dimethyl-1H-Pyrazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2384) ##STR00453##
(2385) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (103 mg, 385 mol) dissolved in 1.5 ml of DMF was treated with N,N-diisopropylethylamine (200 l, 1.2 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (96.0 mg, 501 mol) and 1-hydroxybenzotriazole hydrate (76.7 mg, 501 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(1,3-dimethyl-1H-pyrazol-4-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 385 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 63.0 mg (100% purity, 35% yield) of the title compound were obtained.
(2386) LC-MS (Method 7): R.sub.t=1.25 min; MS (ESIpos): m/z=473 [M+H].sup.+
(2387) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.101 (15.88), 3.341 (0.93), 3.345 (0.44), 3.703 (16.00), 3.759 (2.99), 3.769 (2.72), 7.474 (1.56), 7.487 (2.37), 7.515 (1.76), 7.529 (3.40), 7.542 (2.26), 7.554 (1.16), 7.592 (1.49), 7.605 (1.99), 7.618 (0.77), 7.685 (5.42), 7.907 (1.08), 7.921 (3.88), 7.930 (2.45), 7.933 (2.22), 7.943 (0.68), 7.946 (0.68), 8.065 (3.92), 8.669 (0.91), 8.679 (1.83), 8.689 (0.89), 8.726 (2.80), 10.872 (2.49).
Example 56
3-(4-Chlorophenyl)-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}Isonicotinamide
(2388) ##STR00454##
(2389) 3-(4-chlorophenyl)pyridine-4-carboxylic acid (56.8 mg, 243 mol) dissolved in 1.5 ml of DMF was treated with N,N-diisopropylethylamine (130 l, 730 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (60.6 mg, 316 mol) and 1-hydroxybenzotriazole hydrate (48.4 mg, 316 mol) and stirred for 5 min at room temperature before (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol) was added. The mixture was stirred at room temperature overnight. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 63.0 mg (100% purity, 67% yield) of the title compound were obtained.
(2390) LC-MS (Method 7): R.sub.t=1.20 min; MS (ESIpos): m/z=385 [M+H].sup.+
(2391) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.115 (0.53), 0.129 (1.34), 0.140 (2.36), 0.153 (2.55), 0.164 (1.80), 0.177 (0.84), 0.302 (0.45), 0.317 (0.79), 0.325 (1.49), 0.337 (1.89), 0.348 (1.79), 0.359 (1.43), 0.369 (1.11), 0.380 (0.94), 0.391 (1.47), 0.405 (1.71), 0.413 (2.24), 0.426 (1.72), 0.434 (1.02), 0.448 (1.42), 0.461 (1.94), 0.472 (2.40), 0.485 (2.31), 0.497 (1.44), 0.510 (0.53), 0.948 (0.47), 0.964 (3.30), 0.980 (3.04), 1.050 (0.78), 1.063 (1.59), 1.070 (1.71), 1.076 (1.27), 1.083 (2.96), 1.091 (1.26), 1.097 (1.61), 1.104 (1.48), 1.117 (0.69), 2.523 (1.47), 2.819 (0.48), 3.482 (0.44), 3.498 (0.53), 3.517 (5.65), 3.520 (5.78), 3.535 (6.53), 3.555 (0.62), 3.570 (0.43), 7.330 (6.79), 7.342 (7.01), 7.417 (1.11), 7.423 (9.10), 7.428 (3.61), 7.440 (4.37), 7.445 (16.00), 7.451 (2.53), 7.498 (2.22), 7.504 (15.23), 7.509 (4.34), 7.520 (3.22), 7.525 (8.93), 7.531 (1.21), 7.611 (7.96), 8.632 (13.06), 8.648 (9.08), 8.661 (8.71), 8.754 (1.92), 8.769 (4.04), 8.784 (1.89), 10.661 (3.43).
Example 57
Rac-N-[(2,5-Dioxo-4-Propylimidazolidin-4-Yl)Methyl]-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2392) ##STR00455##
(2393) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (64.3 mg, 241 mol) dissolved in 2 ml of DMF was treated with N,N-diisopropylethylamine (120 l, 670 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (60.0 mg, 313 mol) and 1-hydroxybenzotriazole hydrate (47.9 mg, 313 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-propylimidazolidine-2,4-dione hydrochloride (50.0 mg, 241 mol) 10 was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 85.0 mg (100% purity, 84% yield) of the title compound were obtained.
(2394) LC-MS (Method 7): R.sub.t=1.43 min; MS (ESIpos): m/z=421 [M+H].sup.+
(2395) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.826 (6.82), 0.838 (16.00), 0.850 (7.71), 1.046 (0.40), 1.055 (0.72), 1.067 (1.17), 1.076 (1.07), 1.087 (1.23), 1.099 (0.72), 1.108 (0.48), 1.253 (0.44), 1.261 (0.76), 1.266 (0.58), 1.273 (1.19), 1.282 (0.97), 1.285 (0.97), 1.294 (1.15), 1.302 (0.58), 1.306 (0.66), 1.314 (0.46), 1.448 (0.81), 1.455 (0.91), 1.471 (1.67), 1.478 (1.45), 1.491 (1.45), 1.498 (1.15), 1.524 (1.43), 1.532 (1.57), 1.544 (1.43), 1.547 (1.27), 1.552 (1.45), 1.566 (0.85), 1.575 (0.70), 2.517 (0.42), 2.570 (0.58), 2.605 (0.46), 3.264 (1.05), 3.313 (2.23), 3.326 (3.10), 3.328 (2.15), 3.335 (2.82), 3.396 (2.72), 3.407 (2.82), 3.418 (1.87), 3.429 (1.77), 7.508 (4.13), 7.521 (5.05), 7.528 (1.11), 7.534 (8.43), 7.540 (6.04), 7.543 (5.33), 7.556 (0.80), 7.581 (0.52), 7.588 (2.84), 7.593 (2.46), 7.597 (1.99), 7.600 (2.31), 7.602 (1.95), 7.606 (1.79), 7.610 (1.47), 7.615 (1.25), 7.690 (5.70), 7.918 (4.19), 7.932 (6.16), 7.985 (3.34), 7.988 (3.24), 7.998 (2.15), 8.001 (2.13), 8.564 (1.67), 8.575 (3.18), 8.585 (1.63), 8.738 (5.01), 8.741 (4.89), 10.665 (4.55).
Example 58
Rac-N-{[4-(3-Methylbutyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2396) ##STR00456##
(2397) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (56.5 mg, 212 mol) dissolved in 1.9 ml of DMF was treated with N,N-diisopropylethylamine (100 l, 590 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (52.9 mg, 276 mol) and 1-hydroxybenzotriazole hydrate (42.2 mg, 276 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(3-methylbutyl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 212 mol) was added. The mixture was stirred at room temperature for 2 h. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 47 ml, eluent B 0 to 2 min 23 ml, eluent A 2 to 10 min from 47 ml to 23 ml and eluent B from 23 ml to 47 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 54.0 mg (98% purity, 56% yield) of the title compound were obtained.
(2398) LC-MS (Method 7): R.sub.t=1.86 min; MS (ESIpos): m/z=448 [M+H].sup.+
(2399) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.816 (13.73), 0.827 (15.07), 0.832 (16.00), 0.843 (14.36), 0.876 (0.43), 0.889 (0.67), 0.907 (1.01), 0.921 (1.06), 0.937 (1.21), 0.955 (0.65), 0.968 (0.50), 1.131 (0.57), 1.149 (1.08), 1.165 (1.07), 1.178 (1.04), 1.197 (0.61), 1.209 (0.42), 1.404 (0.80), 1.420 (1.51), 1.437 (1.79), 1.454 (1.40), 1.470 (0.91), 1.498 (1.26), 1.509 (1.19), 1.528 (1.19), 1.541 (1.07), 1.546 (1.21), 1.559 (1.21), 1.577 (1.16), 1.589 (1.11), 1.611 (0.58), 1.623 (0.41), 2.731 (0.97), 2.890 (1.27), 3.331 (2.19), 3.351 (2.50), 3.366 (2.16), 3.397 (2.11), 3.413 (2.21), 3.431 (1.08), 3.448 (1.02), 7.401 (0.69), 7.425 (3.30), 7.444 (4.05), 7.452 (1.02), 7.463 (6.80), 7.471 (5.03), 7.474 (4.93), 7.493 (0.69), 7.501 (0.43), 7.520 (1.20), 7.523 (1.03), 7.529 (2.79), 7.538 (2.95), 7.543 (2.21), 7.548 (2.55), 7.552 (3.12), 7.561 (6.08), 7.570 (1.84), 7.581 (6.07), 7.599 (0.53), 7.603 (0.56), 7.618 (0.66), 7.622 (0.70), 7.668 (5.28), 7.743 (6.30), 7.764 (5.25), 7.774 (1.48), 7.806 (0.60), 7.823 (0.52), 8.537 (1.28), 8.553 (2.62), 8.568 (1.26), 10.674 (2.63).
Example 59
Rac-N-{[4-(4-Methyl-1,2-Oxazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2400) ##STR00457##
(2401) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (103 mg, 385 mol) dissolved in 1.5 ml of DMF was treated with N,N-diisopropylethylamine (200 l, 1.2 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (96.0 mg, 501 mol) and 1-hydroxybenzotriazole hydrate (76.7 mg, 501 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(4-methyl-1,2-oxazol-5-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 241 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 76.0 mg (100% purity, 43% yield) of the title compound were obtained.
(2402) LC-MS (Method 7): R.sub.t=1.61 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2403) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.004 (16.00), 3.967 (2.77), 3.983 (3.00), 7.413 (1.09), 7.416 (1.21), 7.432 (2.25), 7.435 (2.29), 7.442 (1.75), 7.462 (2.74), 7.482 (1.92), 7.500 (0.94), 7.533 (2.94), 7.545 (1.84), 7.553 (3.58), 7.563 (1.85), 7.567 (1.67), 7.582 (0.63), 7.585 (0.60), 7.754 (3.53), 7.775 (2.94), 8.492 (5.06), 8.583 (2.66), 8.787 (0.77), 8.802 (1.63), 8.818 (0.76), 11.264 (2.16).
Example 60
Rac-N-{[4-(1,3-Dimethyl-1H-Pyrazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2404) ##STR00458##
(2405) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (103 mg, 385 mol) dissolved in 1.5 ml of DMF was treated with N,N-diisopropylethylamine (200 l, 1.2 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (96.0 mg, 501 mol) and 1-hydroxybenzotriazole hydrate (76.7 mg, 501 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(1,3-dimethyl-1H-pyrazol-4-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 385 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 93.0 mg (100% purity, 51% yield) of the title compound were obtained.
(2406) LC-MS (Method 7): R.sub.t=1.49 min; MS (ESIpos): m/z=472 [M+H].sup.+
(2407) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.52), 2.111 (15.81), 2.514 (0.63), 2.518 (0.63), 2.521 (0.56), 2.572 (0.63), 3.272 (1.04), 3.277 (0.74), 3.290 (0.89), 3.319 (1.70), 3.326 (0.85), 3.330 (0.85), 3.339 (3.07), 3.702 (16.00), 3.761 (2.22), 3.764 (2.15), 3.771 (2.00), 3.775 (2.07), 7.410 (1.26), 7.412 (1.37), 7.423 (2.15), 7.425 (2.11), 7.430 (1.78), 7.443 (2.07), 7.458 (1.07), 7.460 (1.07), 7.470 (1.96), 7.472 (1.74), 7.483 (0.96), 7.485 (0.85), 7.523 (2.96), 7.537 (4.30), 7.550 (1.85), 7.552 (1.78), 7.563 (0.78), 7.565 (0.74), 7.679 (5.30), 7.741 (3.37), 7.755 (3.00), 8.046 (2.81), 8.592 (0.81), 8.602 (1.67), 8.612 (0.78), 10.867 (2.04).
Example 61
Rac-N-{[4-(1,4-Dimethyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2408) ##STR00459##
(2409) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (97.0 mg, 364 mol) dissolved in 1.5 ml of DMF was treated with N,N-diisopropylethylamine (190 l, 1.1 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (90.8 mg, 474 mol) and 1-hydroxybenzotriazole hydrate (72.5 mg, 474 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(1,4-dimethyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (110 mg, 86% purity, 364 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 21.0 mg (100% purity, 12% yield) of the title compound were obtained.
(2410) LC-MS (Method 7): R.sub.t=1.58 min; MS (ESIpos): m/z=472 [M+H].sup.+
(2411) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.71), 0.008 (0.76), 2.102 (13.54), 2.327 (0.50), 2.669 (0.53), 3.850 (16.00), 3.960 (0.65), 3.974 (0.74), 3.994 (1.20), 4.008 (1.09), 4.065 (1.09), 4.082 (1.18), 4.098 (0.70), 4.115 (0.65), 7.205 (4.78), 7.421 (1.07), 7.425 (1.23), 7.438 (2.75), 7.443 (2.25), 7.455 (2.17), 7.468 (1.15), 7.471 (1.12), 7.487 (2.17), 7.490 (2.45), 7.495 (3.19), 7.505 (1.36), 7.515 (3.35), 7.548 (1.33), 7.551 (1.33), 7.567 (1.67), 7.570 (1.54), 7.585 (0.62), 7.589 (0.65), 7.754 (3.45), 7.775 (2.96), 8.369 (3.01), 8.713 (0.73), 8.729 (1.39), 8.744 (0.71), 11.198 (1.64).
Example 62
Rac-N-{[4-(4-Methyl-1,2,5-Thiadiazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2412) ##STR00460##
(2413) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (101 mg, 379 mol) dissolved in 1.5 ml of DMF was treated with N,N-diisopropylethylamine (200 l, 1.1 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (94.5 mg, 493 mol) and 1-hydroxybenzotriazole hydrate (75.5 mg, 493 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(4-methyl-1,2,5-thiadiazol-3-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 379 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 35.0 mg (100% purity, 19% yield) of the title compound were obtained.
(2414) LC-MS (Method 7): R.sub.t=1.71 min; MS (ESIpos): m/z=476 [M+H].sup.+
(2415) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.479 (16.00), 3.274 (0.56), 4.127 (3.06), 4.138 (3.08), 7.441 (1.04), 7.444 (1.96), 7.454 (2.04), 7.456 (2.89), 7.472 (1.11), 7.474 (1.02), 7.484 (1.68), 7.486 (1.42), 7.497 (0.73), 7.499 (0.65), 7.551 (1.24), 7.553 (1.50), 7.558 (2.63), 7.563 (1.90), 7.566 (1.85), 7.571 (2.89), 7.575 (1.03), 7.578 (0.76), 7.761 (2.92), 7.775 (2.58), 8.372 (0.95), 8.761 (0.67), 8.772 (1.43), 8.783 (0.68).
Example 63
Rac-N-{[4-(3-Methyl-1,2-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2416) ##STR00461##
(2417) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (101 mg, 381 mol) dissolved in 2 ml of DMF was treated with N,N-diisopropylethylamine (200 l, 1.1 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (94.9 mg, 495 mol) and 1-hydroxybenzotriazole hydrate (75.8 mg, 495 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(3-methyl-1,2-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (110 mg, 86% purity, 364 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min; room temperature; UV 200-400 nm; At-Column Injektion; Gradient: eluent A0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 86.0 mg (100% purity, 48% yield) of the title compound were obtained.
(2418) LC-MS (Method 7): R.sub.t=1.62 min; MS (ESIpos): m/z=475 [M+H].sup.+
(2419) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.418 (16.00), 2.522 (0.86), 3.887 (0.61), 3.902 (0.69), 3.921 (1.50), 3.936 (1.35), 3.959 (1.37), 3.976 (1.43), 3.993 (0.64), 4.010 (0.61), 7.422 (1.23), 7.425 (1.43), 7.435 (1.99), 7.440 (2.56), 7.444 (2.60), 7.453 (2.56), 7.466 (1.24), 7.468 (1.31), 7.484 (2.08), 7.487 (1.89), 7.502 (1.07), 7.506 (0.99), 7.524 (3.28), 7.544 (5.16), 7.563 (1.86), 7.566 (1.77), 7.582 (0.69), 7.585 (0.72), 7.740 (3.92), 7.761 (3.24), 8.272 (2.80), 8.275 (2.84), 8.747 (0.84), 8.763 (1.67), 8.778 (0.83), 9.099 (5.63), 11.170 (2.49).
Example 64
Ent-N-{[4-(3-Methyl-1,2-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2420) ##STR00462##
(2421) Enantiomeric separation of rac-N-{[4-(3-methyl-1,2-thiazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-2-[6-(trifluoromethyl)pyridin-3-yl]benzamide (63.0 mg, 133 mol) was done using the following method: Column: Diacel Chiralpak IG 5 m 25020 mm Solvent: 70% n-heptane: 30% ethanol Flow: 20 ml/min Oven temperature: 50 C. UV: 220 nm
(2422) Product containing samples were united, the solvents were evaporated and the residue was dried in vacuo.
(2423) 28.0 mg (100% purity, 44% yield)
(2424) LC-MS (Method 7): R.sub.t=1.37 min; MS (ESIpos): m/z=476 [M+H].sup.+
(2425) Chiral HPLC (Column: Diacel Chiralpak IG 5 m 2504.6 mm; solvent: 70% n-heptane: 30% ethanol; flow: 1 ml/min; temperature: 50 C.): R.sub.t=9.468 min, 100.0% ee
(2426) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.410 (16.00), 2.423 (0.41), 3.170 (0.41), 3.273 (0.84), 3.335 (1.28), 3.342 (0.58), 3.900 (0.71), 3.911 (0.78), 3.923 (1.63), 3.933 (1.48), 3.953 (1.53), 3.964 (1.58), 3.976 (0.74), 3.987 (0.70), 7.489 (1.63), 7.501 (2.46), 7.519 (1.94), 7.532 (2.56), 7.541 (1.23), 7.554 (2.18), 7.566 (1.11), 7.605 (1.46), 7.618 (1.99), 7.630 (0.79), 7.905 (1.89), 7.918 (3.49), 7.947 (1.94), 7.950 (1.89), 7.960 (1.04), 8.264 (3.05), 8.730 (2.77), 8.803 (0.94), 8.813 (1.83), 8.824 (0.94), 9.108 (5.51), 11.156 (2.68).
Example 65
Ent-N-{[4-(3-Methyl-1,2-Oxazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2427) ##STR00463##
(2428) Enantiomeric separation of rac-N-{[4-(3-methyl-1,2-oxazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-2-[6-(trifluoromethyl)pyridin-3-yl]benzamide (170 mg, 370 mol) was done using the following method: Column: Diacel Chiralpak IG 5 m 25020 mm Solvent: 60% n-heptane: 40% ethanol Flow: 20 ml/min Oven temperature: 50 C. UV: 220 nm
(2429) Product containing samples were united, the solvents were evaporated and the residue was dried in vacuo.
(2430) 73.0 mg (100% purity, 43% yield)
(2431) LC-MS (Method 7): R.sub.t=1.35 min; MS (ESIpos): m/z=460 [M+H].sup.+
(2432) Chiral HPLC (Column: Diacel Chiralpak IG 3 m 504.6 mm; solvent: 60% iso-hexane: 40% ethanol): R.sub.t=2.539 min, 100.0% ee
(2433) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.32), 0.008 (2.61), 1.038 (0.81), 1.056 (1.67), 1.073 (0.85), 2.225 (16.00), 3.764 (0.54), 3.778 (0.62), 3.798 (1.57), 3.813 (1.47), 3.825 (1.50), 3.842 (1.52), 3.860 (0.57), 3.877 (0.53), 7.477 (1.29), 7.480 (1.40), 7.496 (2.29), 7.499 (2.21), 7.516 (1.48), 7.518 (1.62), 7.537 (3.23), 7.555 (2.35), 7.558 (1.79), 7.573 (1.27), 7.577 (0.95), 7.598 (1.67), 7.602 (1.66), 7.617 (1.87), 7.621 (1.81), 7.636 (0.68), 7.639 (0.61), 7.894 (1.07), 7.912 (3.87), 7.914 (3.85), 7.924 (2.48), 7.929 (2.31), 7.945 (0.63), 7.949 (0.65), 8.294 (2.77), 8.297 (2.75), 8.728 (2.55), 8.825 (0.83), 8.841 (1.65), 8.856 (0.81), 8.971 (5.39), 11.158 (2.39).
Example 66
Ent-N-{[4-(1-Cyclopropyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2434) ##STR00464##
(2435) Enantiomeric separation of rac-N-{[4-(1-cyclopropyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-2-[6-(trifluoromethyl)pyridin-3-yl]benzamide (58.0 mg, 120 mol) was done using the following method: Column: Diacel Chiralpak OH-H 5 m 25020 mm Solvent: 60% n-heptane: 40% ethanol Flow: 20 ml/min Oven temperature: 40 C. UV: 210 nm
(2436) Product containing samples were united, the solvents were evaporated and the residue was lyophilized.
(2437) 16.0 mg (100% purity, 28% yield)
(2438) LC-MS (Method 7): R.sub.t=1.36 min; MS (ESIpos): m/z=485 [M+H].sup.+
(2439) Chiral HPLC (Column: Diacel OX-3 3 m 504.6 mm; solvent: 50% n-heptane: 50% ethanol): R.sub.t=1.716 min, 100.0% ee
(2440) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (1.31), 0.008 (10.95), 0.008 (11.61), 0.146 (1.38), 0.826 (2.36), 0.844 (3.67), 0.853 (4.00), 0.868 (4.07), 0.880 (3.02), 0.885 (2.82), 0.892 (2.62), 0.897 (1.84), 0.904 (3.21), 0.909 (4.39), 0.921 (3.48), 0.926 (2.75), 0.942 (2.75), 0.954 (2.62), 0.960 (3.61), 0.972 (4.07), 0.978 (3.15), 0.983 (2.03), 0.990 (2.10), 0.996 (2.30), 1.015 (1.05), 1.117 (1.77), 1.133 (3.15), 1.151 (1.64), 1.235 (4.00), 1.249 (2.49), 1.260 (3.15), 1.275 (3.74), 1.287 (3.54), 1.314 (1.31), 2.327 (2.62), 2.332 (1.97), 2.366 (1.77), 2.523 (11.67), 2.665 (2.23), 2.670 (2.95), 2.674 (2.23), 2.710 (2.03), 2.859 (1.05), 2.878 (0.98), 3.429 (1.57), 3.438 (3.02), 3.447 (3.93), 3.456 (5.38), 3.465 (4.13), 3.474 (2.89), 3.484 (1.51), 3.880 (2.36), 3.895 (2.69), 3.914 (5.25), 3.929 (4.66), 3.958 (4.72), 3.975 (5.05), 3.992 (2.49), 4.009 (2.36), 6.533 (13.38), 6.538 (13.70), 7.342 (13.05), 7.346 (13.18), 7.511 (4.00), 7.525 (16.00), 7.544 (13.57), 7.559 (8.07), 7.577 (3.67), 7.603 (5.64), 7.607 (5.51), 7.622 (6.36), 7.626 (5.84), 7.640 (2.30), 7.644 (2.23), 7.919 (6.23), 7.939 (12.26), 7.976 (6.69), 7.981 (6.62), 7.996 (3.41), 8.001 (3.41), 8.348 (14.23), 8.741 (8.46), 8.745 (8.66), 8.852 (2.95), 8.868 (6.10), 8.884 (3.02).
Example 67
Rac-N-{[4-(3-Methyl-1,2-Oxazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2441) ##STR00465##
(2442) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (108 mg, 405 mol) dissolved in 2.5 ml DMF was treated with N,N-diisopropylethylamine (210 l, 1.2 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 527 mol) and 1-hydroxybenzotriazole hydrate (80.7 mg, 527 mol) and stirred for 5 min at room temperature before rac-5-(aminomethyl)-5-(3-methyl-1,2-oxazol-4-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 405 mol) was added. The mixture was stirred at room temperature over night. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m 25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 86.0 mg (100% purity, 46% yield) of the title compound were obtained.
(2443) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2444) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.96), 0.008 (2.17), 2.234 (16.00), 2.524 (1.08), 2.558 (0.47), 3.758 (0.68), 3.773 (0.78), 3.792 (1.46), 3.807 (1.32), 3.841 (1.34), 3.858 (1.44), 3.875 (0.71), 3.892 (0.68), 7.017 (1.77), 7.144 (1.84), 7.271 (1.77), 7.421 (1.23), 7.425 (1.48), 7.433 (1.86), 7.440 (2.52), 7.444 (2.59), 7.448 (2.38), 7.451 (2.50), 7.466 (1.25), 7.469 (1.27), 7.484 (2.17), 7.488 (1.86), 7.508 (3.42), 7.529 (3.70), 7.544 (1.60), 7.548 (1.53), 7.562 (1.91), 7.566 (1.77), 7.581 (0.73), 7.585 (0.73), 7.731 (3.82), 7.751 (3.16), 8.292 (2.97), 8.758 (0.80), 8.774 (1.56), 8.789 (0.82), 8.961 (5.28), 11.159 (1.91).
Example 68
Ent-N-{[4-(3-Methyl-1,2-Oxazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2445) ##STR00466##
(2446) Enantiomeric separation of rac-N-{[4-(3-methyl-1,2-oxazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (85.0 mg, 185 mol) was done using the following method: Column: Daicel Chiralcel OZ-H 5 m 25020 mm Solvent: 80% n-heptane: 20% iso-propanol Flow: 20 ml/min Oven temperature: 50 C. UV: 220 nm
(2447) Further purification by preparative HPLC (Column: Chromatorex C18 10 m25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min) was needed. Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 24.0 mg (100% purity, 28% yield) of the title compound were obtained.
(2448) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2449) Chiral HPLC (Column: Chiraltek OZ-3 3 m, 220 nm, solvent: 50% iso-hexane: 50% iso-propanol): R.sub.t=2.938 min, 99.56% ee
(2450) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.236 (16.00), 2.514 (0.42), 3.279 (0.60), 3.346 (0.99), 3.349 (0.81), 3.768 (0.83), 3.777 (0.91), 3.790 (1.45), 3.800 (1.32), 3.846 (1.30), 3.858 (1.39), 3.868 (0.86), 3.880 (0.81), 7.426 (1.31), 7.428 (1.50), 7.433 (1.85), 7.438 (2.23), 7.441 (2.29), 7.445 (2.25), 7.471 (1.14), 7.472 (1.14), 7.483 (1.93), 7.485 (1.83), 7.496 (0.93), 7.498 (0.86), 7.514 (3.05), 7.527 (3.35), 7.548 (1.28), 7.550 (1.25), 7.561 (1.87), 7.563 (1.75), 7.574 (0.75), 7.575 (0.76), 7.731 (3.46), 7.745 (3.10), 8.255 (2.51), 8.257 (2.53), 8.726 (0.81), 8.737 (1.44), 8.747 (0.81), 8.947 (5.13), 11.139 (2.10).
Example 69
Ent-N-{[4-(4-Methyl-1,2-Oxazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2451) ##STR00467##
(2452) Enantiomeric separation of rac-N-{[4-(4-methyl-1,2-oxazol-3-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (73.0 mg, 159 mol) was done using the following method: Column: Daicel Chiralpak ID 5 m 25020 mm Solvent: 50% n-heptane: 50% iso-propanol Flow: 20 ml/min Oven temperature: 40 C. UV: 210 nm
(2453) Further purification by preparative HPLC (Column: Chromatorex C18 10 m25030 mm; eluent A=water+0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B; 4.5 min 50% B; 11.5 min 70% B; 12 min 100% B; 14.75 min 30% B; flow: 50 ml/min) was needed. Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 15.0 mg (100% purity, 21% yield) of the title compound were obtained.
(2454) LC-MS (Method 7): R.sub.t=1.68 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2455) Chiral HPLC (Column: Daicel Chiralpak ID-3 3 m, 504.6 mm, 1 ml/min, 220 nm, solvent: 50% n-heptane: 50% iso-propanol): R.sub.t=3.572 min, 100% ee
(2456) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.927 (15.18), 1.929 (16.00), 2.514 (0.60), 2.517 (0.56), 2.520 (0.50), 3.269 (0.72), 3.328 (0.54), 3.335 (0.66), 3.994 (4.99), 4.005 (5.01), 7.427 (1.61), 7.430 (1.81), 7.441 (4.93), 7.442 (5.40), 7.455 (2.95), 7.465 (1.65), 7.467 (1.55), 7.478 (2.74), 7.480 (2.47), 7.490 (1.24), 7.492 (1.11), 7.546 (1.84), 7.549 (2.04), 7.554 (4.27), 7.559 (3.55), 7.561 (2.93), 7.568 (4.66), 7.758 (4.74), 7.772 (4.17), 8.420 (3.73), 8.716 (1.07), 8.727 (2.29), 8.736 (5.05), 8.737 (5.44), 11.256 (1.03).
Example 70
Ent-N-{[4-(1,4-Dimethyl-1H-Pyrazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2457) ##STR00468##
(2458) Enantiomeric separation of rac-N-{[4-(1,4-dimethyl-1H-pyrazol-3-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (116 mg, 246 mol) was done using the following method: Column: Maisch Diacel OJ-H 25025 mm Solvent: 85% CO.sub.2: 15% methanol Flow: 80 ml/min Oven temperature: 40 C. UV: 210 nm
(2459) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 44.0 mg (100% purity, 38% yield) of the title compound were obtained.
(2460) LC-MS (Method 7): R.sub.t=1.62 min; MS (ESIpos): m/z=472 [M+H].sup.+
(2461) Chiral HPLC (Column: OJ-3, 3 ml/min, 210 nm, solvent: 90% CO.sub.2: 10% methanol): R.sub.t=0.968 min, 100% ee
(2462) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.887 (4.74), 3.292 (16.00), 3.294 (11.32), 3.296 (10.91), 3.942 (0.53), 3.953 (0.50), 3.980 (0.51), 3.990 (0.56), 7.411 (0.45), 7.413 (0.48), 7.423 (0.77), 7.425 (0.76), 7.436 (0.64), 7.449 (0.83), 7.452 (0.54), 7.454 (0.52), 7.459 (1.46), 7.465 (0.81), 7.467 (0.66), 7.533 (0.47), 7.535 (0.46), 7.545 (0.67), 7.547 (0.64), 7.573 (1.08), 7.586 (1.19), 7.761 (1.26), 7.774 (1.09), 8.084 (1.16), 8.486 (0.60), 10.890 (0.77).
Example 71
Ent-N-[(4-Tert-Butyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2463) ##STR00469##
(2464) Enantiomeric separation of rac-N-[(4-tert-butyl-2,5-dioxoimidazolidin-4-yl)methyl]-4-(trifluoromethyl)[biphenyl]-2-carboxamide (53.0 mg, 122 mol) was done using the following method: Column: Daicel Chiralpak IE 5 m 25020 mm Solvent: 60% n-heptane: 40% iso-propanol Flow: 20 ml/min Oven temperature: 40 C. UV: 210 nm
(2465) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 17.5 mg (100% purity, 33% yield) of the title compound were obtained.
(2466) LC-MS (Method 7): R.sub.t=1.77 min; MS (ESIpos): m/z=434 [M+H].sup.+
(2467) Chiral HPLC (Chiraltek IE-3 3 m, 220 nm, 50% iso-hexane: 50% iso-propanol): R.sub.t=2.492 min, 100% ee
(2468) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.44), 0.982 (16.00), 3.327 (0.78), 3.533 (0.58), 3.544 (0.56), 3.587 (0.57), 3.598 (0.62), 7.370 (0.69), 7.382 (0.92), 7.421 (0.79), 7.434 (0.98), 7.442 (0.48), 7.455 (0.91), 7.457 (0.84), 7.468 (0.48), 7.527 (0.63), 7.529 (0.70), 7.535 (1.69), 7.539 (1.18), 7.542 (1.19), 7.546 (1.52), 7.560 (1.59), 7.757 (1.59), 7.771 (1.42), 8.447 (0.73).
Example 72
Ent-N-{[4-(1,4-Dimethyl-1H-Pyrazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2469) ##STR00470##
(2470) Enantiomeric separation of rac-N-{[4-(1,4-dimethyl-1H-pyrazol-3-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-2-[6-(trifluoromethyl)pyridin-3-yl]benzamide (191 mg, 404 mol) was done using the following method: Column: Daicel Chiralpak IG 5 m 25020 mm Solvent: 70% n-heptane: 30% ethanol Flow: 20 ml/min Oven temperature: 50 C. UV: 210 nm
(2471) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 88.0 mg (100% purity, 46% yield) of the title compound were obtained.
(2472) LC-MS (Method 7): R.sub.t=1.35 min; MS (ESIpos): m/z=473 [M+H].sup.+
(2473) Chiral HPLC (Daicel IG-3 3 m, 220 nm, 1 ml/min, 70% n-heptane: 30% ethanol): R.sub.t=4.645 min, 100% ee
(2474) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.886 (12.59), 2.067 (1.67), 3.743 (16.00), 3.948 (0.41), 3.961 (1.59), 3.972 (2.91), 3.982 (1.74), 3.995 (0.49), 4.005 (0.44), 7.457 (3.73), 7.475 (1.25), 7.477 (1.12), 7.488 (2.10), 7.524 (2.35), 7.537 (3.65), 7.550 (1.06), 7.551 (0.75), 7.587 (1.31), 7.590 (1.25), 7.600 (1.40), 7.602 (1.64), 7.612 (0.66), 7.615 (0.61), 7.933 (1.76), 7.947 (2.80), 7.989 (1.49), 7.993 (1.47), 8.003 (0.92), 8.006 (0.92), 8.109 (2.43), 8.111 (2.41), 8.562 (0.79), 8.573 (1.66), 8.583 (0.79), 8.746 (2.20), 8.750 (2.20), 10.904 (2.08).
Example 73
Ent-N-{[4-(4-Methyl-1,2,5-Oxadiazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2475) ##STR00471##
(2476) Enantiomeric separation of rac-N-{[4-(4-methyl-1,2,5-oxadiazol-3-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (36.0 mg, 78.4 mol) was done using the following method: Column: Daicel Chiralpak ID 5 m 25020 mm Solvent: 50% n-heptane: 50% iso-propanol Flow: 20 ml/min Oven temperature: 40 C. UV: 210 nm
(2477) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 11.0 mg (100% purity, 31% yield) of the title compound were obtained.
(2478) LC-MS (Method 7): R.sub.t=1.73 min; MS (ESIpos): m/z=460 [M+H].sup.+
(2479) Chiral HPLC (Daicel Chiralpak ID-3 3 m, 504.6 mm, 220 nm, 1 ml/min, 220 nm, 50% n-heptane: 50% iso-propanol): R.sub.t=4.645 min, 100% ee
(2480) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.362 (16.00), 2.385 (0.43), 2.423 (0.43), 2.572 (1.30), 2.574 (1.30), 2.612 (0.48), 2.652 (0.43), 3.278 (2.21), 3.343 (7.11), 4.000 (0.48), 4.013 (1.83), 4.023 (3.12), 4.034 (1.78), 4.046 (0.48), 4.057 (0.43), 7.442 (2.83), 7.456 (4.28), 7.478 (1.20), 7.490 (1.97), 7.503 (0.82), 7.526 (3.12), 7.540 (3.46), 7.558 (1.20), 7.569 (1.73), 7.583 (0.77), 7.748 (3.51), 7.761 (3.12), 8.517 (1.92), 8.838 (0.82), 8.848 (1.59), 8.858 (0.82).
Example 74
Ent-N-{[4-(2,4-Dimethyl-1,3-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2481) ##STR00472##
(2482) Enantiomeric separation of rac-N-{[4-(2,4-dimethyl-1,3-thiazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-2-[6-(trifluoromethyl)pyridin-3-yl]benzamide (103 mg, 210 mol) was done using the following method: Column: Daicel Chiralpak IG 5 m 25020 mm Solvent: 60% n-heptane: 40% ethanol Flow: 20 ml/min Oven temperature: 50 C. UV: 220 nm
(2483) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 51.0 mg (100% purity, 50% yield) of the title compound were obtained.
(2484) LC-MS (Method 7): R.sub.t=1.39 min; MS (ESIpos): m/z=490 [M+H].sup.+
(2485) Chiral HPLC (Daicel Chiralpak IG 5 m, 2504.6 mm, 1 ml/min, 50 C., 60% n-heptane: 40% ethanol): R.sub.t=8.602 min, 100% ee
(2486) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (3.11), 0.008 (3.45), 2.328 (0.90), 2.343 (16.00), 2.366 (0.62), 2.523 (2.72), 2.665 (0.50), 2.670 (0.73), 2.674 (0.50), 2.710 (0.60), 3.827 (2.69), 3.843 (2.60), 7.472 (1.16), 7.475 (1.24), 7.491 (1.94), 7.521 (1.38), 7.537 (2.54), 7.540 (3.04), 7.555 (1.99), 7.559 (1.53), 7.574 (1.09), 7.577 (0.85), 7.599 (1.43), 7.603 (1.40), 7.618 (1.56), 7.621 (1.56), 7.637 (0.59), 7.640 (0.52), 7.908 (2.51), 7.914 (5.53), 7.916 (4.23), 7.934 (0.49), 8.496 (2.41), 8.722 (2.46), 8.787 (0.70), 8.803 (1.56), 8.818 (0.73), 11.154 (2.15).
Example 75
4-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2487) ##STR00473##
(2488) 4-chloro-2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (47.0 mg, 156 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (76 l, 440 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (38.8 mg, 203 mol), 1H-benzotriazol-1-ol hydrate (31.0 mg, 203 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrogen chloride (32.0 mg, 156 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 53.0 mg (100% purity, 75% yield) of the title compound were obtained.
(2489) LC-MS (Method 7): R.sub.t=1.55 min; MS (ESIpos): m/z=453 [M+H].sup.+
(2490) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.102 (0.57), 0.115 (1.27), 0.126 (2.35), 0.139 (2.48), 0.150 (1.78), 0.163 (0.83), 0.288 (0.44), 0.311 (1.46), 0.323 (1.84), 0.334 (1.71), 0.345 (1.40), 0.356 (1.08), 0.365 (0.95), 0.375 (1.52), 0.390 (1.65), 0.398 (2.16), 0.411 (1.71), 0.419 (1.02), 0.428 (1.08), 0.442 (1.90), 0.453 (2.35), 0.466 (2.22), 0.478 (1.40), 0.491 (0.51), 1.044 (0.76), 1.058 (1.52), 1.065 (1.65), 1.078 (2.92), 1.091 (1.52), 1.099 (1.40), 1.112 (0.63), 2.328 (0.51), 2.366 (0.38), 2.670 (0.57), 2.710 (0.38), 3.446 (1.02), 3.461 (1.21), 3.480 (4.00), 3.497 (6.10), 3.514 (3.94), 3.532 (1.14), 3.548 (1.14), 7.508 (6.79), 7.514 (1.65), 7.523 (2.16), 7.529 (9.14), 7.577 (8.95), 7.632 (4.38), 7.638 (7.68), 7.648 (9.02), 7.654 (16.00), 7.938 (3.05), 7.956 (8.83), 7.975 (5.21), 7.980 (4.95), 7.995 (1.71), 8.000 (1.78), 8.677 (1.90), 8.693 (4.00), 8.708 (1.90), 8.759 (6.03), 8.764 (5.78), 10.651 (4.13).
Example 76
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-3,4-Difluoro-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2491) ##STR00474##
(2492) 3,4-difluoro-2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (21.0 mg, 69.3 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (34 l, 190 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (17.3 mg, 90.0 mol), 1H-benzotriazol-1-ol hydrate (13.8 mg, 90.0 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrogen chloride (14.2 mg, 69.3 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 18.0 mg (100% purity, 57% yield) of the title compound were obtained.
(2493) LC-MS (Method 8): R.sub.t=0.79 min; MS (ESIpos): m/z=455 [M+H].sup.+
(2494) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.107 (0.72), 0.116 (1.51), 0.123 (2.69), 0.132 (2.77), 0.139 (1.89), 0.149 (0.91), 0.287 (0.62), 0.294 (0.90), 0.296 (0.93), 0.302 (1.66), 0.309 (2.09), 0.317 (1.82), 0.323 (1.31), 0.325 (1.44), 0.332 (1.07), 0.356 (0.94), 0.364 (1.63), 0.371 (1.65), 0.373 (1.70), 0.379 (2.39), 0.388 (1.87), 0.393 (1.08), 0.402 (0.72), 0.419 (0.97), 0.428 (2.03), 0.436 (2.67), 0.444 (2.53), 0.452 (1.67), 0.461 (0.61), 1.030 (0.93), 1.038 (1.84), 1.043 (1.95), 1.047 (1.27), 1.052 (3.45), 1.057 (1.27), 1.061 (1.78), 1.066 (1.69), 1.074 (0.75), 2.516 (0.47), 2.519 (0.46), 3.267 (0.62), 3.414 (1.48), 3.424 (1.70), 3.436 (4.80), 3.447 (4.55), 3.452 (4.70), 3.463 (4.69), 3.475 (1.56), 3.486 (1.48), 7.390 (1.97), 7.397 (2.12), 7.404 (2.35), 7.411 (2.28), 7.542 (10.01), 7.664 (1.23), 7.678 (2.31), 7.694 (2.41), 7.708 (1.26), 7.993 (1.10), 7.995 (1.44), 8.007 (11.73), 8.009 (16.00), 8.013 (7.39), 8.023 (0.85), 8.026 (0.98), 8.638 (2.14), 8.649 (4.36), 8.659 (2.16), 8.747 (6.38), 10.571 (0.49).
Example 77
Rac-N-{[4-(4-Methyl-1,2-Oxazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2495) ##STR00475##
(2496) 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (103 mg, 385 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (200 l, 1.2 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (96.0 mg, 501 mol), 1H-benzotriazol-1-ol hydrate (76.7 mg, 501 mol) and rac-5-(aminomethyl)-5-(4-methyl-1,2-oxazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 95% purity, 385 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 72.0 mg (100% purity, 41% yield) of the title compound were obtained.
(2497) LC-MS (Method 7): R.sub.t=1.37 min; MS (ESIpos): m/z=460 [M+H].sup.+
(2498) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.43), 1.999 (16.00), 2.073 (5.01), 3.959 (3.05), 3.974 (3.12), 7.475 (1.13), 7.478 (1.17), 7.494 (2.05), 7.526 (1.44), 7.533 (1.03), 7.537 (1.16), 7.544 (2.46), 7.552 (2.18), 7.571 (1.06), 7.599 (1.36), 7.603 (1.41), 7.618 (1.45), 7.621 (1.53), 7.636 (0.54), 7.640 (0.52), 7.914 (0.59), 7.934 (4.37), 7.942 (2.50), 7.962 (0.41), 8.484 (5.20), 8.594 (3.18), 8.726 (2.43), 8.841 (0.74), 8.856 (1.60), 8.872 (0.74), 11.262 (1.49).
Example 78
Ent-N-{[4-(4-Methyl-1,2-Oxazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2499) ##STR00476##
(2500) Enantiomeric separation of rac-N-{[4-(4-methyl-1,2-oxazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-2-[6-(trifluoromethyl)pyridin-3-yl]benzamide (62.0 mg, 135 mol) was done using the following method: Column: Daicel Chiralpak IE 5 m 25020 mm Solvent: 70% n-heptane: 30% ethanol Flow: 20 ml/min Oven temperature: 50 C. UV: 220 nm
(2501) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 23.0 mg (100% purity, 37% yield) of the title compound were obtained.
(2502) LC-MS (Method 7): R.sub.t=1.37 min; MS (ESIpos): m/z=460 [M+H].sup.+
(2503) Chiral HPLC (Column: Daicel IE-3 3 m, 504.6 mm, 220 nm, solvent: 70% n-heptane: 30% ethanol): R.sub.t=2.825 min, 97.78% ee
(2504) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.000 (16.00), 2.514 (0.41), 3.960 (3.25), 3.970 (3.24), 7.479 (1.20), 7.481 (1.25), 7.491 (1.81), 7.493 (1.74), 7.525 (1.45), 7.538 (2.88), 7.550 (1.87), 7.552 (1.53), 7.563 (0.95), 7.565 (0.78), 7.602 (1.21), 7.605 (1.21), 7.615 (1.65), 7.617 (1.61), 7.627 (0.64), 7.629 (0.60), 7.915 (1.04), 7.928 (2.99), 7.939 (1.81), 7.942 (1.71), 7.953 (0.57), 7.956 (0.61), 8.475 (5.18), 8.567 (2.24), 8.569 (2.23), 8.722 (2.02), 8.725 (1.98), 8.816 (0.73), 8.826 (1.52), 8.837 (0.72), 11.242 (1.86).
Example 79
Ent-5-Chloro-N-{[4-(1,5-Dimethyl-1H-Pyrazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2505) ##STR00477##
(2506) Enantiomeric separation of rac-5-chloro-N-{[4-(1,5-dimethyl-1H-pyrazol-4-yl)-2,5-dioxoimidazolidine-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (123 mg, 243 mol) was done using the following method: Column: Daicel Chiralpak IE 5 m 25020 mm Solvent: 70% n-heptane: 30% ethanol Flow: 20 ml/min Oven temperature: 50 C. UV: 220 nm
(2507) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 53.0 mg (100% purity, 43% yield) of the title compound were obtained.
(2508) LC-MS (Method 7): R.sub.t=1.66 min; MS (ESIpos): m/z=506 [M+H].sup.+
(2509) Chiral HPLC (Column: Daicel IE-3 3 m, 504.6 mm, 220 nm, solvent: 70% n-heptane: 30% ethanol): R.sub.t=3.474 min, 97.08% ee
(2510) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.248 (15.56), 2.422 (0.45), 2.464 (0.65), 2.514 (1.01), 2.517 (0.87), 2.520 (0.78), 2.570 (0.45), 2.651 (0.44), 3.262 (1.02), 3.699 (16.00), 3.728 (0.45), 3.739 (0.47), 3.751 (1.54), 3.762 (2.79), 3.772 (1.66), 3.786 (0.46), 7.367 (5.40), 7.411 (2.84), 7.424 (3.34), 7.513 (3.10), 7.516 (3.56), 7.558 (4.31), 7.560 (3.50), 7.571 (4.31), 7.755 (3.25), 7.769 (2.89), 8.164 (2.42), 8.167 (2.37), 8.675 (0.76), 8.685 (1.54), 8.696 (0.76), 10.863 (2.08).
Example 80
Ent-N-{[4-(1-Ethyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2511) ##STR00478##
(2512) Enantiomeric separation of rac-5 N-{[4-(1-ethyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (500 mg, 1.06 mmol) was done using the following method: Column: Daicel Chiralpak IC 5 m 25020 mm Solvent: 80% CO.sub.2: 20% methanol Flow: 140 ml/min Backpressure: 100 bar Oven temperature: 40 C. UV: 210 nm
(2513) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 95.0 mg (100% purity, 19% yield) of the title compound were obtained.
(2514) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=472 [M+H].sup.+
(2515) Chiral HPLC (Column: IC, 2504.6 mm, 210 nm, solvent: 70% CO.sub.2: 30% methanol): R.sub.t=2.903 min, 98.3% ee
(2516) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.294 (7.38), 1.306 (16.00), 1.318 (7.30), 2.517 (0.54), 2.520 (0.44), 3.865 (1.17), 3.874 (1.32), 3.887 (2.52), 3.897 (2.22), 3.921 (2.36), 3.932 (2.47), 3.943 (1.24), 3.955 (1.16), 4.012 (0.45), 4.023 (1.35), 4.029 (1.08), 4.035 (3.31), 4.041 (3.19), 4.047 (3.20), 4.053 (3.21), 4.059 (1.07), 4.064 (1.30), 4.076 (0.45), 6.447 (6.28), 6.451 (6.35), 7.431 (7.15), 7.434 (11.71), 7.447 (6.96), 7.449 (7.43), 7.471 (2.05), 7.473 (1.91), 7.484 (3.45), 7.498 (1.46), 7.535 (5.26), 7.549 (6.27), 7.562 (3.09), 7.565 (2.87), 7.575 (1.11), 7.577 (1.28), 7.747 (6.04), 7.761 (5.32), 8.413 (6.41), 8.733 (1.41), 8.744 (2.74), 8.755 (1.39), 11.238 (1.19).
Example 81
Rac-N-[(4-Ethyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2517) ##STR00479##
(2518) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (84.7 mg, 318 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (160 l, 890 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (79.3 mg, 414 mol), 1H-benzotriazol-1-ol hydrate (63.3 mg, 414 mol) and rac-5-(aminomethyl)-5-ethylimidazolidine-2,4-dione hydrochloride (50.0 mg, 258 mol). The mixture was stirred for 2 h at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 81.0 mg (99% purity, 62% yield) of the title compound were obtained.
(2519) LC-MS (Method 7): R.sub.t=1.56 min; MS (ESIpos): m/z=406 [M+H].sup.+
(2520) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.44), 0.008 (0.50), 0.722 (6.54), 0.740 (16.00), 0.758 (7.30), 1.411 (0.41), 1.430 (1.37), 1.448 (1.89), 1.465 (2.69), 1.483 (2.20), 1.501 (0.57), 1.524 (0.64), 1.542 (2.32), 1.560 (2.69), 1.577 (1.94), 1.596 (1.33), 2.072 (1.04), 2.523 (1.23), 3.340 (3.60), 3.355 (3.14), 3.393 (3.10), 3.410 (3.26), 3.427 (1.69), 3.444 (1.60), 7.427 (4.58), 7.446 (5.73), 7.460 (8.96), 7.462 (9.82), 7.468 (6.79), 7.474 (6.06), 7.477 (4.70), 7.493 (1.22), 7.496 (1.09), 7.519 (0.55), 7.530 (3.43), 7.537 (3.04), 7.545 (2.43), 7.549 (3.14), 7.558 (7.86), 7.579 (8.51), 7.634 (8.67), 7.752 (8.93), 7.772 (7.29), 8.489 (1.76), 8.505 (3.49), 8.520 (1.76), 10.677 (1.38).
Example 82
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[4-(Trifluoromethyl)Phenyl]Pyridine-3-Carboxamide
(2521) ##STR00480##
(2522) 2-[4-(trifluoromethyl)phenyl]pyridine-3-carboxylic acid (20.0 mg, 70% purity, 52.4 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (26 l, 150 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (13.1 mg, 68.1 mol), 1H-benzotriazol-1-ol hydrate (10.4 mg, 68.1 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrogen chloride (10.8 mg, 52.4 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 9.00 mg (100% purity, 41% yield) of the title compound were obtained.
(2523) LC-MS (Method 7): R.sub.t=1.32 min; MS (ESIpos): m/z=419 [M+H].sup.+
(2524) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.04), 0.008 (0.97), 0.151 (0.57), 0.164 (0.58), 0.175 (0.40), 0.344 (0.44), 0.353 (0.42), 0.421 (0.53), 0.475 (0.45), 0.486 (0.56), 0.499 (0.54), 1.097 (0.40), 1.110 (0.68), 2.327 (0.49), 2.366 (0.42), 2.523 (2.09), 2.669 (0.52), 2.710 (0.40), 3.565 (1.93), 3.580 (1.98), 7.493 (1.04), 7.505 (1.08), 7.512 (1.17), 7.524 (1.19), 7.632 (1.50), 7.797 (1.32), 7.801 (1.62), 7.809 (16.00), 7.816 (1.91), 7.820 (1.46), 8.736 (1.10), 8.741 (1.19), 8.748 (1.17), 8.752 (1.10), 8.808 (0.44), 8.824 (0.94), 8.840 (0.46), 10.670 (1.24).
Example 83
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-3-[4-(Trifluoromethyl)Phenyl]Pyridine-4-Carboxamide
(2525) ##STR00481##
(2526) 3-[4-(trifluoromethyl)phenyl]pyridine-4-carboxylic acid (47.0 mg, 176 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (86 l, 490 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (43.8 mg, 229 mol), 1H-benzotriazol-1-ol hydrate (35.0 mg, 229 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrogen chloride (36.2 mg, 176 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 43.0 mg (100% purity, 58% yield) of the title compound were obtained.
(2527) LC-MS (Method 7): R.sub.t=1.33 min; MS (ESIpos): m/z=419 [M+H].sup.+
(2528) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.56), 0.008 (1.71), 0.118 (0.61), 0.132 (1.51), 0.143 (2.66), 0.156 (2.83), 0.166 (1.97), 0.180 (0.88), 0.298 (0.52), 0.321 (1.68), 0.333 (2.09), 0.342 (1.97), 0.355 (1.58), 0.366 (1.27), 0.373 (1.10), 0.384 (1.62), 0.398 (1.88), 0.407 (2.44), 0.420 (1.86), 0.428 (1.04), 0.442 (0.78), 0.449 (1.02), 0.462 (2.07), 0.474 (2.64), 0.487 (2.55), 0.498 (1.58), 0.512 (0.56), 1.050 (0.86), 1.063 (1.75), 1.071 (1.92), 1.084 (3.32), 1.097 (1.77), 1.105 (1.58), 1.118 (0.69), 2.323 (0.60), 2.327 (0.84), 2.332 (0.63), 2.366 (0.61), 2.523 (3.02), 2.665 (0.61), 2.670 (0.84), 2.674 (0.61), 2.710 (0.54), 3.490 (0.50), 3.507 (0.56), 3.525 (5.81), 3.530 (5.96), 3.545 (6.52), 3.564 (0.65), 3.579 (0.47), 7.381 (7.77), 7.394 (7.93), 7.623 (16.00), 7.643 (10.26), 7.808 (10.52), 7.829 (8.64), 8.683 (15.61), 8.698 (11.59), 8.711 (10.95), 8.827 (2.12), 8.843 (4.53), 8.858 (2.10), 10.675 (6.37).
Example 84
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[5-(Trifluoromethyl)Pyridin-2-Yl]Benzamide
(2529) ##STR00482##
(2530) 2-[5-(trifluoromethyl)pyridin-2-yl]benzoic acid (27.0 mg, 75% purity, 75.8 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (37 l, 210 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (18.9 mg, 98.5 mol), 1H-benzotriazol-1-ol hydrate (15.1 mg, 98.5 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrogen chloride (15.6 mg, 75.8 mol). The mixture was stirred at room temperature for 3 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 18.0 mg (100% purity, 57% yield) of the title compound were obtained.
(2531) LC-MS (Method 7): R.sub.t=1.35 min; MS (ESIpos): m/z=419 [M+H].sup.+
(2532) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.05), 0.008 (1.92), 0.115 (0.94), 0.129 (2.13), 0.140 (3.81), 0.153 (3.97), 0.163 (2.82), 0.177 (1.31), 0.303 (0.78), 0.325 (2.37), 0.338 (3.03), 0.349 (2.82), 0.360 (2.21), 0.371 (1.64), 0.391 (1.35), 0.402 (2.37), 0.416 (2.58), 0.424 (3.56), 0.438 (2.86), 0.449 (2.33), 0.464 (3.40), 0.475 (3.76), 0.488 (3.60), 0.499 (2.21), 0.513 (0.74), 1.087 (1.27), 1.101 (2.58), 1.108 (2.70), 1.121 (4.79), 1.134 (2.54), 1.142 (2.29), 1.155 (1.02), 2.327 (1.47), 2.332 (1.06), 2.366 (0.90), 2.523 (4.75), 2.665 (1.10), 2.669 (1.47), 2.674 (1.15), 2.710 (0.94), 3.504 (1.60), 3.519 (1.84), 3.539 (6.71), 3.554 (11.50), 3.571 (6.63), 3.589 (1.80), 3.605 (1.68), 7.488 (3.97), 7.492 (5.57), 7.502 (16.00), 7.510 (10.93), 7.520 (4.99), 7.524 (5.07), 7.538 (8.10), 7.542 (7.65), 7.557 (4.01), 7.560 (3.97), 7.568 (5.16), 7.573 (4.71), 7.587 (7.16), 7.591 (7.16), 7.605 (3.48), 7.609 (3.23), 7.683 (8.72), 7.686 (8.18), 7.694 (8.88), 7.702 (7.04), 7.705 (6.22), 7.715 (8.88), 8.208 (5.16), 8.214 (5.20), 8.229 (4.87), 8.235 (4.83), 8.584 (3.03), 8.599 (6.34), 8.615 (3.03), 8.989 (8.27), 10.631 (2.50).
Example 85
Ent-N-{[4-(4-Methyl-1,2,5-Thiadiazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2533) ##STR00483##
(2534) Enantiomeric separation of rac-N-{[4-(4-methyl-1,2,5-thiadiazol-3-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (22.0 mg, 46.3 mol) was done using the following chiral HPLC method: Column: Daicel Chiralpak ID 5 m 25020 mm Solvent: 50% n-heptane: 50% iso-propanol Flow: 20 ml/min Oven temperature: 40 C. UV: 210 nm
(2535) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 7.00 mg (100% purity, 32% yield) of the title compound were obtained.
(2536) LC-MS (Method 7): R.sub.t=1.70 min; MS (ESIpos): m/z=476 [M+H].sup.+
(2537) Chiral HPLC (Column: Daicel Chiralpak ID-3 3 m, 504.6 mm, 220 nm, solvent: 50% n-heptane: 50% iso-propanol): R.sub.t=1.862 min, 99% ee
(2538) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.386 (0.72), 2.426 (0.86), 2.475 (16.00), 2.615 (0.86), 2.655 (0.86), 4.129 (4.02), 4.140 (3.95), 7.441 (1.58), 7.453 (4.52), 7.464 (2.65), 7.477 (1.43), 7.489 (2.22), 7.502 (1.00), 7.558 (4.88), 7.571 (5.52), 7.769 (4.09), 7.782 (3.66), 8.421 (3.37), 8.824 (1.00), 8.835 (1.94), 8.845 (1.08).
Example 86
Ent-N-{[4-(3-Methyl-1,2-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2539) ##STR00484##
(2540) Enantiomeric separation of rac-N-{[4-(3-methyl-1,2-thiazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (76.0 mg, 160 mol) was done using the following chiral HPLC method: Column: Daicel Chiralpak IC-3 5 m 25020 mm Solvent: 80% n-heptane: 20% iso-propanol Flow: 25 ml/min Oven temperature: 40 C. UV: 220 nm
(2541) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 30.0 mg (100% purity, 39% yield) of the title compound were obtained.
(2542) LC-MS (Method 7): R.sub.t=1.61 min; MS (ESIpos): m/z=475 [M+H].sup.+
(2543) Chiral HPLC (Column: Daicel IC-3 3 m, 504.6 mm, 220 nm, solvent: 80% iso-hexane: 20% iso-propanol): R.sub.t=1.948 min, >99.5% ee
(2544) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.99), 1.260 (0.41), 2.386 (0.58), 2.415 (16.00), 2.426 (0.91), 2.517 (1.15), 2.521 (1.24), 2.524 (0.99), 2.615 (0.49), 2.655 (0.74), 3.370 (0.66), 3.380 (0.66), 3.901 (0.74), 3.911 (0.82), 3.923 (1.40), 3.933 (1.24), 3.965 (1.32), 3.977 (1.40), 3.988 (0.82), 3.999 (0.74), 7.428 (1.48), 7.439 (4.04), 7.453 (2.06), 7.474 (1.15), 7.476 (1.07), 7.486 (2.06), 7.488 (1.81), 7.499 (0.99), 7.528 (3.13), 7.542 (3.38), 7.553 (1.32), 7.555 (1.32), 7.565 (1.98), 7.568 (1.81), 7.578 (0.74), 7.580 (0.74), 7.747 (3.55), 7.761 (3.22), 8.294 (3.05), 8.779 (0.82), 8.790 (1.57), 8.800 (0.82), 9.106 (5.20), 11.188 (0.82).
Example 87
Ent-N-{[4-(1,3-Dimethyl-1H-Pyrazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2545) ##STR00485##
(2546) Enantiomeric separation of rac-N-{[4-(1,3-dimethyl-1H-pyrazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (83.0 mg, 176 mol) was done using the following chiral HPLC method: Column: Daicel Chiralpak ID 5 m 25020 mm Solvent: 60% n-heptane: 40% iso-propanol Flow: 20 ml/min Oven temperature: 40 C. UV: 210 nm
(2547) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 26.0 mg (100% purity, 31% yield) of the title compound were obtained.
(2548) LC-MS (Method 7): R.sub.t=1.47 min; MS (ESIpos): m/z=472 [M+H].sup.+
(2549) Chiral HPLC (Column: Daicel ID-3 3 m, 504.6 mm, 220 nm, solvent: 50% n-heptane: 50% iso-propanol): R.sub.t=1.728 min, 99% ee
(2550) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.107 (15.78), 2.387 (0.41), 2.426 (0.63), 2.615 (0.48), 2.655 (0.56), 3.703 (16.00), 3.766 (3.48), 3.777 (3.41), 7.411 (1.48), 7.423 (2.30), 7.436 (1.89), 7.448 (2.30), 7.462 (1.11), 7.474 (2.07), 7.487 (1.00), 7.524 (3.37), 7.538 (3.78), 7.555 (1.93), 7.567 (0.78), 7.695 (5.37), 7.749 (3.81), 7.763 (3.37), 8.099 (4.22), 8.654 (0.93), 8.664 (1.89), 8.674 (0.93), 10.898 (0.63).
Example 88
Ent-N-{[4-(4-Methyl-1,2-Oxazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2551) ##STR00486##
(2552) Enantiomeric separation of rac-N-{[4-(4-methyl-1,2-oxazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (66.0 mg, 144 mol) was done using the following chiral HPLC method: Column: Daicel Chiralpak ID-3 5 m 25020 mm Solvent: 50% n-heptane: 50% iso-propanol Flow: 20 ml/min Oven temperature: 40 C. UV: 220 nm
(2553) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 24.0 mg (100% purity, 36% yield) of the title compound were obtained.
(2554) LC-MS (Method 7): R.sub.t=1.61 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2555) Chiral HPLC (Column: Daicel ID-3 3 m, 504.6 mm, 220 nm, solvent: 50% n-heptane: 50% iso-propanol): R.sub.t=2.666 min, 97.2% ee
(2556) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.55), 1.282 (0.87), 2.002 (16.00), 2.426 (0.41), 2.517 (0.73), 2.521 (0.69), 3.309 (0.46), 3.968 (1.83), 3.973 (1.92), 3.978 (1.87), 3.983 (1.87), 7.419 (1.33), 7.429 (2.01), 7.448 (1.60), 7.461 (1.97), 7.471 (1.01), 7.484 (1.87), 7.497 (0.91), 7.537 (2.88), 7.550 (3.29), 7.566 (1.69), 7.568 (1.65), 7.578 (0.73), 7.580 (0.69), 7.761 (3.29), 7.774 (2.88), 8.498 (5.39), 8.603 (3.20), 8.818 (0.82), 8.828 (1.65), 8.839 (0.78).
Example 89
4-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(2557) ##STR00487##
(2558) 4-chloro-5-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (73.1 mg, 243 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (120 l, 680 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (60.6 mg, 316 mol), 1H-benzotriazol-1-ol hydrate (48.4 mg, 316 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol). The mixture was stirred for 2.5 h at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 bis 2 min 7 ml, eluent A 2 bis 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 45.0 mg (100% purity, 41% yield) of the title compound were obtained.
(2559) LC-MS (Method 8): R.sub.t=0.93 min; MS (ESIpos): m/z=452 [M+H].sup.+
(2560) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.58), 0.008 (0.61), 0.115 (0.52), 0.128 (1.20), 0.139 (2.13), 0.152 (2.26), 0.163 (1.58), 0.176 (0.74), 0.301 (0.42), 0.323 (1.33), 0.335 (1.65), 0.346 (1.55), 0.358 (1.26), 0.368 (0.97), 0.379 (0.81), 0.390 (1.36), 0.404 (1.49), 0.412 (1.97), 0.426 (1.55), 0.434 (0.91), 0.445 (1.03), 0.458 (1.68), 0.469 (2.13), 0.482 (2.00), 0.494 (1.23), 0.507 (0.45), 1.047 (0.68), 1.061 (1.42), 1.068 (1.52), 1.073 (1.10), 1.081 (2.65), 1.089 (1.10), 1.094 (1.39), 1.102 (1.26), 1.115 (0.55), 2.323 (0.42), 2.327 (0.61), 2.332 (0.45), 2.524 (2.29), 2.558 (0.68), 2.665 (0.48), 2.670 (0.61), 2.674 (0.48), 3.471 (0.45), 3.486 (0.55), 3.505 (4.43), 3.511 (4.53), 3.521 (4.72), 3.526 (4.82), 3.545 (0.58), 3.560 (0.42), 7.426 (7.66), 7.431 (3.07), 7.442 (4.11), 7.448 (16.00), 7.453 (2.59), 7.483 (2.46), 7.489 (15.97), 7.494 (3.98), 7.505 (3.07), 7.510 (7.79), 7.516 (1.00), 7.571 (4.30), 7.592 (12.48), 7.712 (6.08), 7.815 (3.33), 7.818 (3.30), 7.835 (2.91), 7.838 (2.78), 8.672 (1.75), 8.687 (3.72), 8.702 (1.75), 10.649 (3.46).
Example 90
2-(4-Chlorophenyl)-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}Pyridine-3-Carboxamide
(2561) ##STR00488##
(2562) 2-(4-chlorophenyl)pyridine-3-carboxylic acid (81.2 mg, 70% purity, 243 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (120 l, 680 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (60.6 mg, 316 mol), 1H-benzotriazol-1-ol hydrate (48.4 mg, 316 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol). The mixture was stirred for 5 h at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 bis 2 min 7 ml, eluent A 2 bis 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 12.0 mg (100% purity, 13% yield) of the title compound were obtained.
(2563) LC-MS (Method 8): R.sub.t=0.63 min; MS (ESIpos): m/z=385 [M+H].sup.+
(2564) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.40), 0.008 (1.34), 0.122 (0.55), 0.135 (1.28), 0.146 (2.37), 0.159 (2.31), 0.170 (1.64), 0.183 (0.73), 0.312 (0.49), 0.334 (1.40), 0.346 (1.76), 0.358 (1.64), 0.369 (1.28), 0.380 (0.97), 0.392 (0.79), 0.403 (1.34), 0.417 (1.52), 0.426 (2.07), 0.439 (1.64), 0.447 (0.97), 0.459 (1.16), 0.472 (1.76), 0.483 (2.19), 0.496 (2.07), 0.508 (1.28), 0.521 (0.43), 1.076 (0.67), 1.089 (1.46), 1.097 (1.58), 1.110 (2.68), 1.123 (1.40), 1.131 (1.34), 1.144 (0.61), 2.323 (0.85), 2.327 (1.22), 2.332 (0.91), 2.366 (1.10), 2.523 (4.99), 2.665 (0.91), 2.669 (1.28), 2.674 (0.91), 2.710 (0.97), 3.556 (7.67), 3.571 (7.79), 7.437 (4.26), 7.449 (4.26), 7.456 (4.62), 7.468 (4.81), 7.490 (9.49), 7.495 (3.47), 7.506 (3.95), 7.511 (14.05), 7.517 (1.95), 7.609 (7.48), 7.615 (16.00), 7.620 (4.81), 7.632 (3.65), 7.637 (10.16), 7.643 (1.34), 7.739 (4.68), 7.743 (4.99), 7.758 (4.32), 7.763 (4.20), 8.693 (4.44), 8.697 (4.62), 8.704 (4.62), 8.709 (4.38), 8.732 (1.76), 8.747 (3.77), 8.762 (1.76), 10.654 (4.93).
Example 91
Ent-N-{[4-(4-Methyl-1,2,5-Thiadiazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2565) ##STR00489##
(2566) Enantiomeric separation of rac-N-{[4-(4-methyl-1,2,5-thiadiazol-3-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-2-[6-(trifluoromethyl)pyridin-3-yl]benzamide (36.0 mg, 75.6 mol) was done using the following chiral HPLC method: Daicel Chiralpak ID 5 m 250*20 mm Eluent A: 50% n-heptane, eluent B: 50% iso-propanol Flow: 20 ml/min UV-detection: 210 nm Temperature: 40 C.
(2567) 12.2 mg (100% purity, 34% yield) of the title compound were obtained.
(2568) Chiral-HPLC (Column: Diacel Chrialpak ID-3 3 m 50*4.6 mm, eluent A: 50% n-heptane, eluent B: 50% iso-propanol, flow: 1 ml/min, UV-detection: 220 nm): R.sub.t=2.852 min; 100% ee
(2569) LC-MS (Method 8): R.sub.t=0.77 min; MS (ESIpos): m/z=477 [M+H].sup.+
(2570) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.072 (2.10), 2.327 (0.45), 2.469 (16.00), 2.670 (0.53), 4.115 (2.89), 4.131 (2.89), 7.498 (1.08), 7.513 (2.28), 7.532 (1.59), 7.538 (1.24), 7.541 (1.30), 7.550 (2.75), 7.557 (2.50), 7.575 (1.08), 7.601 (1.47), 7.605 (1.47), 7.620 (1.51), 7.624 (1.57), 7.639 (0.57), 7.642 (0.55), 7.925 (1.28), 7.945 (3.34), 7.967 (1.95), 7.972 (1.89), 7.987 (0.77), 7.992 (0.79), 8.400 (2.46), 8.747 (2.30), 8.849 (0.79), 8.865 (1.69), 8.880 (0.81).
Example 92
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-(Trifluoromethoxy)-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(2571) ##STR00490##
(2572) 5-(trifluoromethoxy)-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (104 mg, 82% purity, 243 mol) dissolved in 1.5 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (120 l, 680 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (60.6 mg, 316 mol), 1H-benzotriazol-1-ol hydrate (48.4 mg, 316 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 85.0 mg (100% purity, 70% yield) of the title compound were obtained.
(2573) LC-MS (Method 9): R.sub.t=1.45 min; MS (ESIpos): m/z=502 [M+H].sup.+
(2574) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (1.69), 0.008 (13.88), 0.008 (14.90), 0.126 (1.86), 0.137 (3.39), 0.151 (3.47), 0.161 (2.46), 0.314 (2.12), 0.327 (2.62), 0.336 (2.46), 0.349 (1.95), 0.359 (1.61), 0.369 (1.27), 0.380 (2.20), 0.394 (2.29), 0.402 (2.96), 0.416 (2.37), 0.443 (1.44), 0.457 (2.54), 0.468 (3.30), 0.480 (3.13), 0.492 (2.03), 1.045 (1.10), 1.058 (2.29), 1.066 (2.37), 1.079 (3.98), 1.092 (2.20), 1.099 (2.03), 2.072 (0.93), 2.327 (1.27), 2.366 (1.44), 2.670 (1.27), 2.710 (1.35), 3.506 (10.58), 3.522 (11.01), 7.452 (8.55), 7.503 (2.46), 7.524 (6.26), 7.547 (16.00), 7.568 (6.18), 7.580 (14.22), 7.587 (12.44), 7.607 (12.53), 7.783 (13.12), 7.803 (10.75), 8.686 (2.62), 8.701 (5.67), 8.717 (2.71), 10.647 (3.98).
Example 93
5-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-6-Fluoro-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(2575) ##STR00491##
(2576) 5-chloro-6-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (77.5 mg, 243 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (120 l, 680 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (60.6 mg, 316 mol), 1H-benzotriazol-1-ol hydrate (48.4 mg, 316 mol) and (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 14.0 mg (100% purity, 12% yield) of the title compound were obtained.
(2577) LC-MS (Method 7): R.sub.t=1.79 min; MS (ESIpos): m/z=470 [M+H].sup.+
(2578) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.73), 0.008 (6.16), 0.008 (6.95), 0.094 (0.69), 0.108 (1.70), 0.119 (3.05), 0.132 (3.23), 0.143 (2.40), 0.155 (1.07), 0.268 (0.57), 0.292 (1.88), 0.304 (2.46), 0.313 (2.42), 0.326 (1.86), 0.337 (1.82), 0.351 (1.96), 0.365 (2.26), 0.373 (2.87), 0.387 (2.20), 0.411 (1.47), 0.425 (2.40), 0.436 (3.07), 0.449 (2.91), 0.461 (1.82), 0.474 (0.69), 0.999 (0.97), 1.012 (1.98), 1.020 (2.16), 1.033 (3.64), 1.046 (1.98), 1.054 (1.78), 1.067 (0.75), 2.073 (0.57), 2.328 (0.65), 2.367 (0.69), 2.670 (0.61), 2.710 (0.63), 3.387 (0.55), 3.425 (7.37), 3.439 (8.28), 3.460 (0.71), 3.475 (0.46), 7.288 (6.12), 7.309 (6.63), 7.539 (9.21), 7.557 (16.00), 7.742 (4.67), 7.762 (5.84), 7.781 (4.69), 7.793 (11.76), 7.814 (10.02), 8.602 (2.48), 8.618 (5.23), 8.633 (2.48), 10.649 (7.37).
Example 94
Rac-N-({2,5-Dioxo-4-[1-(2,2,2-Trifluoroethyl)-1H-Imidazol-5-Yl]Imidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2579) ##STR00492##
(2580) N-{2-oxo-2-[1-(2,2,2-trifluoroethyl)-1H-imidazol-5-yl]ethyl}-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxamide (249 mg, 547 mol) was dissolved in 3.5 ml of ethanol. Ammonium carbonate (525 mg, 5.47 mmol) and potassium cyanide (142 mg, 2.19 mmol), dissolved in 7 ml of water, were added, the vial was sealed and the mixture was stirred at 60 C. for 2 days. More potassium cyanide (142 mg, 2.19 mmol) was added and the mixture was stirred at 80 C. for 35 days. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 7.00 mg (91% purity, 2% yield) of the title compound were obtained.
(2581) LC-MS (Method 7): R.sub.t=1.53 min; MS (ESIpos): m/z=526 [M+H].sup.+
(2582) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.327 (0.49), 2.366 (0.47), 2.670 (0.54), 2.709 (0.45), 3.765 (2.10), 3.782 (2.33), 3.799 (4.31), 3.816 (4.08), 3.853 (4.03), 3.867 (4.43), 3.887 (2.29), 3.902 (2.05), 5.008 (1.93), 5.027 (4.90), 5.054 (4.74), 5.072 (1.84), 5.698 (0.66), 5.721 (0.64), 7.174 (15.10), 7.420 (4.45), 7.436 (14.30), 7.455 (8.06), 7.466 (3.89), 7.469 (3.91), 7.485 (6.79), 7.488 (6.53), 7.504 (3.58), 7.532 (10.63), 7.551 (16.00), 7.565 (7.12), 7.569 (6.46), 7.584 (2.22), 7.587 (2.40), 7.637 (1.89), 7.658 (1.20), 7.710 (1.04), 7.750 (13.13), 7.771 (10.77), 7.789 (11.73), 8.020 (1.51), 8.335 (10.39), 8.784 (2.71), 8.799 (5.47), 8.815 (2.69), 11.208 (0.68).
Example 95
Rac-N-[(4-Methyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2583) ##STR00493##
(2584) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (148 mg, 557 mol) dissolved in 4 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (270 l, 1.6 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (139 mg, 724 mol), 1H-benzotriazol-1-ol hydrate (111 mg, 724 mol) and rac-5-(aminomethyl)-5-methylimidazolidine-2,4-dione hydrochloride (100 mg, 557 mol). The mixture was stirred over night at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 bis 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 153 mg (98% purity, 69% yield) of the title compound were obtained.
(2585) LC-MS (Method 7): R.sub.t=1.48 min; MS (ESIpos): m/z=392 [M+H].sup.+
Example 96
Ent-N-[(4-Methyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2586) ##STR00494##
(2587) Enantiomeric separation of rac-N-[(4-methyl-2,5-dioxoimidazolidin-4-yl)methyl]-4-(trifluoromethyl)[biphenyl]-2-carboxamide (145 mg, 371 mol) was done using the following chiral HPLC method: Daicel Chiralpak AD-H 5 m 250*20 mm Eluent A: 60% n-heptane, eluent B: 40% ethanol Flow: 15 ml/min UV-detection: 210 nm Temperature: 40 C.
(2588) 48.4 mg (100% purity, 33% yield) of the title compound were obtained.
(2589) Chiral-HPLC (Column: Chiraltek AD-3 3 m, eluent A: 50% iso-hexane, eluent B: 50% ethanol, flow: 1 ml/min, UV-detection: 220 nm): R.sub.t=3.309 min; 100% ee
(2590) LC-MS (Method 7): R.sub.t=1.48 min; MS (ESIpos): m/z=392 [M+H].sup.+
(2591) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.194 (16.00), 3.312 (1.45), 3.325 (1.99), 3.335 (1.57), 3.384 (1.65), 3.395 (1.67), 3.407 (1.04), 3.418 (0.97), 7.432 (2.22), 7.444 (2.86), 7.475 (3.16), 7.480 (6.03), 7.537 (1.27), 7.543 (1.20), 7.547 (1.20), 7.550 (1.40), 7.561 (4.01), 7.575 (4.18), 7.709 (4.08), 7.749 (4.32), 7.763 (3.76), 8.494 (0.96), 8.505 (1.85), 8.515 (1.00), 10.640 (0.73).
Example 97
Rac-N-{[4-(4-Methyl-1,2-Thiazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2592) ##STR00495##
(2593) N-[2-(4-methyl-1,2-thiazol-5-yl)-2-oxoethyl]-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxamide (18.0 mg, 44.5 mol) was dissolved in 290 l of ethanol. Ammonium carbonate (42.8 mg, 445 mol) and potassium cyanide (11.6 mg, 178 mol), dissolved in 570 l of water, were added, the vial was sealed and the mixture was stirred at 60 C. for 2 days. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and Eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 3.00 mg (100% purity, 14% yield) of the title compound were obtained.
(2594) LC-MS (Method 7): R.sub.t=1.68 min; MS (ESIpos): m/z=475 [M+H].sup.+
(2595) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.157 (0.71), 2.312 (1.04), 2.365 (16.00), 2.383 (0.88), 2.422 (1.17), 2.612 (1.04), 2.651 (1.25), 3.924 (2.67), 3.936 (3.09), 6.930 (0.42), 7.386 (2.01), 7.399 (2.55), 7.433 (2.51), 7.445 (2.84), 7.473 (1.34), 7.486 (2.55), 7.496 (4.80), 7.510 (4.34), 7.551 (1.71), 7.564 (2.26), 7.576 (1.00), 7.729 (4.18), 7.742 (3.76), 8.353 (5.39), 8.602 (3.80), 8.719 (2.01), 8.729 (1.09), 11.258 (1.21).
Example 98
Rac-N-({4-[5-Methyl-1-(2,2,2-Trifluoroethyl)-1H-Pyrazol-4-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2596) ##STR00496##
(2597) 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (42.2 mg, 159 mol) dissolved in 1 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (83 l, 480 mol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (39.5 mg, 206 mol), 1H-benzotriazol-1-ol hydrate (31.6 mg, 206 mol) and rac-5-(aminomethyl)-5-[5-methyl-1-(2,2,2-trifluoroethyl)-1H-pyrazol-4-yl]imidazolidine-2,4-dione hydrochloride (52.0 mg, 159 mol). The mixture was stirred for 4 h at room temperature. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 57.0 mg (100% purity, 67% yield) of the title compound were obtained.
(2598) LC-MS (Method 8): R.sub.t=0.86 min; MS (ESIpos): m/z=540 [M+H].sup.+
(2599) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.66), 0.008 (0.78), 2.320 (16.00), 3.797 (3.56), 3.813 (3.77), 5.058 (1.08), 5.081 (3.06), 5.104 (2.91), 5.126 (0.91), 7.374 (1.67), 7.377 (1.75), 7.393 (2.73), 7.434 (2.16), 7.451 (3.51), 7.466 (2.72), 7.484 (1.36), 7.540 (5.09), 7.558 (5.29), 7.578 (7.93), 7.751 (4.72), 7.772 (3.90), 8.218 (4.76), 8.673 (0.96), 8.689 (2.03), 8.704 (0.96), 10.939 (1.15).
Example 99
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Methyl-5-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2600) ##STR00497##
(2601) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-methyl-5-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (54.5 mg, 195 mol) dissolved in DMF (1.7 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred 3 hours at room temperature. Water (5 ml) was added to the reaction and the resulting precipitate was filtered off. The residue was washed with water and dried to obtain 42.0 mg (96% purity, 48% yield) of the title compound.
(2602) LC-MS (Method 7): R.sub.t=1.75 min; MS (ESIpos): m/z=432
(2603) .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 0.10-0.17 (m, 1H).sub.0.29-0.49 (m, 1H) 0.32-0.37 (m, 1 H) 0.54-0.55 (m, 1H) 1.07 (ddd, J=8.22, 5.17, 3.00 Hz, 1H) 2.34 (s, 3H) 3.45-3.54 (m, 2H) 7.21-7.27 (m, 2H) 7.33 (m, J=8.07 Hz, 2H) 7.47-7.61 (m, 2H) 7.66 (s, 1H) 7.78 (d, J=7.95 Hz, 1H) 8.58 (t, J=5.99 Hz, 1H) 10.58-10.71 (m, 1H).
Example 100
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro-4-Methyl[Biphenyl]-2-Carboxamide
(2604) ##STR00498##
(2605) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 5-fluoro-4-methyl[1,1-biphenyl]-2-carboxylic acid (44.8 mg, 195 mol) dissolved in DMF (1.7 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred for 2.5 hours at room temperature. Water (4 ml) was added to the reaction and the resulting precipitate was filtered off. The residue was washed with water and dried to obtain 28.0 mg (99% purity, 37% yield) of the title compound.
(2606) LC-MS (Method 8): R.sub.t=0.87 min, MS (ESIpos): m/z=382 [M+H].sup.+
(2607) .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 0.09-0.16 (m, 1H) 0.28-0.47 (m, 3H) 0.98-1.10 (m, 1H) 2.32 (s, 4H) 3.48 (m, J=5.80, 5.80 Hz, 2H) 7.17-7.30 (m, 6H) 7.40 (dd, J=8.31, 5.99 Hz, 1H) 7.49 (s, 1H) 8.37 (t, J=5.99 Hz, 1H) 10.62 (s, 1H).
Example 101
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4,6-Dimethyl[Biphenyl]-2-Carboxamide
(2608) ##STR00499##
(2609) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4,6-dimethyl[1,1-biphenyl]-2-carboxylic acid (44.0 mg, 195 mol) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred over night at room temperature. Water (2 ml) was added to the mixture and purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 54.3 mg (100% purity, 74% yield) of the title compound were obtained.
(2610) LC-MS (Method 7): R.sub.t=1.57 min; MS (ESIpos): m/z=378 [M+H].sup.+
(2611) .sup.1H NMR (600 MHz, DMSO-d.sub.6) ppm 0.07-0.12 (m, 1H) 0.24-0.32 (m, 1H) 0.32-0.41 (m, 2H) 0.95 (m, 1H) 2.04 (s, 3H) 2.32 (s, 3H) 3.32 (d, J=6.24 Hz, 2H) 7.07 (d, J=8.07 Hz, 2H) 7.13-7.18 (m, 3H) 7.28 (t, J=7.61 Hz, 1H) 7.33 (d, J=7.34 Hz, 1H) 7.39 (s, 1H) 8.02 (t, J=6.24 Hz, 1H) 10.60 (s, 1H).
Example 102
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(1,1-Difluoropropyl)[Biphenyl]-2-Carboxamide
(2612) ##STR00500##
(2613) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-(1,1-difluoropropyl)[1,1-biphenyl]-2-carboxylic acid (53.7 mg, 195 mol) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature. Water (2 ml) was added and the purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 82.4 mg (100% purity, 99% yield) of the title compound were obtained.
(2614) LC-MS (Method 7) R.sub.t=1.68 min; MS (ESIneg): m/z=426 [MH].sup.
(2615) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.72), 0.008 (1.57), 0.099 (0.43), 0.113 (1.01), 0.123 (1.80), 0.137 (1.90), 0.147 (1.48), 0.160 (0.61), 0.293 (0.63), 0.300 (1.15), 0.313 (1.42), 0.324 (1.35), 0.335 (1.06), 0.345 (0.82), 0.356 (0.70), 0.367 (1.15), 0.381 (1.28), 0.389 (1.68), 0.402 (1.30), 0.410 (0.79), 0.420 (0.86), 0.424 (0.77), 0.433 (1.45), 0.444 (1.77), 0.457 (1.67), 0.469 (1.02), 0.936 (7.03), 0.955 (16.00), 0.973 (7.33), 1.033 (0.58), 1.046 (1.19), 1.054 (1.28), 1.059 (0.93), 1.067 (2.18), 1.074 (0.89), 1.080 (1.16), 1.087 (1.05), 1.100 (0.46), 2.171 (0.47), 2.189 (1.47), 2.208 (1.65), 2.231 (3.01), 2.250 (2.95), 2.273 (1.51), 2.292 (1.26), 2.523 (0.54), 3.470 (0.53), 3.489 (3.92), 3.494 (3.94), 3.504 (3.82), 3.510 (3.75), 3.528 (0.48), 3.544 (0.42), 3.958 (0.45), 7.394 (1.46), 7.398 (1.84), 7.412 (8.80), 7.416 (4.80), 7.423 (3.47), 7.430 (5.13), 7.441 (4.33), 7.444 (2.91), 7.459 (6.09), 7.479 (8.66), 7.504 (6.13), 7.509 (3.47), 7.527 (11.47), 7.547 (5.36), 8.441 (1.45), 8.456 (3.10), 8.472 (1.44), 10.642 (4.18).
Example 103
4-Cyclopropyl-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Methoxy[Biphenyl]-2-Carboxamide
(2616) ##STR00501##
(2617) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (29.9 mg, 145 mol) and 4-cyclopropyl-5-methoxy[1,1-biphenyl]-2-carboxylic acid (39.0 mg, 145 mol) dissolved in DMF (1.0 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (36.2 mg, 189 mol), 1-hydroxybenzotriazole hydrate (28.9 mg, 189 mol) and N,N-diisopropylethylamine (71 l, 410 mol). The mixture was stirred overnight at room temperature. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 10.3 mg (100% purity, 17% yield) of the title compound were obtained.
(2618) LC-MS (Method 7): R.sub.t=1.75 min; MS (ESIpos): m/z=420 [M+H].sup.+
(2619) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.083 (0.83), 0.096 (1.90), 0.107 (3.23), 0.120 (3.39), 0.130 (2.46), 0.144 (1.19), 0.268 (0.70), 0.291 (2.10), 0.304 (2.70), 0.315 (2.65), 0.325 (1.92), 0.336 (1.47), 0.350 (1.23), 0.361 (2.09), 0.375 (2.37), 0.383 (3.33), 0.396 (3.41), 0.407 (3.70), 0.419 (3.83), 0.432 (2.96), 0.444 (1.83), 0.457 (0.60), 0.650 (0.57), 0.667 (3.06), 0.674 (5.05), 0.679 (8.05), 0.685 (7.85), 0.691 (7.81), 0.702 (3.44), 0.719 (0.56), 0.945 (7.26), 0.951 (7.11), 0.966 (7.64), 0.972 (6.96), 1.001 (1.19), 1.014 (2.18), 1.021 (2.38), 1.035 (3.84), 1.047 (2.14), 1.055 (1.86), 1.068 (0.81), 1.885 (1.13), 1.898 (2.25), 1.906 (2.56), 1.919 (4.11), 1.931 (2.37), 1.939 (2.07), 1.952 (0.97), 2.072 (1.13), 2.366 (0.44), 3.407 (2.01), 3.422 (2.29), 3.441 (4.83), 3.456 (4.41), 3.481 (4.48), 3.497 (4.69), 3.515 (2.19), 3.531 (2.07), 3.626 (0.76), 3.987 (0.46), 6.843 (9.48), 6.849 (10.78), 6.913 (5.41), 6.920 (4.59), 6.935 (5.77), 6.941 (5.14), 7.065 (12.18), 7.086 (15.50), 7.223 (16.00), 7.244 (12.35), 7.319 (10.20), 7.340 (9.07), 7.435 (8.91), 8.097 (2.77), 8.112 (5.50), 8.127 (2.70), 10.618 (8.15).
Example 104
4-Cyclopropyl-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro[Biphenyl]-2-Carboxamide
(2620) ##STR00502##
(2621) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-cyclopropyl-5-fluoro[1,1-biphenyl]-2-carboxylic acid (49.8 mg, 195 mol) dissolved in DMF (1.7 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred for 2.5 hours at room temperature. Water (5 mL) was added to the reaction and the mixture was extracted with ethyl acetate three times. The combined organic layers were dried over sodium sulfate, filtered and evaporated Purification was done by flash-column chromatography (n-heptane:ethyl actetate (60:40)+ethyl acetate+ethyl acetate:methanol (80:20)). Product containing samples were united, the solvents were evaporated. 52.0 mg (99% purity, 65% yield) of the title compound were obtained.
(2622) LC-MS (Method 7): R.sub.t=1.67 min, MS (ESIpos): m/z=408 [M+H].sup.+
(2623) .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 0.05-0.18 (m, 1H) 0.28-0.50 (m, 3H) 0.64-0.74 (m, 2H) 0.92-1.00 (m, 2H) 1.01-1.10 (m, 1H) 1.89-1.96 (m, 1H) 3.48 (m, 2H) 7.10 (d, J=8.31 Hz, 2H) 7.16-7.29 (m, 4H) 7.39 (dd, J=8.44, 5.99 Hz, 1H) 7.49 (s, 1H) 8.38 (t, J=6.17 Hz, 1H) 10.63 (s, 1H).
Example 105
4-Cyclopropyl-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2624) ##STR00503##
(2625) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-cyclopropyl[1,1-biphenyl]-2-carboxylic acid (46.3 mg, 195 mol) dissolved in DMF (1.6 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred over night at room temperature. Water (4 ml) was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (n-heptane:ethyl actetate (70:30).fwdarw.ethyl acetate). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 60.0 mg (99% purity, 78% yield) of the title compound were obtained.
(2626) LC-MS (Method 7): R.sub.t=1.61 min, MS (ESIpos): m/z=390 [M+H].sup.+
(2627) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.51), 0.008 (2.24), 0.092 (0.74), 0.105 (1.72), 0.116 (3.03), 0.129 (3.22), 0.140 (2.31), 0.153 (1.03), 0.275 (0.60), 0.297 (1.93), 0.310 (2.44), 0.321 (2.35), 0.332 (1.73), 0.342 (1.33), 0.357 (1.07), 0.368 (1.91), 0.382 (2.14), 0.390 (2.98), 0.404 (3.05), 0.420 (2.80), 0.430 (3.12), 0.443 (2.79), 0.455 (1.70), 0.469 (0.56), 0.654 (0.46), 0.671 (2.89), 0.678 (4.75), 0.684 (7.62), 0.690 (7.19), 0.695 (7.20), 0.707 (3.29), 0.724 (0.49), 0.937 (2.07), 0.946 (6.99), 0.952 (6.89), 0.960 (3.72), 0.967 (7.34), 0.973 (6.69), 0.980 (1.79), 0.983 (1.84), 1.012 (1.00), 1.026 (2.09), 1.033 (2.19), 1.039 (1.66), 1.047 (3.72), 1.054 (1.58), 1.059 (2.02), 1.067 (1.77), 1.080 (0.77), 1.886 (1.09), 1.899 (2.14), 1.907 (2.40), 1.920 (4.00), 1.932 (2.19), 1.941 (1.98), 1.953 (0.91), 3.436 (1.17), 3.451 (1.40), 3.470 (5.36), 3.485 (9.60), 3.501 (5.26), 3.519 (1.31), 3.535 (1.23), 7.074 (12.16), 7.094 (15.42), 7.238 (16.00), 7.259 (12.37), 7.343 (6.12), 7.352 (9.18), 7.357 (13.30), 7.362 (9.94), 7.372 (6.89), 7.391 (2.17), 7.453 (4.78), 7.459 (6.15), 7.464 (11.43), 7.471 (6.45), 7.490 (2.14), 7.494 (2.14), 8.304 (2.40), 8.319 (5.03), 8.334 (2.40), 10.623 (5.61).
Example 106
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Ethyl[Biphenyl]-2-Carboxamide
(2628) ##STR00504##
(2629) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-ethyl[1,1-biphenyl]-2-carboxylicacid (44.0 mg, 195 mol) dissolved in DMF (1.6 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred over night at room temperature. Water (4 ml) was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (n-heptane:ethyl actetate (70:30).fwdarw.ethyl acetate). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 54.0 mg (99% purity, 73% yield) of the title compound were obtained.
(2630) LC-MS (Method 7): R.sub.t=1.61 min, MS (ESIpos): m/z=378 [M+H].sup.+
(2631) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.63), 0.104 (0.92), 0.115 (1.58), 0.128 (1.67), 0.138 (1.22), 0.151 (0.54), 0.294 (1.01), 0.306 (1.29), 0.317 (1.24), 0.328 (0.93), 0.339 (0.71), 0.353 (0.57), 0.364 (1.00), 0.378 (1.12), 0.386 (1.56), 0.400 (1.38), 0.418 (1.51), 0.429 (1.58), 0.441 (1.46), 0.454 (0.91), 1.021 (0.52), 1.034 (1.08), 1.042 (1.17), 1.048 (0.96), 1.055 (1.93), 1.068 (1.11), 1.075 (0.94), 1.088 (0.41), 1.174 (0.41), 1.189 (7.29), 1.208 (16.00), 1.227 (7.59), 1.987 (0.47), 2.594 (1.85), 2.613 (5.41), 2.632 (5.29), 2.651 (1.70), 3.439 (0.54), 3.454 (0.66), 3.473 (2.84), 3.486 (4.56), 3.501 (2.79), 3.519 (0.63), 3.536 (0.58), 7.214 (4.61), 7.234 (8.29), 7.282 (9.40), 7.303 (5.06), 7.347 (1.26), 7.360 (8.40), 7.364 (6.66), 7.378 (5.59), 7.381 (5.50), 7.400 (1.26), 7.461 (7.37), 7.479 (2.75), 7.484 (2.28), 7.497 (1.05), 7.502 (1.04), 8.309 (1.27), 8.324 (2.60), 8.339 (1.25), 10.628 (4.04).
Example 107
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Methoxy-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2632) ##STR00505##
(2633) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 5-methoxy-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (57.6 mg, 195 mol) dissolved in DMF (1.7 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred for 3 hours at room temperature. Water was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (n-heptane:ethyl actetate (60:40)+ethyl acetate+ethyl acetate:methanol (80:20)). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 52.0 mg (99% purity, 59% yield) of the title compound were obtained.
(2634) LC-MS (Method 7): R.sub.t=1.64 min, MS (ESIpos): m/z=448 [M+H].sup.+
(2635) .sup.1H NMR (600 MHz, DMSO-d.sub.6) ppm 0.13 (m, 1H) 0.29-0.37 (m, 1H) 0.39 (m, 1H) 0.43-0.48 (m, 1H) 1.04-1.09 (m, 1H) 3.42-3.58 (m, 2H) 3.83 (s, 3H) 6.94 (d, J=2.38 Hz, 1H) 7.02 (dd, J=8.53, 2.48 Hz, 1H) 7.43 (d, J=8.44 Hz, 1H) 7.49 (s, 1H) 7.55 (d, J=8.07 Hz, 2H) 7.75 (d, J=8.25 Hz, 2H) 8.39 (t, J=6.14 Hz, 1H) 10.65 (br s, 1H).
Example 108
4-Cyclopropyl-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2636) ##STR00506##
(2637) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (32.2 mg, 157 mol) and 4-cyclopropyl-5-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (48.0 mg, 157 mol) dissolved in DMF (1.4 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (39.1 mg, 204 mol), 1-hydroxybenzotriazole hydrate (31.2 mg, 204 mol) and N,N-diisopropylethylamine (76 l, 440 mol). The mixture was stirred 3 hours at room temperature. Water (5 ml) was added to the reaction and the resulting precipitate was filtered off. The residue was washed with water and dried to obtain 43.0 mg (99% purity, 59% yield) of the title compound.
(2638) LC-MS (Method 7): R.sub.t=1.91 min; MS (ESIpos): m/z=458 [M+H].sup.+
(2639) .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 0.07-0.19 (m, 1H) 0.26-0.51 (m, 3H) 0.62-0.78 (m, 2H) 0.94-1.01 (m, 2H) 1.07 (m, 1H) 1.90-1.98 (m, 1H) 3.50 (d, J=6.11 Hz, 2H) 7.13 (d, J=8.31 Hz, 2H) 7.31 (d, J=8.19 Hz, 2H) 7.51-7.58 (m, 2H) 7.65 (s, 1H) 7.74-7.79 (m, 1H) 8.59 (t, J=6.11 Hz, 1H) 10.64 (s, 1H).
Example 109
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-6-Methyl-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2640) ##STR00507##
(2641) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 6-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (54.5 mg, 195 mol) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature. Purification was done by preparative HPLC (column: ReprosilC18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 50.2 mg (100% purity, 60% yield) of the title compound were obtained.
(2642) LC-MS (Method 7): R.sub.t=1.68 min; MS (ESIpos): m/z=432 [M+H].sup.+
(2643) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.092 (0.76), 0.100 (1.23), 0.108 (1.28), 0.116 (0.92), 0.124 (0.41), 0.256 (0.47), 0.262 (0.83), 0.270 (1.04), 0.277 (0.94), 0.284 (0.70), 0.292 (0.47), 0.322 (0.42), 0.330 (0.76), 0.340 (0.84), 0.345 (1.19), 0.354 (0.91), 0.359 (0.55), 0.383 (0.40), 0.392 (0.92), 0.400 (1.16), 0.408 (1.11), 0.416 (0.75), 0.958 (0.42), 0.966 (0.81), 0.971 (0.90), 0.980 (1.52), 0.985 (0.63), 0.989 (0.82), 0.994 (0.76), 2.045 (16.00), 3.339 (2.95), 3.341 (3.12), 3.351 (3.43), 3.364 (0.44), 7.231 (2.01), 7.243 (2.39), 7.346 (1.51), 7.358 (3.45), 7.371 (2.26), 7.393 (4.69), 7.406 (3.46), 7.448 (3.37), 7.717 (4.13), 7.731 (3.82), 8.269 (1.05), 8.279 (2.15), 8.290 (1.05), 10.621 (2.99).
Example 110
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Ethyl-5-Fluoro[Biphenyl]-2-Carboxamide
(2644) ##STR00508##
(2645) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-ethyl-5-fluoro[1,1-biphenyl]-2-carboxylic acid (47.5 mg, 195 mol) dissolved in DMF (1.7 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred for 2.5 hours at room temperature. Water was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated. The residue was purified twice by flash-column chromatography. Product containing samples were united, the solvents were evaporated. 46.0 mg (99% purity, 59% yield) of the title compound were obtained.
(2646) LC-MS (Method 7): R.sub.t=1.67 min, MS (ESIpos): m/z=396 [M+H].sup.+
(2647) .sup.1H NMR (600 MHz, DMSO-d.sub.6) ppm 0.09-0.16 (m, 1H) 0.27-0.35 (m, 1H) 0.35-0.48 (m, 2H) 1.06 (ddd, J=8.21, 5.18, 2.93 Hz, 1H) 1.21 (t, J=7.61 Hz, 3H) 2.63 (q, J=7.70 Hz, 2H) 3.39-3.54 (m, 2H) 7.20-7.27 (m, 4H) 7.31 (d, J=8.07 Hz, 2H) 7.40 (dd, J=8.44, 6.05 Hz, 1H) 7.50 (s, 1H) 8.40 (t, J=6.14 Hz, 1H) 10.64 (s, 1H).
Example 111
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(2,2-Difluorocyclopropyl)[Biphenyl]-2-Carboxamide (Mixture of Diastereoisomers)
(2648) ##STR00509##
(2649) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (30.0 mg, 146 mol) and 4-(2,2-difluorocyclopropyl)[1,1-biphenyl]-2-carboxylicacid (40.0 mg, 146 mol) dissolved in DMF (1.3 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (36.3 mg, 190 mol), 1-hydroxybenzotriazole hydrate (29.0 mg, 190 mol) and N,N-diisopropylethylamine (71 l, 410 mol). The mixture was for 3 hours at room temperature. Water was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (heptan:ethyl actetate (60:40)+ethyl acetate+ethyl acetate:methanol (80:20)). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 32.0 mg (99% purity, 51% yield) of the title compound were obtained.
(2650) LC-MS (Method 7): R.sub.t=1.61 min, MS (ESIpos): m/z=426 [M+H].sup.+
(2651) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.62), 0.008 (1.60), 0.105 (1.26), 0.118 (1.93), 0.129 (2.08), 0.142 (1.57), 0.276 (0.46), 0.299 (1.50), 0.311 (1.90), 0.322 (1.80), 0.333 (1.41), 0.343 (1.08), 0.369 (1.30), 0.380 (1.57), 0.391 (1.89), 0.412 (1.59), 0.424 (2.16), 0.437 (2.06), 0.448 (1.96), 0.461 (1.28), 1.026 (0.78), 1.039 (1.62), 1.047 (1.72), 1.052 (1.28), 1.060 (2.94), 1.073 (1.60), 1.080 (1.44), 1.093 (0.61), 1.901 (0.45), 1.911 (0.59), 1.921 (1.60), 1.932 (1.83), 1.942 (1.53), 1.953 (3.29), 1.965 (1.90), 1.974 (1.88), 1.985 (2.52), 1.998 (1.93), 2.015 (1.31), 2.029 (1.07), 2.049 (0.48), 2.072 (1.63), 2.669 (0.40), 2.970 (1.30), 2.993 (1.36), 3.001 (1.86), 3.024 (1.83), 3.033 (1.44), 3.055 (1.20), 3.439 (0.61), 3.453 (0.74), 3.475 (3.46), 3.490 (5.19), 3.498 (3.04), 3.506 (2.44), 3.524 (0.68), 3.540 (0.61), 7.277 (6.33), 7.298 (12.84), 7.336 (16.00), 7.357 (8.97), 7.377 (11.38), 7.385 (5.34), 7.388 (4.18), 7.395 (7.24), 7.403 (6.13), 7.421 (2.14), 7.476 (10.59), 7.480 (6.22), 7.494 (4.63), 7.499 (3.97), 7.512 (1.73), 7.517 (1.75), 8.365 (2.01), 8.380 (4.17), 8.395 (1.96), 10.631 (4.52).
Example 112
4-Cyclobutyl-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2652) ##STR00510##
(2653) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-cyclobutyl[1,1-biphenyl]-2-carboxylic acid (49.1 mg, 195 mol) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 76.1 mg (100% purity, 97% yield) of the title compound were obtained.
(2654) LC-MS (Method 7): R.sub.t=1.80 min; MS (ESIpos): m/z=404 [M+H].sup.+
(2655) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.102 (0.81), 0.111 (1.82), 0.118 (2.96), 0.127 (3.04), 0.134 (2.18), 0.143 (0.95), 0.282 (0.70), 0.297 (2.00), 0.304 (2.50), 0.312 (2.24), 0.320 (1.62), 0.327 (1.08), 0.360 (0.96), 0.368 (1.77), 0.377 (2.01), 0.383 (2.79), 0.392 (2.15), 0.397 (1.34), 0.407 (0.83), 0.416 (1.10), 0.425 (2.34), 0.432 (2.95), 0.441 (2.82), 0.449 (1.90), 0.458 (0.67), 1.029 (0.98), 1.038 (1.98), 1.042 (2.16), 1.051 (3.58), 1.056 (1.58), 1.060 (1.98), 1.065 (1.79), 1.074 (0.79), 1.801 (0.77), 1.816 (2.19), 1.833 (2.64), 1.847 (1.16), 1.945 (0.50), 1.959 (1.30), 1.962 (1.39), 1.975 (3.19), 1.992 (3.29), 2.006 (1.65), 2.009 (1.61), 2.023 (0.76), 2.084 (1.09), 2.098 (3.39), 2.100 (3.50), 2.116 (4.95), 2.133 (3.27), 2.147 (0.87), 2.150 (0.89), 2.272 (1.84), 2.276 (2.37), 2.286 (4.13), 2.290 (5.73), 2.294 (3.42), 2.300 (3.44), 2.304 (5.35), 2.308 (3.45), 2.318 (1.83), 2.322 (1.32), 3.456 (1.50), 3.466 (1.72), 3.478 (5.04), 3.488 (5.21), 3.493 (5.37), 3.504 (5.04), 3.513 (3.04), 3.527 (5.04), 3.542 (2.46), 3.557 (0.78), 3.835 (0.45), 7.240 (9.24), 7.254 (14.50), 7.298 (16.00), 7.311 (9.73), 7.351 (3.11), 7.361 (13.48), 7.370 (5.95), 7.374 (8.20), 7.381 (6.28), 7.394 (2.31), 7.471 (9.48), 7.480 (5.92), 7.483 (5.11), 7.492 (2.20), 7.495 (2.21), 8.339 (2.64), 8.349 (5.23), 8.360 (2.59), 10.639 (7.17).
Example 113
4-Tert-Butyl-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2656) ##STR00511##
(2657) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-tert-butyl[1,1-biphenyl]-2-carboxylic acid (49.5 mg, 195 mol) dissolved in DMF (1.6 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred over night at room temperature. Water was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (n-heptane:ethyl actetate (70:30).fwdarw.ethyl acetate). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 52.0 mg (99% purity, 65% yield) of the title compound were obtained.
(2658) LC-MS (Method 7): R.sub.t=1.82 min, MS (ESIpos): m/z=406 [M+H].sup.+
(2659) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.065 (0.43), 1.285 (0.74), 1.304 (16.00), 3.324 (8.15), 3.328 (8.13), 3.486 (0.59), 3.496 (0.57), 3.504 (0.56), 3.515 (0.54), 7.313 (1.27), 7.327 (1.67), 7.349 (0.47), 7.359 (0.90), 7.362 (0.90), 7.372 (1.09), 7.384 (1.08), 7.386 (1.21), 7.402 (1.73), 7.416 (1.24), 7.469 (1.62), 7.484 (0.63), 8.373 (0.61), 10.640 (0.53).
Example 114
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2660) ##STR00512##
(2661) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (51.8 mg, 195 mol) dissolved in DMF (1.6 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature. Water was added and the mixture was extracted with ethylacetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (n-heptane:ethyl actetate (80:20).fwdarw.n-heptane:ethyl acetate (20:80)). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 61.0 mg (99% purity, 74% yield) of the title compound were obtained.
(2662) LC-MS (Method 10): R.sub.t=1.14 min, MS (ESIneg): m/z=416 [MH].sup.
(2663) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.24), 0.008 (1.85), 0.110 (0.81), 0.123 (1.98), 0.134 (3.47), 0.147 (3.83), 0.158 (2.57), 0.171 (1.14), 0.286 (0.69), 0.301 (1.21), 0.310 (2.23), 0.321 (2.80), 0.331 (2.62), 0.343 (2.04), 0.354 (1.52), 0.366 (1.33), 0.377 (2.16), 0.391 (2.47), 0.399 (3.23), 0.412 (2.47), 0.420 (1.42), 0.437 (1.69), 0.451 (2.74), 0.462 (3.45), 0.475 (3.28), 0.487 (2.04), 0.501 (0.69), 1.039 (1.10), 1.052 (2.31), 1.060 (2.49), 1.065 (1.86), 1.073 (4.19), 1.080 (1.76), 1.086 (2.26), 1.093 (2.00), 1.106 (0.86), 1.988 (0.67), 2.731 (3.71), 2.890 (4.90), 3.470 (0.74), 3.485 (1.00), 3.504 (7.35), 3.510 (7.51), 3.519 (7.25), 3.526 (6.94), 3.545 (0.90), 3.561 (0.78), 7.430 (7.99), 7.449 (16.00), 7.459 (6.02), 7.474 (7.51), 7.493 (2.73), 7.526 (13.32), 7.534 (5.95), 7.550 (14.84), 7.571 (14.71), 7.751 (13.08), 7.771 (10.63), 7.953 (0.54), 8.538 (2.73), 8.553 (5.64), 8.569 (2.64), 10.644 (6.47).
Example 115
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-[1-(Trifluoromethyl)Cyclopropyl][Biphenyl]-2-Carboxamide
(2664) ##STR00513##
(2665) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (37.8 mg, 184 mol) and 4-[1-(trifluoromethyl)cyclopropyl][1,1-biphenyl]-2-carboxylic acid (56.3 mg, 184 mol) dissolved in DMF (1.0 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (45.8 mg, 239 mol), 1-hydroxybenzotriazole hydrate (36.6 mg, 239 mol) and N,N-diisopropylethylamine (90 l, 510 mol). The mixture was stirred over night at room temperature. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 48.8 mg (100% purity, 58% yield) of the title compound were obtained.
(2666) LC-MS (Method 7): R.sub.t=1.87 min; MS (ESIpos): m/z=458 [M+H].sup.+
(2667) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.86), 0.094 (0.56), 0.107 (1.38), 0.118 (2.29), 0.131 (2.42), 0.142 (1.73), 0.155 (0.77), 0.275 (0.45), 0.298 (1.48), 0.310 (1.91), 0.320 (1.86), 0.332 (1.42), 0.343 (1.22), 0.358 (1.46), 0.372 (1.71), 0.380 (2.21), 0.394 (1.67), 0.402 (1.03), 0.411 (1.13), 0.424 (1.91), 0.435 (2.29), 0.448 (2.19), 0.461 (1.34), 0.473 (0.45), 1.044 (0.75), 1.058 (1.50), 1.065 (1.68), 1.078 (2.70), 1.091 (1.52), 1.098 (1.45), 1.112 (0.79), 1.157 (5.88), 1.343 (3.40), 1.354 (8.40), 1.369 (2.75), 3.454 (0.73), 3.469 (0.89), 3.489 (4.16), 3.502 (5.45), 3.515 (4.02), 3.533 (0.84), 3.549 (0.74), 3.924 (1.10), 7.374 (9.99), 7.388 (12.13), 7.395 (16.00), 7.406 (7.19), 7.416 (5.23), 7.435 (1.96), 7.469 (10.97), 7.484 (11.32), 7.488 (11.32), 7.503 (3.94), 7.507 (3.61), 7.521 (1.42), 7.525 (1.46), 8.432 (1.93), 8.447 (3.98), 8.462 (1.87), 10.640 (5.68).
Example 116
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2668) ##STR00514##
(2669) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (55.3 mg, 195 mol) dissolved in DMF (1.7 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature. Water was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (n-heptane:ethyl actetate (80:20)-ethyl acetate). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 68.0 mg (99% purity, 79% yield) of the title compound were obtained.
(2670) LC-MS (Method 7): R.sub.t=1.66 min, MS (ESIpos): m/z=436 [M+H].sup.+
(2671) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.75), 0.008 (0.79), 0.110 (0.98), 0.123 (2.31), 0.134 (4.08), 0.148 (4.36), 0.158 (3.05), 0.171 (1.37), 0.289 (0.79), 0.303 (1.38), 0.311 (2.63), 0.323 (3.29), 0.333 (3.13), 0.346 (2.45), 0.356 (1.89), 0.366 (1.65), 0.377 (2.56), 0.391 (2.91), 0.399 (3.82), 0.413 (2.92), 0.420 (1.70), 0.439 (1.79), 0.453 (3.22), 0.464 (4.11), 0.477 (3.89), 0.489 (2.40), 0.502 (0.88), 1.042 (1.37), 1.055 (2.71), 1.063 (2.92), 1.069 (2.19), 1.076 (4.97), 1.083 (2.12), 1.089 (2.70), 1.097 (2.43), 1.110 (1.05), 2.731 (0.91), 2.890 (1.16), 3.461 (1.33), 3.476 (1.66), 3.495 (7.44), 3.507 (9.79), 3.522 (7.28), 3.540 (1.54), 3.556 (1.42), 7.311 (3.82), 7.317 (12.06), 7.339 (16.00), 7.359 (4.69), 7.365 (3.13), 7.479 (5.34), 7.492 (4.97), 7.499 (5.13), 7.514 (3.87), 7.547 (15.54), 7.568 (13.20), 7.588 (15.23), 7.765 (15.84), 7.786 (13.04), 8.579 (3.33), 8.595 (6.90), 8.610 (3.29), 10.647 (8.35).
Example 117
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4,5-Bis(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2672) ##STR00515##
(2673) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4,5-bis(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (65.0 mg, 195 mol) dissolved in DMF (1.7 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred 3 hours at room temperature. Water (5 ml) was added to the reaction and the resulting precipitate was filtered off. The residue was washed with water and dried to obtain 76.0 mg (97% purity, 78% yield) of the title compound.
(2674) LC-MS (Method 7): R.sub.t=1.85 min, MS (ESIpos): m/z=486 [M+H].sup.+
(2675) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.81), 0.008 (1.06), 0.118 (0.81), 0.132 (2.03), 0.143 (3.60), 0.156 (3.85), 0.166 (2.75), 0.179 (1.28), 0.296 (0.68), 0.319 (2.30), 0.331 (2.94), 0.341 (2.79), 0.353 (2.21), 0.364 (1.70), 0.372 (1.51), 0.383 (2.30), 0.397 (2.63), 0.405 (3.44), 0.419 (2.61), 0.427 (1.51), 0.446 (1.55), 0.460 (2.84), 0.471 (3.68), 0.483 (3.50), 0.495 (2.21), 0.509 (0.81), 0.960 (0.68), 0.978 (0.43), 1.048 (1.14), 1.062 (2.36), 1.069 (2.59), 1.074 (1.97), 1.082 (4.43), 1.090 (1.97), 1.095 (2.44), 1.103 (2.21), 1.116 (0.99), 2.075 (0.68), 2.366 (0.41), 2.710 (0.43), 3.478 (1.01), 3.494 (1.10), 3.512 (6.75), 3.521 (7.58), 3.528 (7.68), 3.536 (7.45), 3.555 (1.32), 3.570 (0.99), 7.609 (11.07), 7.624 (13.83), 7.646 (16.00), 7.692 (0.41), 7.713 (0.68), 7.774 (10.78), 7.793 (14.80), 7.813 (11.76), 7.867 (5.77), 7.887 (5.01), 8.752 (3.06), 8.767 (6.44), 8.782 (3.02), 10.665 (8.47).
Example 118
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Isopropyl[Biphenyl]-2-Carboxamide
(2676) ##STR00516##
(2677) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-(propan-2-yl)[1,1-biphenyl]-2-carboxylic acid (46.7 mg, 195 mol) dissolved in DMF (1.6 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred over night at room temperature. Water was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (n-heptane:ethyl actetate (70:30).fwdarw.ethyl acetate). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 56.0 mg (99% purity, 73% yield) of the title compound were obtained.
(2678) LC-MS (Method 7): R.sub.t=1.73 min, MS (ESIpos): m/z=392 [M+H].sup.+
(2679) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.67), 0.008 (0.57), 0.102 (0.48), 0.113 (0.84), 0.126 (0.89), 0.136 (0.63), 0.291 (0.53), 0.303 (0.67), 0.313 (0.65), 0.325 (0.50), 0.335 (0.40), 0.354 (0.54), 0.369 (0.60), 0.376 (0.81), 0.391 (0.66), 0.398 (0.66), 0.412 (0.87), 0.423 (0.83), 0.436 (0.78), 0.448 (0.49), 1.039 (0.58), 1.047 (0.70), 1.060 (1.15), 1.073 (0.61), 1.080 (0.56), 1.218 (15.71), 1.235 (16.00), 2.885 (0.93), 2.903 (1.21), 2.920 (0.88), 3.478 (1.48), 3.492 (2.60), 3.508 (1.45), 7.246 (2.22), 7.267 (5.24), 7.296 (5.69), 7.317 (2.33), 7.343 (0.67), 7.359 (2.77), 7.364 (5.43), 7.383 (4.59), 7.400 (0.75), 7.458 (3.25), 7.466 (1.47), 7.484 (1.32), 7.498 (0.60), 7.502 (0.57), 8.327 (0.67), 8.342 (1.38), 8.357 (0.66), 10.629 (1.62).
Example 119
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(2,2,2-Trifluoroethyl)[Biphenyl]-2-Carboxamide
(2680) ##STR00517##
(2681) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-(2,2,2-trifluoroethyl)[1,1-biphenyl]-2-carboxylic acid (54.5 mg, 195 mol) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature. Purification was done by preparative HPLC (column: ReprosilC18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 61.5 mg (100% purity, 73% yield) of the title compound were obtained.
(2682) LC-MS (Method 7): R.sub.t=1.59 min; MS (ESIpos): m/z=432 [M+H].sup.+
(2683) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.87), 0.008 (0.92), 0.104 (0.48), 0.115 (0.85), 0.128 (0.90), 0.139 (0.64), 0.297 (0.53), 0.309 (0.67), 0.320 (0.64), 0.332 (0.50), 0.363 (0.54), 0.377 (0.59), 0.385 (0.81), 0.399 (0.63), 0.410 (0.56), 0.423 (0.79), 0.435 (0.84), 0.448 (0.79), 0.459 (0.48), 1.047 (0.57), 1.054 (0.61), 1.059 (0.44), 1.067 (1.04), 1.074 (0.43), 1.080 (0.56), 1.087 (0.50), 3.474 (1.69), 3.482 (1.80), 3.489 (1.77), 3.498 (1.64), 3.616 (0.78), 3.646 (2.25), 3.675 (2.14), 3.704 (0.68), 7.353 (0.45), 7.376 (16.00), 7.386 (2.86), 7.391 (3.13), 7.412 (2.94), 7.415 (3.17), 7.434 (0.83), 7.485 (3.38), 7.504 (1.47), 7.508 (1.41), 7.522 (0.61), 7.526 (0.56), 8.373 (0.69), 8.389 (1.47), 8.404 (0.69), 10.628 (1.99).
Example 120
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(1,1,1-Trifluoro-2-Methylpropan-2-Yl)[Biphenyl]-2-Carboxamide
(2684) ##STR00518##
(2685) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-(1,1,1-trifluoro-2-methylpropan-2-yl)[1,1-biphenyl]-2-carboxylic acid (60.0 mg, 195 mol) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred over night at room temperature. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 65.3 mg (94% purity, 69% yield) of the title compound were obtained.
(2686) LC-MS (Method 7): R.sub.t=1.79 min; MS (ESIpos): m/z=460 [M+H].sup.+
(2687) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.47), 0.118 (0.71), 0.131 (0.76), 0.141 (0.55), 0.295 (0.45), 0.308 (0.56), 0.317 (0.56), 0.330 (0.45), 0.355 (0.46), 0.369 (0.52), 0.377 (0.67), 0.391 (0.54), 0.423 (0.58), 0.434 (0.73), 0.447 (0.70), 0.459 (0.44), 1.057 (0.48), 1.065 (0.53), 1.078 (0.90), 1.091 (0.49), 1.098 (0.44), 1.577 (16.00), 3.490 (1.31), 3.500 (1.59), 3.504 (1.51), 3.515 (1.39), 7.367 (0.63), 7.370 (0.76), 7.386 (2.04), 7.391 (2.17), 7.397 (4.03), 7.399 (3.76), 7.418 (6.67), 7.434 (1.00), 7.486 (3.28), 7.490 (1.53), 7.503 (1.03), 7.508 (1.36), 7.523 (0.60), 7.527 (0.65), 7.547 (2.75), 7.568 (2.02), 8.424 (0.58), 8.440 (1.23), 8.455 (0.58), 10.649 (1.36).
Example 121
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2688) ##STR00519##
(2689) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (55.3 mg, 195 mol, CAS 537713-35-2) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred over night at room temperature. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 73.7 mg (100% purity, 87% yield) of the title compound were obtained.
(2690) LC-MS (Method 7): R.sub.t=1.65 min; MS (ESIpos): m/z=436 [M+H].sup.+
(2691) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.46), 0.118 (1.02), 0.131 (2.45), 0.142 (4.19), 0.155 (4.41), 0.166 (3.19), 0.179 (1.42), 0.294 (0.86), 0.317 (2.70), 0.329 (3.44), 0.339 (3.28), 0.351 (2.50), 0.362 (1.92), 0.371 (1.66), 0.382 (2.61), 0.396 (2.99), 0.405 (3.91), 0.418 (2.93), 0.426 (1.69), 0.440 (1.13), 0.449 (1.58), 0.463 (3.29), 0.474 (4.22), 0.486 (4.00), 0.499 (2.52), 0.512 (0.86), 1.050 (1.32), 1.064 (2.76), 1.071 (2.97), 1.084 (4.97), 1.098 (2.70), 1.105 (2.39), 1.118 (1.02), 2.366 (0.42), 3.469 (0.89), 3.484 (1.25), 3.504 (9.49), 3.508 (9.44), 3.519 (9.20), 3.524 (8.95), 3.542 (1.17), 3.559 (1.05), 3.726 (1.54), 7.253 (5.76), 7.259 (6.86), 7.275 (5.90), 7.282 (6.52), 7.383 (2.48), 7.389 (2.44), 7.404 (6.11), 7.411 (6.03), 7.425 (3.94), 7.432 (3.82), 7.477 (6.88), 7.491 (7.24), 7.499 (5.06), 7.512 (4.67), 7.527 (13.28), 7.547 (15.54), 7.592 (11.10), 7.749 (16.00), 7.770 (13.32), 8.684 (3.41), 8.700 (7.15), 8.715 (3.36), 10.678 (9.99).
Example 122
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Difluoromethyl)[Biphenyl]-2-Carboxamide
(2692) ##STR00520##
(2693) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-(difluoromethyl)[1,1-biphenyl]-2-carboxylic acid (48.3 mg, 195 mol) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 63.6 mg (100% purity, 82% yield) of the title compound were obtained.
(2694) LC-MS (Method 7): R.sub.t=1.55 min; MS (ESIpos): m/z=400 [M+H].sup.+
(2695) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.138 (0.54), 0.008 (0.64), 0.008 (0.46), 0.172 (0.41), 0.179 (0.52), 0.187 (0.46), 0.252 (0.41), 0.258 (0.58), 0.267 (0.45), 0.308 (0.50), 0.316 (0.64), 0.324 (0.61), 0.332 (0.40), 0.912 (0.42), 0.917 (0.46), 0.926 (0.78), 0.935 (0.42), 2.360 (3.47), 2.363 (4.87), 2.366 (3.63), 2.402 (16.00), 3.355 (1.28), 3.363 (1.50), 3.365 (1.50), 3.373 (1.25), 6.828 (0.77), 6.921 (1.58), 7.014 (0.68), 7.273 (1.71), 7.286 (2.65), 7.298 (0.82), 7.300 (0.86), 7.310 (1.25), 7.312 (1.15), 7.323 (0.51), 7.325 (0.54), 7.346 (2.01), 7.359 (2.56), 7.377 (1.84), 7.381 (1.07), 7.391 (1.14), 7.394 (1.06), 7.404 (0.46), 7.406 (0.50), 7.448 (2.24), 7.461 (1.76), 8.334 (0.55), 8.344 (1.12), 8.354 (0.55), 10.508 (1.49).
Example 123
4-(2-Cyanopropan-2-Yl)-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2696) ##STR00521##
(2697) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-(2-cyanopropan-2-yl)[1,1-biphenyl]-2-carboxylic acid (51.6 mg, 195 mol) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 89.8 mg (100% purity, 111% yield) of the title compound were obtained.
(2698) LC-MS (Method 7): R.sub.t=1.47 min; MS (ESIpos): m/z=417 [M+H].sup.+
(2699) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.87), 0.008 (0.81), 0.112 (0.42), 0.123 (0.77), 0.136 (0.81), 0.146 (0.66), 0.302 (0.48), 0.314 (0.60), 0.325 (0.57), 0.337 (0.45), 0.365 (0.49), 0.379 (0.54), 0.387 (0.71), 0.401 (0.55), 0.430 (0.61), 0.441 (0.75), 0.454 (0.71), 0.465 (0.42), 1.057 (0.51), 1.065 (0.55), 1.078 (0.94), 1.091 (0.49), 1.098 (0.44), 1.714 (16.00), 1.716 (15.64), 3.497 (1.57), 3.503 (1.60), 3.512 (1.56), 3.519 (1.51), 7.373 (0.62), 7.377 (0.78), 7.392 (3.87), 7.403 (1.52), 7.411 (2.40), 7.419 (3.86), 7.423 (2.31), 7.435 (1.55), 7.439 (5.27), 7.491 (2.66), 7.495 (3.07), 7.508 (1.53), 7.513 (1.35), 7.528 (5.04), 7.544 (1.24), 7.549 (3.11), 8.430 (0.63), 8.445 (1.36), 8.461 (0.63), 10.644 (1.79).
Example 124
4-Tert-Butyl-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro[Biphenyl]-2-Carboxamide
(2700) ##STR00522##
(2701) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-tert-butyl-5-fluoro[1,1-biphenyl]-2-carboxylic acid (53.0 mg, 195 mol, CAS 926200-09-1) dissolved in DMF (1.7 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was for 2.5 hours at room temperature. Water was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (n-heptane:ethyl actetate (80:20).fwdarw.n-heptane:ethyl acetate (20:80)). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 47.0 mg (99% purity, 56% yield) of the title compound were obtained.
(2702) LC-MS (Method 7): R.sub.t=1.88 min, MS (ESIpos): m/z=424 [M+H].sup.+
(2703) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.072 (0.40), 1.304 (16.00), 3.481 (0.55), 3.491 (0.52), 3.500 (0.52), 3.511 (0.52), 7.222 (0.62), 7.240 (0.81), 7.330 (1.24), 7.344 (1.61), 7.386 (0.48), 7.396 (0.51), 7.400 (0.48), 7.410 (0.51), 7.417 (1.68), 7.431 (1.17), 7.498 (1.11), 8.432 (0.59), 10.650 (0.55).
Example 125
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(1,1-Difluoroethyl)[Biphenyl]-2-Carboxamide
(2704) ##STR00523##
(2705) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (34.5 mg, 168 mol) and 4-(1,1-difluoroethyl)[1,1-biphenyl]-2-carboxylic acid (44.0 mg, 168 mol) dissolved in DMF (1.0 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (41.8 mg, 218 mol), 1-hydroxybenzotriazole hydrate (33.4 mg, 218 mol) and N,N-diisopropylethylamine (82 l, 470 mol). The mixture was stirred overnight at room temperature. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 45.1 mg (100% purity, 65% yield) of the title compound were obtained.
(2706) LC-MS (Method 7): R.sub.t=1.66 min; MS (ESIneg): m/z=412 [MH].sup.
(2707) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.70), 0.102 (0.44), 0.116 (1.13), 0.126 (1.95), 0.140 (2.08), 0.150 (1.51), 0.163 (0.67), 0.304 (1.26), 0.316 (1.61), 0.326 (1.53), 0.338 (1.16), 0.349 (0.87), 0.361 (0.72), 0.372 (1.21), 0.385 (1.40), 0.394 (1.85), 0.408 (1.42), 0.415 (0.90), 0.424 (0.93), 0.438 (1.63), 0.449 (1.95), 0.462 (1.86), 0.474 (1.17), 1.035 (0.61), 1.048 (1.26), 1.055 (1.40), 1.069 (2.34), 1.082 (1.28), 1.089 (1.14), 1.102 (0.51), 1.951 (8.14), 1.998 (16.00), 2.045 (7.18), 3.462 (0.41), 3.476 (0.56), 3.496 (4.23), 3.501 (4.32), 3.511 (4.21), 3.517 (4.06), 3.535 (0.53), 3.552 (0.43), 4.103 (0.65), 7.405 (3.81), 7.414 (5.34), 7.418 (5.91), 7.424 (7.90), 7.442 (4.13), 7.456 (6.60), 7.477 (8.48), 7.506 (7.79), 7.524 (3.37), 7.543 (1.25), 7.546 (1.22), 7.575 (8.29), 7.596 (5.96), 8.461 (1.62), 8.476 (3.42), 8.491 (1.60), 10.642 (4.76).
Example 126
4-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro[Biphenyl]-2-Carboxamide
(2708) ##STR00524##
(2709) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-chloro-5-fluoro[1,1-biphenyl]-2-carboxylic acid (48.8 mg, 195 mol, CAS 1179253-24-7) dissolved in DMF (1.7 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred 2.5 hours at room temperature. Water (4 ml) was added to the reaction and the resulting precipitate was filtered off. The residue was washed with water and dried to obtain 37.0 mg (97% purity, 46% yield) of the title compound.
(2710) LC-MS (Method 8): R.sub.t=0.88 min, MS (ESIpos): m/z=402 [M+H].sup.+
(2711) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.117 (1.08), 0.125 (2.35), 0.133 (3.50), 0.142 (3.58), 0.149 (2.61), 0.158 (1.11), 0.306 (0.88), 0.321 (2.56), 0.329 (3.17), 0.336 (2.85), 0.351 (1.28), 0.384 (1.24), 0.392 (2.21), 0.400 (2.67), 0.406 (3.37), 0.415 (2.54), 0.430 (0.94), 0.449 (1.33), 0.457 (2.88), 0.465 (3.58), 0.474 (3.38), 0.482 (2.28), 1.053 (1.16), 1.062 (2.35), 1.067 (2.67), 1.075 (3.96), 1.084 (2.41), 1.089 (2.07), 1.098 (0.92), 2.731 (1.32), 2.890 (1.44), 3.465 (1.80), 3.475 (2.09), 3.488 (5.57), 3.498 (5.57), 3.505 (5.58), 3.515 (5.27), 3.528 (1.81), 3.538 (1.68), 7.253 (4.12), 7.257 (5.37), 7.273 (7.38), 7.287 (5.11), 7.292 (4.29), 7.302 (3.01), 7.306 (2.54), 7.377 (11.89), 7.391 (15.75), 7.431 (4.54), 7.441 (5.08), 7.445 (4.79), 7.455 (4.68), 7.464 (16.00), 7.478 (11.59), 7.542 (11.06), 8.509 (3.11), 8.520 (5.77), 8.530 (2.92), 10.649 (5.30).
Example 127
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Difluoromethoxy)[Biphenyl]-2-Carboxamide
(2712) ##STR00525##
(2713) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-(difluoromethoxy)[1,1-biphenyl]-2-carboxylic acid (51.4 mg, 195 mol) dissolved in DMF (1.6 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature. Water (5 ml) was added to the reaction and the resulting precipitate was filtered off. The residue was washed with water and dried to obtain 69.0 mg (99% purity, 85% yield) of the title compound.
(2714) LC-MS (Method 7): R.sub.t=1.48 min, MS (ESIpos): m/z=416 [M+H].sup.+
(2715) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.104 (0.78), 0.114 (1.84), 0.123 (2.75), 0.134 (2.82), 0.142 (2.10), 0.153 (0.90), 0.294 (0.67), 0.312 (1.94), 0.322 (2.41), 0.330 (2.22), 0.349 (1.08), 0.376 (0.97), 0.385 (1.75), 0.396 (2.08), 0.403 (2.67), 0.413 (2.04), 0.432 (1.56), 0.444 (2.28), 0.453 (2.79), 0.463 (2.64), 0.472 (1.74), 1.049 (0.91), 1.060 (1.87), 1.066 (2.09), 1.076 (3.20), 1.086 (1.91), 1.092 (1.64), 1.102 (0.73), 2.074 (2.25), 3.462 (0.99), 3.474 (1.23), 3.490 (4.98), 3.501 (7.72), 3.512 (4.69), 3.527 (1.05), 3.540 (0.95), 7.121 (3.62), 7.189 (9.86), 7.207 (11.31), 7.269 (7.29), 7.375 (6.24), 7.390 (10.46), 7.396 (15.01), 7.413 (16.00), 7.429 (2.56), 7.487 (3.42), 7.489 (3.51), 7.504 (5.45), 7.514 (8.42), 8.441 (2.43), 8.454 (4.69), 8.466 (2.32), 10.648 (6.81).
Example 128
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4,5-Difluoro[Biphenyl]-2-Carboxamide
(2716) ##STR00526##
(2717) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4,5-difluoro[1,1-biphenyl]-2-carboxylic acid (45.6 mg, 195 mol) dissolved in DMF (1.7 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was for 2 hours at room temperature. Water was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (n-heptane:ethyl actetate (70:30).fwdarw.ethyl acetate). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 63.0 mg (99% purity, 83% yield) of the title compound were obtained.
(2718) LC-MS (Method 7): R.sub.t=1.43 min, MS (ESIpos): m/z=386 [M+H].sup.+
(2719) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.68), 0.008 (2.50), 0.101 (0.57), 0.114 (1.37), 0.125 (2.41), 0.138 (2.59), 0.148 (1.83), 0.162 (0.83), 0.288 (0.49), 0.311 (1.52), 0.323 (1.92), 0.334 (1.80), 0.345 (1.40), 0.356 (1.09), 0.369 (0.89), 0.380 (1.50), 0.394 (1.68), 0.402 (2.29), 0.415 (1.80), 0.428 (1.31), 0.442 (2.09), 0.453 (2.40), 0.466 (2.26), 0.479 (1.40), 0.492 (0.51), 1.041 (0.79), 1.054 (1.64), 1.061 (1.74), 1.067 (1.33), 1.075 (3.01), 1.088 (1.59), 1.095 (1.43), 1.108 (0.63), 1.141 (2.01), 2.072 (0.74), 2.117 (0.82), 2.327 (0.63), 2.366 (0.49), 2.523 (2.56), 2.665 (0.52), 2.669 (0.67), 2.709 (0.46), 3.443 (0.64), 3.458 (0.83), 3.478 (4.78), 3.486 (5.11), 3.492 (4.99), 3.501 (4.56), 3.519 (0.76), 3.536 (0.69), 6.942 (0.97), 7.070 (1.04), 7.198 (1.12), 7.211 (5.65), 7.216 (2.18), 7.228 (5.62), 7.234 (16.00), 7.246 (3.64), 7.256 (9.09), 7.259 (6.21), 7.267 (5.48), 7.274 (3.40), 7.289 (2.79), 7.295 (2.13), 7.391 (7.02), 7.397 (3.29), 7.405 (11.40), 7.413 (6.91), 7.421 (6.23), 7.427 (8.83), 7.441 (3.26), 7.515 (6.15), 8.445 (1.91), 8.461 (4.01), 8.476 (1.88), 10.632 (5.38).
Example 129
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Fluoro[Biphenyl]-2-Carboxamide
(2720) ##STR00527##
(2721) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-fluoro[1,1-biphenyl]-2-carboxylic acid (42.1 mg, 195 mol) dissolved in DMF (1.6 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred over night at room temperature. Water was added and the mixture was extracted with ethyl acetate. The combined organic layers were dried, filtered and evaporated and the residue was purified by flash-column chromatography (n-heptane:ethyl actetate (80:20).fwdarw.ethyl acetate). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 59.0 mg (99% purity, 82% yield) of the title compound were obtained.
(2722) LC-MS (Method 7): R.sub.t=1.36 min, MS (ESIpos): m/z=368 [M+H].sup.+
(2723) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.25), 0.100 (0.60), 0.113 (1.44), 0.124 (2.45), 0.137 (2.58), 0.148 (2.03), 0.161 (0.80), 0.285 (0.50), 0.308 (1.60), 0.319 (2.02), 0.330 (1.90), 0.342 (1.41), 0.352 (1.05), 0.368 (0.90), 0.379 (1.57), 0.390 (1.72), 0.401 (2.38), 0.415 (1.83), 0.425 (1.71), 0.438 (2.45), 0.450 (2.43), 0.463 (2.29), 0.475 (1.43), 0.488 (0.45), 1.036 (0.80), 1.049 (1.65), 1.057 (1.78), 1.062 (1.38), 1.070 (2.89), 1.083 (1.60), 1.090 (1.39), 1.103 (0.60), 2.072 (0.62), 2.731 (2.45), 2.890 (3.07), 3.449 (0.43), 3.464 (0.64), 3.484 (5.84), 3.488 (5.74), 3.499 (5.58), 3.504 (5.36), 3.522 (0.58), 3.538 (0.50), 7.195 (4.55), 7.217 (9.95), 7.239 (5.81), 7.367 (11.95), 7.381 (14.34), 7.386 (16.00), 7.403 (5.64), 7.409 (5.80), 7.427 (1.93), 7.477 (3.48), 7.481 (3.64), 7.491 (9.80), 7.514 (1.67), 7.517 (1.59), 8.395 (1.92), 8.410 (3.99), 8.426 (1.91), 10.625 (4.72).
Example 130
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Methoxy[Biphenyl]-2-Carboxamide
(2724) ##STR00528##
(2725) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 4-methoxy[1,1-biphenyl]-2-carboxylic acid (44.4 mg, 195 mol, CAS 18110-71-9) dissolved in DMF (1.0 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature.
(2726) Water (5 ml) was added to the reaction and the resulting precipitate was filtered off. The residue was washed with water and dried to obtain 54.7 mg (100% purity, 74% yield) of the title compound.
(2727) LC-MS (Method 7): R.sub.t=1.34 min, MS (ESIpos): m/z=380 [M+H].sup.+
(2728) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.107 (0.59), 0.118 (0.97), 0.130 (0.98), 0.142 (0.77), 0.312 (0.82), 0.324 (0.81), 0.345 (0.42), 0.376 (0.63), 0.397 (0.98), 0.412 (1.03), 0.426 (0.98), 0.438 (1.02), 0.450 (0.89), 0.463 (0.59), 1.040 (0.64), 1.061 (1.08), 1.073 (0.69), 3.477 (1.64), 3.491 (2.69), 3.505 (1.62), 3.776 (16.00), 6.943 (3.73), 6.965 (4.23), 7.290 (4.30), 7.312 (3.83), 7.343 (6.24), 7.361 (4.21), 7.377 (0.75), 7.446 (1.15), 7.452 (1.20), 7.469 (3.92), 8.290 (0.75), 8.306 (1.53), 8.321 (0.76), 10.627 (2.30).
Example 131
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2729) ##STR00529##
(2730) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and [1,1-biphenyl]-2-carboxylic acid (38.6 mg, 195 mol, CAS 947-84-2) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred overnight at room temperature. Purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 54.5 mg (100% purity, 80% yield) of the title compound were obtained.
(2731) LC-MS (Method 7): R.sub.t=1.31 min; MS (ESIpos): m/z=350 [M+H].sup.+
(2732) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.100 (0.44), 0.109 (0.92), 0.116 (1.47), 0.125 (1.47), 0.133 (1.03), 0.141 (0.48), 0.298 (0.59), 0.303 (0.99), 0.311 (1.21), 0.319 (1.07), 0.326 (0.77), 0.334 (0.51), 0.371 (0.51), 0.379 (0.92), 0.388 (0.99), 0.393 (1.40), 0.403 (1.10), 0.408 (0.70), 0.417 (0.96), 0.426 (1.21), 0.433 (1.43), 0.442 (1.36), 0.450 (0.92), 1.034 (0.51), 1.043 (1.03), 1.048 (1.07), 1.057 (1.80), 1.062 (0.74), 1.065 (0.96), 1.070 (0.85), 2.071 (0.63), 3.288 (0.44), 3.292 (0.48), 3.322 (1.69), 3.328 (2.46), 3.380 (0.51), 3.382 (0.81), 3.388 (0.51), 3.449 (0.59), 3.459 (0.74), 3.472 (2.91), 3.481 (4.08), 3.491 (2.72), 3.503 (0.55), 3.514 (0.51), 7.304 (0.59), 7.307 (1.03), 7.311 (0.77), 7.318 (2.43), 7.326 (0.96), 7.329 (1.62), 7.332 (1.18), 7.367 (3.46), 7.369 (3.20), 7.375 (9.86), 7.379 (16.00), 7.391 (7.50), 7.407 (3.16), 7.420 (1.29), 7.477 (5.15), 7.488 (1.91), 7.490 (1.80), 7.500 (2.65), 7.503 (2.43), 7.513 (1.10), 7.515 (1.07), 8.345 (1.29), 8.356 (2.46), 8.366 (1.18), 10.637 (2.28).
Example 132
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-(4-Methylphenyl)Nicotinamide
(2733) ##STR00530##
(2734) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (40.0 mg, 195 mol) and 2-(4-methylphenyl)pyridine-3-carboxylic acid (41.5 mg, 195 mol, CAS 1226205-68-0) dissolved in DMF (1000 l) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.5 mg, 253 mol), 1-hydroxybenzotriazole hydrate (38.7 mg, 253 mol) and N,N-diisopropylethylamine (95 l, 540 mol). The mixture was stirred over night at room temperature. Water was added to the mixture an purification was done by preparative HPLC (column: Reprosil C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 34.0 mg (100% purity, 48% yield) of the title compound were obtained.
(2735) LC-MS (Method 7): R.sub.t=1.06 min; MS (ESIpos): m/z=365 [M+H].sup.+
(2736) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.43), 0.123 (0.71), 0.133 (1.24), 0.146 (1.36), 0.157 (0.92), 0.171 (0.43), 0.321 (0.77), 0.334 (0.99), 0.345 (0.92), 0.356 (0.72), 0.366 (0.54), 0.382 (0.45), 0.393 (0.79), 0.408 (0.86), 0.415 (1.19), 0.429 (0.92), 0.438 (0.89), 0.452 (1.25), 0.464 (1.22), 0.476 (1.15), 0.488 (0.72), 1.066 (0.41), 1.079 (0.85), 1.087 (0.90), 1.100 (1.53), 1.113 (0.82), 1.120 (0.74), 2.340 (16.00), 3.534 (4.41), 3.550 (4.48), 7.223 (4.41), 7.243 (5.00), 7.390 (2.35), 7.402 (2.39), 7.410 (2.58), 7.421 (2.65), 7.524 (6.45), 7.544 (5.59), 7.559 (3.29), 7.692 (2.77), 7.697 (2.91), 7.711 (2.51), 7.716 (2.39), 8.617 (1.02), 8.633 (2.15), 8.648 (1.03), 8.668 (2.74), 8.672 (2.81), 8.680 (2.75), 8.684 (2.50), 10.632 (2.86).
Example 133
Ent-6-Methyl-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(2737) ##STR00531##
(2738) ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione-hydrogen chloride (40.0 mg, 163 mol) and 6-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (45.6 mg, 163 mol) dissolved in DMF (1.0 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (40.6 mg, 212 mol) 1-hydroxybenzotriazole hydrate (32.4 mg, 212 mol) and N,N-diisopropylethylamine (79 l, 460 mol) The mixture was stirred over night at room temperature. Water was added and the mixture was evaporated. The residue was purified by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 66.2 mg (100% purity, 86% yield) of the title compound were obtained.
(2739) LC-MS (Method 7): R.sub.t=1.48 min; MS (ESIpos): m/z=472 [M+H].sup.+
(2740) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.049 (16.00), 3.902 (4.80), 3.913 (4.73), 3.936 (0.52), 4.099 (0.68), 7.218 (3.23), 7.230 (3.46), 7.358 (1.50), 7.370 (3.36), 7.383 (3.95), 7.398 (2.76), 7.414 (3.20), 7.427 (1.92), 7.451 (2.80), 7.726 (3.47), 7.739 (3.19), 8.308 (3.63), 8.476 (0.91), 8.485 (1.70), 8.495 (0.89), 11.414 (2.38).
Example 134
Ent-4,6-Dimethyl-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazoidin-4-Yl]Methyl}[1,1-Biphenyl]-2-Carboxamide
(2741) ##STR00532##
(2742) ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione-hydrogen chloride (40.0 mg, 163 mol) and 4,6-dimethyl[1,1-biphenyl]-2-carboxylic acid (36.8 mg, 163 mol) dissolved in DMF (1.0 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (40.6 mg, 212 mol) 1-hydroxybenzotriazole hydrate (32.4 mg, 212 mol) and N,N-diisopropylethylamine (79 l, 460 mol) The mixture was stirred over night at room temperature. Water was added and the mixture was evaporated. The residue was purified by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 65.2 mg (100% purity, 96% yield) of the title compound were obtained.
(2743) LC-MS (Method 7): R.sub.t=1.37 min; MS (ESIpos): m/z=418 [M+H].sup.+
(2744) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.043 (16.00), 2.337 (15.94), 3.837 (0.82), 3.847 (0.91), 3.860 (2.05), 3.870 (1.85), 3.885 (1.87), 3.896 (1.95), 3.908 (0.86), 3.919 (0.83), 7.037 (2.10), 7.049 (2.38), 7.115 (2.22), 7.128 (2.54), 7.156 (4.92), 7.169 (3.97), 7.276 (1.76), 7.289 (4.68), 7.302 (2.27), 7.348 (2.75), 7.361 (1.89), 7.503 (2.50), 8.259 (3.14), 8.291 (0.85), 8.301 (1.48), 8.311 (0.80), 11.441 (2.16).
Example 135
4-(2,2-Difluorocyclopropyl)-5-Methyl-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[1,1-Biphenyl]-2-Carboxamide (Mixture of Diastereoisomers)
(2745) ##STR00533##
(2746) ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (40.0 mg, 163 mol) and rac-4-(2,2-difluorocyclopropyl)-5-methyl[1,1-biphenyl]-2-carboxylic acid (46.9 mg, 163 mol) dissolved in DMF (1.0 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (40.6 mg, 212 mol) 1-hydroxybenzotriazole hydrate (32.4 mg, 212 mol) and N,N-diisopropylethylamine (79 l, 460 mol) The mixture was stirred over night at room temperature. Water was added to the mixture and purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 69.8 mg (100% purity, 89% yield) of the title compound were obtained.
(2747) LC-MS (Method 7): R.sub.t=1.52 min; MS (ESIpos): m/z=480 [M+H].sup.+
(2748) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.930 (0.64), 1.937 (0.76), 1.944 (0.67), 1.951 (0.90), 1.957 (0.63), 1.966 (0.47), 1.972 (0.72), 1.982 (0.48), 1.985 (0.42), 1.993 (0.82), 2.002 (0.82), 2.014 (0.75), 2.022 (0.46), 2.369 (16.00), 2.994 (0.50), 3.014 (0.98), 3.028 (0.94), 3.048 (0.45), 3.759 (6.48), 3.762 (6.39), 3.972 (1.64), 3.977 (1.70), 3.981 (1.77), 3.987 (1.75), 3.995 (2.05), 4.000 (2.15), 4.005 (2.01), 4.010 (1.92), 4.061 (2.03), 4.070 (2.04), 4.072 (2.01), 4.082 (1.55), 4.084 (1.56), 4.093 (1.46), 4.095 (1.45), 7.203 (4.49), 7.221 (2.67), 7.255 (5.07), 7.268 (4.52), 7.282 (14.11), 7.288 (6.58), 7.297 (1.03), 7.302 (0.92), 7.488 (2.07), 8.362 (3.04), 8.452 (0.81), 8.462 (1.50), 8.472 (0.80), 11.438 (1.62).
Example 136
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(2,2-Difluorocyclopropyl)-5-Methyl[1,1-Biphenyl]-2-Carboxamide (Mixture of Diastereoisomers)
(2749) ##STR00534##
(2750) (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione-hydrogen chloride (33.5 mg, 163 mol) and rac-4-(2,2-difluorocyclopropyl)-5-methyl[1,1-biphenyl]-2-carboxylic acid (47.0 mg, 163 mol) dissolved in DMF (1.0 ml) were treated with 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (40.6 mg, 212 mol) 1-hydroxybenzotriazole hydrate (32.5 mg, 212 mol) and N,N-diisopropylethylamine (79 l, 460 mol) The mixture was stirred over night at room temperature. Water was added to the mixture and purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 69.3 mg (100% purity, 97% yield) of the title compound were obtained.
(2751) LC-MS (Method 7): R.sub.t=1.71 min; MS (ESIpos): m/z=440 [M+H].sup.+
(2752) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.924 (0.58), 2.238 (5.88), 2.368 (2.82), 2.371 (5.86), 2.374 (8.03), 2.377 (5.81), 2.380 (2.74), 2.413 (16.00), 3.358 (0.91), 3.368 (0.96), 3.378 (0.61), 3.391 (0.42), 7.068 (1.66), 7.084 (0.84), 7.141 (1.35), 7.155 (3.22), 7.166 (0.83), 7.190 (2.84), 7.203 (1.52), 7.307 (1.20), 8.078 (0.41), 8.088 (0.80), 10.484 (0.85).
Example 137
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(2,2-Difluorocyclopropyl)-5-Methyl[1,1-Biphenyl]-2-Carboxamide (Enantiomer 1)
(2753) ##STR00535##
(2754) Separation of diastereoisomers of N-{[(4R)-4-cyclopropyl-2,5-dioxoimidazolidin-4-yl]methyl}-4-(2,2-difluorocyclopropyl)-5-methyl[1,1-biphenyl]-2-carboxamide (mixture of diastereoisomers) was done using the following chiral HPLC method: Column: Daicel Chiralpak OJ-H 25025 mm Solvent: 90% CO.sub.2: 10% methanol Flow: 80 ml/min Column temperature: 40 C. UV: 210 nm
(2755) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 22.80 mg (31% yield) of the title compound were obtained.
(2756) LC-MS (Method 7): R.sub.t=1.69 min; MS (ESIpos): m/z=440 [M+H].sup.+
(2757) Chiral HPLC (Column: Daicel OJ-3-10, 220 nm, solvent: 90% CO.sub.2: 10% methanol): R.sub.t=1.249 min, 100% de
(2758) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.236 (1.50), 2.369 (1.91), 2.372 (2.57), 2.375 (1.89), 2.411 (4.35), 3.177 (16.00), 7.065 (0.42), 7.151 (0.71), 7.187 (0.69).
Example 138
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(2,2-Difluorocyclopropyl)-5-Methyl[1,1-Biphenyl]-2-Carboxamide (Enantiomer 2)
(2759) ##STR00536##
(2760) Separation of diastereoisomers of N-{[(4R)-4-cyclopropyl-2,5-dioxoimidazolidin-4-yl]methyl}-4-(2,2-difluorocyclopropyl)-5-methyl[1,1-biphenyl]-2-carboxamide (mixture of diastereoisomers) was done using the following chiral HPLC method: Column: Daicel Chiralpak OJ-H 25025 mm Solvent: 90% CO.sub.2: 10% methanol Flow: 80 ml/min Column temperature: 40 C. UV: 210 nm
(2761) Product containing samples were united, the solvents were evaporated and the residue was lyophilized. 21.6 mg (30% yield) of the title compound were obtained.
(2762) LC-MS (method 7): R.sub.t=1.69 min; MS (ESIpos): m/z=440 [M+H].sup.+
(2763) Chiral HPLC (Column: Daicel OJ-3-10, 220 nm, solvent: 90% CO.sub.2: 10% methanol): R.sub.t=1.604 min, 99.5% de
(2764) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.240 (2.07), 2.372 (3.02), 2.375 (3.99), 2.378 (2.95), 2.415 (5.53), 3.185 (16.00), 7.069 (0.64), 7.142 (0.48), 7.155 (1.24), 7.191 (0.93), 7.204 (0.51), 7.309 (0.46), 10.482 (0.40).
Example 139
4-(2,2-Difluorocyclopropyl)-4-Fluoro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[1,1-Biphenyl]-2-Carboxamide (Mixture of Diastereoisomers)
(2765) ##STR00537##
(2766) 4-(2,2-difluorocyclopropyl)-4-fluoro[1,1-biphenyl]-2-carboxylic acid (46.5 mg, 159 mol) dissolved in DMF (1.0 ml) were treated with ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (39.1 mg, 159 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (39.7 mg, 207 mol) 1-hydroxybenzotriazole hydrate (31.7 mg, 207 mol) and N,N-diisopropylethylamine (78 l, 450 mol) The mixture was stirred over night at room temperature. Water was added to the mixture and purification was done by preparative HPLC HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 74.8 mg (100% purity, 97% yield) of the title compound were obtained.
(2767) LC-MS (Method 7): R.sub.t=1.48 min; MS (ESIpos): m/z=484 [M+H].sup.+
(2768) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.933 (0.68), 1.940 (0.76), 1.947 (0.66), 1.955 (0.88), 1.962 (0.61), 1.969 (0.47), 1.974 (0.62), 1.983 (0.42), 1.995 (0.72), 2.004 (0.71), 2.016 (0.64), 2.996 (0.50), 3.010 (0.57), 3.017 (0.90), 3.031 (0.87), 3.037 (0.55), 3.052 (0.46), 3.997 (1.21), 4.001 (1.22), 4.007 (1.32), 4.012 (1.30), 4.020 (1.82), 4.024 (1.90), 4.030 (1.81), 4.035 (1.77), 4.054 (1.88), 4.058 (1.92), 4.065 (2.00), 4.069 (1.94), 4.077 (1.45), 4.081 (1.47), 4.088 (1.41), 4.092 (1.43), 7.149 (1.69), 7.153 (1.94), 7.164 (1.70), 7.168 (1.80), 7.257 (1.15), 7.281 (0.81), 7.295 (16.00), 7.298 (8.12), 7.308 (0.57), 7.313 (0.58), 7.354 (0.77), 7.358 (0.79), 7.368 (1.75), 7.372 (1.84), 7.382 (1.08), 7.386 (1.09), 7.430 (1.93), 7.439 (1.99), 7.444 (1.46), 7.453 (1.37), 7.481 (2.11), 8.446 (2.85), 8.730 (0.72), 8.740 (1.40), 8.749 (0.72), 11.464 (1.61).
Example 140
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(2,2-Difluorocyclopropyl)-4-Fluoro[1,1-Biphenyl]-2-Carboxamide (Mixture of Diastereoisomers)
(2769) ##STR00538##
(2770) 4-(2,2-difluorocyclopropyl)-4-fluoro[1,1-biphenyl]-2-carboxylic acid (46.5 mg, 159 mol) dissolved in DMF (1.0 ml) were treated with (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione-hydrogen chloride (32.7 mg, 159 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (39.7 mg, 207 mol) 1-hydroxybenzotriazole hydrate (31.7 mg, 207 mol) and N,N-diisopropylethylamine (78 l, 450 mol) The mixture was stirred over night at room temperature. Water was added to the mixture and purification was done by preparative HPLC HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 70.4 mg (100% purity, 100% yield) of the title compound were obtained.
(2771) LC-MS (Method 7): R.sub.t=1.63 min; MS (ESIpos): m/z=444 [M+H].sup.+
(2772) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.007 (0.52), 0.009 (0.40), 0.171 (0.44), 0.178 (0.55), 0.186 (0.48), 0.249 (0.42), 0.256 (0.48), 0.298 (0.42), 0.307 (0.53), 0.314 (0.49), 0.918 (0.47), 0.923 (0.51), 0.932 (0.87), 0.940 (0.46), 0.945 (0.42), 1.782 (0.42), 1.797 (0.48), 1.843 (0.42), 1.851 (0.40), 2.351 (3.02), 2.353 (6.25), 2.356 (8.64), 2.360 (6.23), 2.363 (2.94), 2.396 (16.00), 2.857 (0.52), 2.871 (0.51), 3.347 (3.11), 3.357 (1.34), 3.370 (0.56), 3.380 (0.41), 7.024 (0.55), 7.028 (0.85), 7.031 (0.65), 7.039 (0.59), 7.043 (0.82), 7.046 (0.59), 7.134 (1.72), 7.148 (3.72), 7.170 (4.44), 7.184 (2.35), 7.189 (0.63), 7.199 (1.02), 7.203 (1.05), 7.213 (0.60), 7.217 (0.61), 7.272 (1.10), 7.281 (1.15), 7.286 (0.89), 7.295 (0.81), 7.385 (1.76), 8.368 (0.60), 8.379 (1.22), 8.389 (0.58), 10.502 (1.23).
Example 141
4-(2,2-Difluorocyclopropyl)-5-Fluoro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[1,1-Biphenyl]-2-Carboxamide (Mixture of Diastereoisomers)
(2773) ##STR00539##
(2774) 4-(2,2-difluorocyclopropyl)-5-fluoro[1,1-biphenyl]-2-carboxylic acid (41.0 mg, 140 mol) dissolved in DMF (1.0 ml) were treated with ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione-hydrogen chloride (34.5 mg, 140 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (35.0 mg, 182 mol) 1-hydroxybenzotriazole hydrate (27.9 mg, 182 mol) and N,N-diisopropylethylamine (68 l, 390 mol) The mixture was stirred over night at room temperature. Water was added to the mixture and purification was done by preparative HPLC HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 62.1 mg (98% purity, 92% yield) of the title compound were obtained.
(2775) LC-MS (Method 7): R.sub.t=1.47 min; MS (ESIpos): m/z=484 [M+H].sup.+
(2776) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.934 (0.55), 1.941 (0.63), 1.947 (1.57), 1.954 (1.81), 1.962 (1.64), 1.969 (2.25), 1.976 (1.69), 1.983 (1.76), 1.990 (1.85), 2.002 (1.83), 2.011 (1.90), 2.023 (1.64), 2.031 (1.13), 2.045 (0.62), 2.084 (0.46), 2.384 (0.42), 2.423 (0.60), 2.466 (0.42), 2.518 (2.94), 2.571 (1.13), 2.577 (0.53), 2.652 (0.56), 3.008 (1.16), 3.028 (2.20), 3.042 (2.11), 3.048 (1.51), 3.063 (1.21), 3.727 (15.67), 3.730 (16.00), 3.820 (4.22), 3.985 (2.89), 3.989 (2.90), 3.995 (3.01), 3.999 (2.90), 4.008 (3.78), 4.012 (3.96), 4.018 (3.66), 4.022 (3.56), 4.054 (3.29), 4.058 (3.41), 4.065 (3.54), 4.069 (3.47), 4.077 (2.38), 4.081 (2.45), 4.088 (2.20), 4.092 (2.25), 7.219 (2.39), 7.244 (3.70), 7.249 (5.65), 7.262 (4.89), 7.265 (6.48), 7.276 (4.63), 7.281 (3.75), 7.291 (2.71), 7.295 (2.66), 7.300 (6.92), 7.314 (14.52), 7.335 (10.42), 7.339 (11.23), 7.343 (3.87), 7.345 (3.06), 7.349 (5.25), 7.353 (5.21), 7.388 (4.52), 7.397 (4.72), 7.402 (4.31), 7.411 (3.91), 7.457 (4.29), 8.389 (6.76), 8.590 (1.58), 8.600 (3.03), 8.609 (1.78), 11.421 (3.50).
Example 142
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(2,2-Difluorocyclopropyl)-5-Fluoro[1,1-Biphenyl]-2-Carboxamide (Mixture of Diastereoisomers)
(2777) ##STR00540##
(2778) 4-(2,2-difluorocyclopropyl)-5-fluoro[1,1-biphenyl]-2-carboxylic acid (41.0 mg, 140 mol) dissolved in DMF (1.0 ml) were treated with (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione-hydrogen chloride (28.8 mg, 140 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (35.0 mg, 182 mol) 1-hydroxybenzotriazole hydrate (27.9 mg, 182 mol) and N,N-diisopropylethylamine (68 l, 390 mol) The mixture was stirred over night at room temperature. Water was added to the mixture and purification was done by preparative HPLC HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 61.6 mg (100% purity, 99% yield) of the title compound were obtained.
(2779) LC-MS (Method 7): R.sub.t=1.63 min; MS (ESIpos): m/z=444 [M+H].sup.+
(2780) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.932 (0.60), 2.359 (2.72), 2.362 (5.77), 2.365 (8.01), 2.368 (5.81), 2.371 (2.69), 2.404 (16.00), 3.311 (0.65), 3.315 (0.52), 3.321 (0.49), 3.333 (0.61), 3.338 (0.65), 3.344 (0.60), 3.348 (0.93), 3.358 (0.74), 3.368 (0.46), 7.093 (0.53), 7.097 (0.86), 7.109 (0.74), 7.114 (0.97), 7.122 (0.63), 7.125 (0.46), 7.160 (1.46), 7.174 (2.22), 7.222 (2.72), 7.236 (1.67), 7.273 (0.45), 7.283 (0.54), 7.349 (1.20), 8.267 (0.72), 10.484 (0.86).
Example 143
4-(2,2-Difluorocyclopropyl)-4,5-Difluoro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[1,1-Biphenyl]-2-Carboxamide (Mixture of Diastereoisomers)
(2781) ##STR00541##
(2782) 4-(2,2-difluorocyclopropyl)-4,5-difluoro[1,1-biphenyl]-2-carboxylic acid (40.0 mg, 129 mol) dissolved in DMF (1.0 ml) were treated with ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione-hydrogen chloride (31.7 mg, 129 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (32.1 mg, 168 mol) 1-hydroxybenzotriazole hydrate (25.7 mg, 168 mol) and N,N-diisopropylethylamine (63 l, 360 mol) The mixture was stirred over night at room temperature. Water was added to the mixture and purification was done by preparative HPLC HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 58.3 mg (98% purity, 90% yield) of the title compound were obtained.
(2783) LC-MS (Method 7): R.sub.t=1.56 min; MS (ESIpos): m/z=502 [M+H].sup.+
(2784) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.929 (0.53), 1.936 (0.57), 1.943 (1.45), 1.950 (1.64), 1.957 (1.43), 1.965 (1.91), 1.972 (1.34), 1.979 (1.58), 1.986 (1.06), 2.001 (1.50), 2.010 (1.51), 2.022 (1.33), 2.030 (0.81), 2.044 (0.43), 2.423 (0.46), 2.518 (0.79), 2.570 (0.43), 2.652 (0.45), 3.004 (1.16), 3.018 (1.26), 3.025 (1.95), 3.039 (1.84), 3.045 (1.27), 3.059 (1.04), 3.721 (13.73), 3.867 (3.83), 3.990 (2.93), 3.995 (2.87), 4.000 (2.92), 4.005 (2.79), 4.013 (3.63), 4.018 (3.71), 4.024 (3.40), 4.028 (3.25), 4.050 (3.05), 4.055 (3.15), 4.061 (3.22), 4.066 (2.98), 4.073 (2.05), 4.078 (2.06), 4.084 (1.87), 4.089 (1.84), 4.361 (0.59), 7.218 (2.23), 7.297 (3.53), 7.311 (16.00), 7.317 (11.97), 7.321 (11.00), 7.331 (2.78), 7.335 (2.38), 7.371 (2.26), 7.385 (2.77), 7.389 (2.68), 7.402 (2.37), 7.454 (4.06), 7.509 (2.34), 7.522 (2.65), 7.528 (2.59), 7.541 (2.43), 8.459 (5.80), 8.727 (1.47), 8.737 (2.79), 8.747 (1.45), 11.443 (3.21).
Example 144
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(2,2-Difluorocyclopropyl)-4,5-Difluoro[1,1-Biphenyl]-2-Carboxamide (Mixture of Diastereoisomers)
(2785) ##STR00542##
(2786) 4-(2,2-difluorocyclopropyl)-4,5-difluoro[1,1-biphenyl]-2-carboxylic acid (40.0 mg, 129 mol) dissolved in DMF (1.0 ml) were treated with (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione-hydrogen chloride (26.5 mg, 129 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (32.1 mg, 168 mol) 1-hydroxybenzotriazole hydrate (25.7 mg, 168 mol) and N,N-diisopropylethylamine (63 l, 360 mol) The mixture was stirred over night at room temperature. Water was added to the mixture and purification was done by preparative HPLC HPLC (column: Chromatorex C18 10 m, 25030 mm, eluent A=water+0.1% TFA, B=acetonitrile; gradient: 3 min 10% B; 21 min 95% B; 30 min 95% B; 32 min 10% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 57.2 mg (100% purity, 96% yield) of the title compound were obtained.
(2787) LC-MS (Method 7): R.sub.t=1.72 min; MS (ESIpos): m/z=462 [M+H].sup.+
(2788) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.144 (0.40), 0.016 (0.46), 0.007 (0.66), 0.009 (0.51), 0.172 (0.55), 0.179 (0.68), 0.187 (0.60), 0.195 (0.44), 0.242 (0.43), 0.248 (0.53), 0.256 (0.61), 0.263 (0.47), 0.266 (0.44), 0.298 (0.50), 0.307 (0.64), 0.313 (0.60), 0.919 (0.58), 0.924 (0.63), 0.928 (0.43), 0.933 (1.06), 0.938 (0.43), 0.941 (0.56), 0.947 (0.52), 1.784 (0.41), 1.791 (0.50), 1.798 (0.43), 1.805 (0.58), 1.827 (0.43), 1.848 (0.51), 1.857 (0.50), 1.869 (0.46), 2.349 (3.86), 2.353 (7.90), 2.356 (10.73), 2.359 (7.74), 2.361 (3.72), 2.395 (16.00), 2.843 (0.40), 2.857 (0.44), 2.864 (0.65), 2.879 (0.63), 2.885 (0.44), 3.376 (0.71), 7.148 (2.25), 7.161 (4.40), 7.188 (4.93), 7.202 (2.38), 7.251 (0.49), 7.254 (0.52), 7.264 (0.63), 7.268 (0.97), 7.272 (0.59), 7.282 (0.54), 7.286 (0.48), 7.343 (0.76), 7.357 (0.87), 7.363 (0.85), 7.376 (0.82), 7.407 (2.17), 8.380 (0.66), 8.390 (1.29), 8.401 (0.63), 10.503 (1.52).
Example 145
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5,6-Dimethyl-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(2789) ##STR00543##
(2790) 5,6-dimethyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (50.0 mg, 170 mol) dissolved in DMF (1.4 ml) was treated with HATU (129 mg, 340 mol) and N,N-diisopropylethylamine (59 l, 340 mol). The mixture was stirred for 5 minutes then (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione (57.5 mg, 340 mol) was added and the reaction was stirred over night at room temperature. Purification was done by preparative HPLC. Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 42.6 mg (98% purity, 55% yield) of the title compound were obtained.
(2791) LC-MS (Method 7): R.sub.t=1.78 min, MS (ESIpos): m/z=446 [M+H].sup.+
(2792) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.54), 0.090 (0.70), 0.097 (1.31), 0.106 (1.25), 0.113 (0.88), 0.122 (0.42), 0.247 (0.43), 0.250 (0.43), 0.255 (0.77), 0.263 (0.93), 0.271 (0.85), 0.278 (0.65), 0.285 (0.48), 0.314 (0.42), 0.321 (0.74), 0.329 (0.76), 0.331 (0.79), 0.336 (1.10), 0.346 (0.88), 0.351 (0.52), 0.367 (0.48), 0.376 (0.94), 0.383 (1.19), 0.392 (1.15), 0.399 (0.75), 0.947 (0.43), 0.956 (0.85), 0.961 (0.90), 0.965 (0.58), 0.970 (1.56), 0.975 (0.58), 0.978 (0.81), 0.984 (0.77), 1.917 (16.00), 2.313 (15.59), 2.514 (0.49), 2.517 (0.47), 2.520 (0.43), 3.321 (4.58), 3.332 (4.20), 7.147 (2.64), 7.160 (3.24), 7.251 (2.97), 7.264 (2.38), 7.341 (1.38), 7.355 (2.77), 7.368 (1.49), 7.389 (3.04), 7.391 (3.03), 7.703 (3.11), 7.717 (2.89), 8.100 (1.03), 8.111 (2.16), 8.121 (1.02), 10.587 (2.61).
Example 146
Ent-4-Methyl-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2793) ##STR00544##
(2794) To a solution of rac-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-methyl[1,1-biphenyl]-2-carboxylic acid (86.4 mg, 407 mol) in DMF (8.4 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (200 l, 1.1 mmol). The reaction mixture was stirred overnight at 50 C. and concentrated under reduced pressure. The crude product was first purified by preparative HPLC (Method 9f). The combined organic phases were concentrated in vacuo and the remaining TFA was removed, using a Stratospheres PL-HCO3 MP SPE cartridge. After lyophilization, 20 mg of the racemate product were obtained. A second purification by preparative chiral HPLC [sample preparation: 20 mg; column: Daicel Chiralpack AD-H 5 m 250*20 mm; eluent: 2-propanol; flow rate: 9 ml/min; temperature: 20 C.; UV detection: 240 nm] gave 2.55 mg (95% purity, 1% yield) of the desired product
(2795) Analytical chiral HPLC: R.sub.t=11.28 min, e.e. =>95% [column: Daicel Chiralpack AD-H 5 m 250*4.6 mm; eluent: 2-propanol; flow rate: 0.5 ml/min; temperature: 20 C.; UV detection: 240 nm]
(2796) LC-MS (Method 8): R.sub.t=0.73 min; MS (ESIpos): m/z=404 [M+H].sup.+
(2797) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.007 (1.07), 0.006 (0.79), 1.236 (0.55), 2.075 (1.42), 2.333 (12.66), 3.510 (16.00), 3.577 (0.42), 3.948 (0.82), 3.961 (0.90), 3.976 (1.41), 3.989 (1.26), 4.046 (1.30), 4.059 (1.37), 4.074 (0.86), 4.087 (0.80), 6.844 (4.15), 6.846 (4.37), 7.206 (2.99), 7.213 (4.67), 7.215 (4.93), 7.222 (4.70), 7.267 (5.61), 7.283 (3.22), 7.336 (1.00), 7.339 (1.10), 7.351 (2.58), 7.354 (2.48), 7.360 (2.36), 7.365 (1.79), 7.368 (1.61), 7.375 (2.89), 7.380 (2.56), 7.395 (0.92), 7.471 (1.28), 7.474 (1.27), 7.486 (1.80), 7.489 (1.68), 7.500 (0.78), 7.504 (0.74), 8.267 (3.69), 8.383 (0.84), 8.396 (1.71), 8.409 (0.82), 11.222 (1.27).
Example 147
Ent-5-Fluoro-4-Methyl-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2798) ##STR00545##
(2799) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 204 mol) and 5-fluoro-4-methyl[1,1-biphenyl]-2-carboxylic acid (46.9 mg, 204 mol) in DMF (4.2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (50.7 mg, 265 mol), 1-hydroxybenzotriazole hydrate (40.5 mg, 265 mol) and N,N-diisopropylethylamine (99 l, 570 mol). The reaction mixture was stirred overnight at RT and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 2f). The combined organic phases were concentrated in vacuo and the remaining TFA was removed, using a Stratospheres PL-HCO3 MP SPE cartridge. After lyophilization, 36.1 mg (97% purity, 41% yield) of the desired product were obtained.
(2800) LC-MS (Method 7): R.sub.t=1.33 min, MS (ESIpos): m/z=421 [M+H].sup.+
(2801) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.072 (2.18), 2.334 (13.01), 2.730 (0.66), 2.889 (0.75), 3.500 (16.00), 3.907 (0.82), 3.917 (0.89), 3.930 (1.18), 3.940 (1.04), 4.028 (1.27), 4.039 (1.32), 4.051 (0.95), 4.062 (0.87), 6.827 (4.24), 7.190 (4.50), 7.197 (1.89), 7.210 (1.59), 7.217 (3.48), 7.231 (4.71), 7.240 (1.50), 7.250 (0.97), 7.254 (0.81), 7.287 (5.32), 7.301 (3.50), 7.385 (1.45), 7.395 (1.56), 7.399 (1.38), 7.409 (1.20), 8.052 (0.47), 8.368 (0.79), 8.378 (1.45), 8.389 (0.72).
Example 148
Ent-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2802) ##STR00546##
(2803) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 204 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (54.2 mg, 204 mol) in DMF (4.2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (50.7 mg, 265 mol), 1-hydroxybenzotriazole hydrate (40.5 mg, 265 mol) and N,N-diisopropylethylamine (99 l, 570 mol). The reaction mixture was stirred overnight at RT and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 51.5 mg (98% purity, 54% yield) of the desired product were obtained.
(2804) LC-MS (Method 7): R.sub.t=1.41 min, MS (ESIpos): m/z=458 [M+H].sup.+
(2805) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.43), 0.008 (1.63), 2.523 (0.85), 3.518 (16.00), 3.989 (0.70), 4.004 (0.79), 4.024 (1.32), 4.039 (1.18), 4.092 (1.22), 4.108 (1.31), 4.126 (0.76), 4.143 (0.70), 6.849 (4.01), 6.852 (4.11), 7.212 (3.83), 7.214 (3.84), 7.440 (1.88), 7.445 (0.85), 7.460 (5.27), 7.464 (4.27), 7.478 (2.17), 7.497 (0.65), 7.499 (0.55), 7.540 (1.39), 7.545 (1.24), 7.558 (1.32), 7.564 (1.54), 7.571 (2.96), 7.580 (1.04), 7.591 (3.33), 7.763 (3.42), 7.784 (2.83), 8.330 (3.52), 8.575 (0.74), 8.592 (1.57), 8.607 (0.74), 11.230 (0.95).
Example 149
Ent-4-Fluoro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2806) ##STR00547##
(2807) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (60.0 mg, 90% purity, 220 mol) and 4-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (62.5 mg, 220 mol) in DMF (1.4 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (54.8 mg, 286 mol), 1-hydroxybenzotriazole hydrate (43.8 mg, 286 mol) and N,N-diisopropylethylamine (190 l, 1.1 mmol). The reaction mixture was stirred overnight at RT and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 2f) The combined organic phases were concentrated in vacuo and the remaining TFA was removed, using a Stratospheres PL-HCO3 MP SPE cartridge. After lyophilization, 79.7 mg (100% purity, 76% yield) of the desired product were obtained.
(2808) LC-MS (Method 7): R.sub.t=1.56 min; MS (ESIpos): m/z=476 [M+H].sup.+
(2809) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 3.512 (16.00), 3.961 (0.62), 3.976 (0.68), 3.995 (1.06), 4.011 (0.97), 4.085 (1.20), 4.102 (1.27), 4.120 (0.80), 4.137 (0.75), 6.842 (3.65), 6.844 (3.75), 7.201 (3.69), 7.204 (3.76), 7.247 (1.35), 7.253 (1.62), 7.269 (1.39), 7.276 (1.56), 7.389 (0.64), 7.396 (0.65), 7.411 (1.56), 7.418 (1.58), 7.432 (1.01), 7.439 (1.02), 7.485 (1.72), 7.499 (1.81), 7.506 (1.27), 7.520 (1.14), 7.555 (3.08), 7.575 (3.62), 7.760 (3.74), 7.781 (3.13), 8.698 (0.62), 8.714 (1.17), 8.730 (0.60).
Example 150
Ent-5-Fluoro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2810) ##STR00548##
(2811) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (60.0 mg, 90% purity, 220 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (62.5 mg, 220 mol) in DMF (1.4 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (54.8 mg, 286 mol), 1-hydroxybenzotriazole hydrate (43.8 mg, 286 mol) and N,N-diisopropylethylamine (190 l, 1.1 mmol). The reaction mixture was stirred overnight at RT and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 2f) The combined organic phases were concentrated in vacuo and the remaining TFA was removed, using a Stratospheres PL-HCO3 MP SPE cartridge. After lyophilization, 72.3 mg (100% purity, 69% yield) of the desired product were obtained.
(2812) LC-MS (Method 7): R.sub.t=1.56 min, MS (ESIpos): m/z=476 [M+H].sup.+
(2813) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 3.502 (16.00), 3.921 (0.61), 3.937 (0.65), 3.956 (1.00), 3.971 (0.90), 4.061 (1.12), 4.077 (1.19), 4.095 (0.79), 4.112 (0.74), 6.826 (3.86), 6.828 (3.85), 7.182 (3.80), 7.316 (3.25), 7.339 (3.60), 7.357 (1.11), 7.364 (0.67), 7.497 (1.08), 7.510 (1.16), 7.514 (1.29), 7.532 (0.89), 7.597 (3.12), 7.617 (3.76), 7.772 (3.95), 7.793 (3.16), 8.534 (0.59), 8.549 (1.07).
Example 151
Ent-5-Methyl-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2814) ##STR00549##
(2815) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (60.0 mg, 90% purity, 220 mol) and 5-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (61.6 mg, 220 mol) in DMF (1.4 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (54.8 mg, 286 mol), 1-hydroxybenzotriazole hydrate (43.8 mg, 286 mol) and N,N-diisopropylethylamine (190 l, 1.1 mmol). The reaction mixture was stirred overnight at RT and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 67.1 mg (100% purity, 65% yield) of the desired product were obtained.
(2816) LC-MS (Method 7): R.sub.t=1.52 min, MS (ESIpos): m/z=472 [M+H].sup.+
(2817) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.71), 0.008 (0.72), 2.388 (11.22), 2.523 (0.81), 3.513 (16.00), 3.966 (0.76), 3.981 (0.85), 4.001 (1.31), 4.016 (1.14), 4.089 (1.18), 4.105 (1.27), 4.124 (0.80), 4.140 (0.74), 6.844 (3.99), 6.847 (4.08), 7.208 (3.87), 7.211 (3.91), 7.258 (3.08), 7.266 (1.53), 7.286 (1.81), 7.363 (3.21), 7.382 (2.15), 7.546 (2.90), 7.566 (3.40), 7.746 (3.55), 7.766 (2.93), 8.304 (3.44), 8.458 (0.78), 8.475 (1.63), 8.491 (0.76), 11.220 (1.46).
Example 152
Ent-4-Fluoro-4-Methyl-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2818) ##STR00550##
(2819) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-fluoro-4-methyl[1,1-biphenyl]-2-carboxylic acid (112 mg, 488 mol) in DMF (2.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred for 2 days at 40 C. and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 67.4 mg (96% purity, 38% yield) of the desired product were obtained.
(2820) LC-MS (Method 7): R.sub.t=1.31 min, MS (ESIpos): m/z=422 [M+H].sup.+
(2821) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.328 (13.26), 3.512 (16.00), 3.952 (0.93), 3.962 (1.00), 3.975 (1.42), 3.985 (1.28), 4.058 (1.34), 4.069 (1.40), 4.081 (0.96), 4.092 (0.90), 6.848 (4.51), 7.112 (1.35), 7.117 (1.53), 7.127 (1.36), 7.132 (1.42), 7.204 (2.69), 7.215 (7.36), 7.246 (5.76), 7.259 (3.01), 7.323 (0.60), 7.327 (0.63), 7.337 (1.43), 7.341 (1.46), 7.351 (0.87), 7.355 (0.89), 7.395 (1.56), 7.404 (1.64), 7.409 (1.20), 7.418 (1.07), 8.140 (0.45), 8.311 (3.94), 8.547 (0.92), 8.
Example 153
Ent-5-Chloro-4-Methyl-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2822) ##STR00551##
(2823) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 5-chloro-4-methyl[1,1-biphenyl]-2-carboxylic acid (100 mg, 407 mol) in DMF (7.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (200 l, 1.1 mmol). The reaction mixture was stirred overnight at room temperature and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 92.0 mg (98% purity, 51% yield) of the desired product were obtained.
(2824) LC-MS (Method 7): R.sub.t=1.48 min; MS (ESIpos): m/z=438 [M+H].sup.+
(2825) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.336 (13.22), 2.567 (0.48), 3.508 (16.00), 3.944 (0.92), 3.954 (1.01), 3.966 (1.49), 3.977 (1.38), 4.039 (1.39), 4.049 (1.48), 4.061 (1.00), 4.073 (0.92), 6.838 (4.35), 7.201 (4.48), 7.220 (3.18), 7.234 (4.67), 7.284 (5.29), 7.297 (3.57), 7.342 (2.75), 7.356 (3.43), 7.407 (3.15), 7.410 (3.59), 7.459 (2.01), 7.462 (1.85), 7.473 (1.66), 7.476 (1.56), 8.258 (4.13), 8.420 (0.95), 8.431 (1.91), 8.441 (0.98), 11.187 (0.51).
Example 154
Ent-4,5-Difluoro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2826) ##STR00552##
(2827) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4,5-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (123 mg, 407 mol) in DMF (2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). After overnight stirring at room temperature, the reaction was additionally stirred for 2 h at 50 C. The resulting reaction mixture was concentrated under reduced pressure and the crude product was purified by preparative HPLC (Method 3f). After lyophilization, 82.0 mg (98% purity, 40% yield) of the desired product were obtained.
(2828) LC-MS (Method 7): R.sub.t=1.54 min; MS (ESIpos): m/z=494 [M+H].sup.+
(2829) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.571 (0.46), 3.262 (0.46), 3.333 (1.27), 3.520 (16.00), 3.997 (0.87), 4.007 (0.99), 4.020 (1.38), 4.031 (1.26), 4.104 (1.27), 4.115 (1.37), 4.127 (0.97), 4.139 (0.92), 6.852 (3.96), 6.854 (3.93), 7.212 (3.90), 7.213 (3.88), 7.473 (0.89), 7.487 (1.13), 7.491 (1.10), 7.505 (1.00), 7.574 (3.06), 7.587 (3.75), 7.603 (1.24), 7.609 (1.17), 7.622 (1.05), 7.775 (3.59), 7.789 (3.25), 8.390 (3.66), 8.718 (0.83), 8.729 (1.68), 8.740 (0.90), 11.249 (1.06).
Example 155
Ent-4-Chloro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2830) ##STR00553##
(2831) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (60.0 mg, 244 mol) and 4-chloro[1,1-biphenyl]-2-carboxylic acid (68.2 mg, 293 mol) in DMF (1.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (60.9 mg, 317 mol), 1-hydroxybenzotriazole hydrate (48.6 mg, 317 mol) and N,N-diisopropylethylamine (210 l, 1.2 mmol). The reaction mixture was stirred for 2 days at 40 C. and concentrated under reduced pressure. The crude product was first purified by preparative HPLC (Method 5f). A second purification by preparative thin-layer chromatography (silica gel, eluent: ethyl acetate/methanol: 10/1) gave 23.9 mg (100% purity, 23% yield) of the desired product
(2832) LC-MS (Method 7): R.sub.t=1.29 min, MS (ESIpos): m/z=424 [M+H].sup.+
(2833) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.235 (0.49), 2.327 (0.65), 2.366 (0.54), 2.669 (0.75), 2.709 (0.61), 3.515 (16.00), 3.965 (0.70), 3.980 (0.82), 3.999 (1.41), 4.015 (1.28), 4.069 (1.37), 4.085 (1.44), 4.103 (0.83), 4.120 (0.77), 6.848 (4.02), 7.210 (4.24), 7.373 (3.84), 7.388 (3.73), 7.394 (7.05), 7.414 (4.79), 7.429 (2.40), 7.458 (6.13), 7.480 (3.81), 7.499 (1.46), 7.504 (1.31), 7.517 (1.62), 7.522 (1.52), 7.535 (0.75), 8.267 (0.92), 8.463 (0.83), 8.479 (1.62), 8.494 (0.83), 11.220 (0.64).
Example 156
Ent-4-Chloro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2834) ##STR00554##
(2835) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-chloro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (122 mg, 407 mol) in DMF (2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). After overnight stirring at room temperature, the reaction was additionally stirred for 2 h at 50 C. The resulting reaction mixture was concentrated under reduced pressure and the crude product was purified by preparative HPLC (Method 3f). After lyophilization, 70.8 mg (98% purity, 35% yield) of the desired product were obtained.
(2836) LC-MS (Method 7): R.sub.t=1.57 min, MS (ESIpos): m/z=492 [M+H].sup.+
(2837) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.267 (0.50), 3.272 (0.48), 3.523 (16.00), 4.001 (0.92), 4.011 (1.00), 4.024 (1.44), 4.034 (1.29), 4.108 (1.31), 4.119 (1.42), 4.131 (1.00), 4.142 (0.92), 6.853 (4.22), 7.213 (4.21), 7.473 (2.76), 7.484 (3.85), 7.487 (6.67), 7.564 (3.28), 7.577 (3.72), 7.617 (1.98), 7.621 (1.76), 7.631 (1.57), 7.635 (1.59), 7.774 (3.80), 7.787 (3.43), 8.374 (3.95), 8.760 (0.90), 8.771 (1.79), 8.782 (0.93), 11.257 (0.71).
Example 157
Ent-4-Chloro-5-Fluoro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2838) ##STR00555##
(2839) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-chloro-5-fluoro[1,1-biphenyl]-2-carboxylic acid (122 mg, 488 mol) in DMF (2.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred for 2 days at 40 C. and concentrated under reduced pressure. The crude product was first purified by preparative HPLC (Method 5f). A second purification by preparative thin-layer chromatography (silica gel, eluent: ethyl acetate/methanol: 10/1) gave 17.4 mg (100% purity, 10% yield) of the desired product
(2840) LC-MS (Method 7): R.sub.t=1.36 min, MS (ESIpos): m/z=442 [M+H].sup.+
(2841) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.327 (0.78), 2.366 (0.64), 2.669 (0.82), 2.709 (0.64), 3.168 (5.84), 3.343 (5.77), 3.967 (1.66), 3.983 (1.86), 4.002 (3.13), 4.017 (2.84), 4.073 (3.05), 4.089 (3.24), 4.107 (1.91), 4.124 (1.75), 6.913 (1.84), 7.256 (5.83), 7.262 (7.32), 7.274 (3.41), 7.281 (4.33), 7.287 (5.09), 7.296 (4.60), 7.302 (3.02), 7.317 (2.37), 7.323 (1.83), 7.387 (9.12), 7.392 (3.78), 7.409 (15.15), 7.428 (4.02), 7.443 (4.14), 7.449 (3.57), 7.465 (4.50), 7.472 (16.00), 7.477 (4.73), 7.489 (3.74), 7.493 (9.43), 8.349 (5.74), 8.554 (2.64), 11.261 (3.18).
Example 158
Ent-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2842) ##STR00556##
(2843) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (109 mg, 407 mol) in DMF (2.3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 92.8 mg (96% purity, 48% yield) of the desired product were obtained.
(2844) LC-MS (Method 7): R.sub.t=1.15 min, MS (ESIpos): m/z=459 [M+H].sup.+
(2845) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.48), 0.008 (1.59), 2.731 (1.05), 2.889 (1.29), 3.315 (8.83), 3.978 (3.17), 3.994 (3.53), 4.013 (5.52), 4.028 (4.98), 4.098 (5.09), 4.114 (5.44), 4.132 (3.37), 4.149 (3.17), 6.854 (14.61), 6.856 (15.15), 7.215 (15.75), 7.503 (2.82), 7.507 (3.22), 7.525 (14.98), 7.544 (12.79), 7.547 (12.89), 7.566 (3.73), 7.594 (5.69), 7.599 (5.32), 7.612 (5.59), 7.617 (5.69), 7.631 (2.21), 7.635 (2.04), 7.928 (6.81), 7.949 (13.03), 7.989 (7.04), 7.994 (6.94), 8.010 (3.69), 8.015 (3.77), 8.141 (4.40), 8.347 (16.00), 8.652 (3.27), 8.668 (6.85), 8.684 (3.27), 8.749 (9.40), 8.754 (9.31), 11.238 (2.39).
Example 159
Ent-3-Fluoro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2846) ##STR00557##
(2847) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 3-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (116 mg, 407 mol) in DMF (2.3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and concentrated under reduced pressure.
(2848) The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 65.5 mg (99% purity, 34% yield) of the desired product were obtained.
(2849) LC-MS (Method 7): R.sub.t=1.37 min; MS (ESIpos): m/z=476 [M+H].sup.+
(2850) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.41), 0.008 (0.47), 3.315 (16.00), 3.966 (1.02), 3.981 (1.08), 4.001 (1.53), 4.017 (1.42), 4.119 (1.51), 4.135 (1.65), 4.154 (1.14), 4.170 (1.02), 6.836 (5.12), 6.839 (5.39), 7.200 (5.19), 7.274 (2.69), 7.293 (3.05), 7.310 (1.27), 7.331 (2.49), 7.353 (1.47), 7.527 (1.04), 7.542 (1.19), 7.547 (1.65), 7.562 (1.59), 7.567 (0.97), 7.582 (0.82), 7.618 (3.89), 7.639 (4.58), 7.800 (4.85), 7.820 (3.92), 8.328 (3.76), 8.885 (1.03), 8.901 (2.12), 8.917 (1.00), 11.168 (2.74).
Example 160
Ent-4-Chloro-4-Fluoro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2851) ##STR00558##
(2852) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-chloro-4-fluoro[1,1-biphenyl]-2-carboxylic acid (102 mg, 407 mol) in DMF (2.3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 65.5 mg (97% purity, 35% yield) of the desired product were obtained.
(2853) LC-MS (Method 7): R.sub.t=1.36 min; MS (ESIpos): m/z=442 [M+H].sup.+
(2854) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.31), 0.008 (1.50), 2.523 (0.75), 3.517 (16.00), 3.971 (0.76), 3.986 (0.85), 4.006 (1.38), 4.021 (1.23), 4.084 (1.26), 4.100 (1.33), 4.118 (0.81), 4.135 (0.77), 6.853 (3.89), 6.855 (4.19), 7.179 (1.41), 7.186 (1.68), 7.202 (1.49), 7.208 (1.74), 7.216 (3.98), 7.219 (4.14), 7.351 (4.48), 7.356 (2.08), 7.373 (7.25), 7.378 (2.42), 7.392 (1.11), 7.399 (1.08), 7.429 (1.80), 7.443 (1.95), 7.451 (1.99), 7.457 (6.08), 7.463 (2.30), 7.474 (1.48), 7.479 (4.02), 8.362 (3.78), 8.643 (0.78), 8.659 (1.62), 8.675 (0.78), 11.249 (0.80).
Example 161
Ent-5-Chloro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2855) ##STR00559##
(2856) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 5-chloro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (122 mg, 407 mol) in DMF (7.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (200 l, 1.1 mmol). The reaction mixture was stirred overnight at room temperature and concentrated under reduced pressure.
(2857) The crude product was purified by preparative HPLC (Method 3F). After lyophilization, 112 mg (97% purity, 54% yield) of the desired product were obtained.
(2858) LC-MS (Method 7): R.sub.t=1.61 min, MS (ESIpos): m/z=492 [M+H].sup.+
(2859) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.570 (0.40), 3.327 (0.67), 3.516 (16.00), 3.989 (0.87), 3.999 (0.99), 4.012 (1.42), 4.023 (1.30), 4.090 (1.30), 4.101 (1.41), 4.113 (0.97), 4.124 (0.92), 6.848 (4.12), 7.207 (4.15), 7.454 (2.70), 7.468 (3.40), 7.524 (3.01), 7.528 (3.52), 7.564 (2.06), 7.567 (1.77), 7.578 (1.61), 7.581 (1.46), 7.598 (3.21), 7.611 (3.67), 7.778 (3.74), 7.791 (3.30), 8.344 (3.91), 8.634 (0.86), 8.644 (1.79), 8.655 (0.92), 11.221 (0.93).
Example 162
Ent-4,5-Dichloro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2860) ##STR00560##
(2861) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4,5-dichloro[1,1-biphenyl]-2-carboxylic acid (109 mg, 407 mol) in DMF (2.3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 132 mg (95% purity, 67% yield) of the desired product were obtained.
(2862) LC-MS (Method 7): R.sub.t=1.52 min, MS (ESIpos): m/z=458 [M+H].sup.+
(2863) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.81), 0.008 (0.85), 2.523 (0.46), 3.469 (0.71), 3.512 (16.00), 3.963 (0.73), 3.979 (0.83), 3.998 (1.38), 4.013 (1.23), 4.070 (1.24), 4.086 (1.33), 4.104 (0.81), 4.121 (0.75), 6.847 (4.20), 6.850 (4.29), 7.211 (4.08), 7.214 (4.11), 7.395 (6.42), 7.399 (1.78), 7.411 (2.22), 7.416 (10.08), 7.422 (1.18), 7.467 (3.89), 7.474 (7.77), 7.479 (1.96), 7.486 (0.62), 7.491 (1.53), 7.496 (3.77), 7.502 (0.61), 7.512 (2.69), 7.518 (2.13), 7.533 (2.03), 7.538 (1.59), 8.161 (0.61), 8.346 (4.10), 8.567 (0.79), 8.583 (1.64), 8.599 (0.78).
Example 163
Ent-6-Fluoro-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2864) ##STR00561##
(2865) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 6-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (249 mg, 46% purity, 407 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 9f). After lyophilization, 81.8 mg (98% purity, 41% yield) of the desired product were obtained.
(2866) LC-MS (Method 7): R.sub.t=1.43 min, MS (ESIpos): m/z=476 [M+H].sup.+
(2867) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.57), 1.169 (2.18), 1.182 (4.48), 1.194 (2.20), 2.385 (0.48), 2.424 (0.57), 2.467 (0.43), 2.519 (0.73), 2.522 (0.76), 3.089 (1.18), 3.097 (1.20), 3.101 (1.18), 3.109 (1.13), 3.813 (0.47), 3.911 (0.49), 3.973 (1.12), 3.984 (1.46), 3.997 (11.29), 4.010 (11.14), 4.022 (1.30), 4.033 (1.15), 4.356 (1.12), 7.187 (5.50), 7.277 (8.22), 7.279 (8.46), 7.290 (9.02), 7.291 (8.95), 7.432 (8.97), 7.440 (4.52), 7.456 (6.73), 7.471 (4.61), 7.519 (12.08), 7.533 (16.00), 7.543 (4.25), 7.547 (5.24), 7.556 (4.93), 7.560 (2.97), 7.569 (2.54), 7.778 (15.60), 7.792 (13.97), 8.408 (10.69), 8.729 (2.96), 8.740 (5.85), 8.750 (2.92), 11.415 (7.33).
Example 164
Rac-N-{[2,5-Dioxo-4-(Pyridin-2-Yl)Imidazolidin-4-Yl]Methyl}-4-Methyl[Biphenyl]-2-Carboxamide
(2868) ##STR00562##
(2869) To a solution of rac-5-(aminomethyl)-5-(pyridin-2-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 412 mol) and 4-methyl[1,1-biphenyl]-2-carboxylic acid (76.0 mg, 358 mol) in DMF (7.4 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (89.3 mg, 466 mol), 1-hydroxybenzotriazole hydrate (71.4 mg, 466 mol) and N,N-diisopropylethylamine (500 l, 2.9 mmol). After overnight stirring at room temperature, the reaction mixture was additionally stirred for 3 h at 50 C., then diluted with ethyl acetate and extracted with water. After phase separation, the water phase was concentrated under reduced pressure and the crude product was purified by preparative HPLC (Method 3f). After lyophilization, 3.30 mg (100% purity, 2% yield) of the desired product were obtained.
(2870) LC-MS (Method 7): R.sub.t=1.47 min, MS (ESIpos): m/z=401 [M+H].sup.+
(2871) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.324 (16.00), 2.423 (0.45), 3.280 (0.65), 3.292 (0.71), 3.317 (2.07), 3.326 (3.82), 3.383 (0.39), 3.392 (0.71), 3.888 (1.17), 3.898 (1.30), 3.911 (1.75), 3.921 (1.55), 4.002 (1.68), 4.011 (1.75), 4.025 (1.23), 4.034 (1.17), 7.174 (3.43), 7.187 (5.77), 7.222 (7.13), 7.235 (3.82), 7.280 (2.01), 7.293 (2.72), 7.344 (2.59), 7.350 (1.81), 7.356 (3.24), 7.362 (3.04), 7.375 (1.43), 7.385 (1.49), 7.393 (1.62), 7.398 (1.62), 7.406 (1.55), 7.459 (1.62), 7.461 (1.49), 7.472 (2.40), 7.474 (2.20), 7.484 (1.10), 7.486 (1.10), 7.494 (2.79), 7.507 (2.79), 7.838 (1.30), 7.841 (1.30), 7.851 (2.14), 7.854 (2.07), 7.864 (1.10), 7.867 (1.04), 8.190 (4.21), 8.345 (1.17), 8.355 (2.20), 8.365 (1.10), 8.588 (1.94), 8.594 (1.88), 10.902 (2.46).
Example 165
Rac-4-Fluoro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2872) ##STR00563##
(2873) To a solution of rac-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (70.0 mg, 266 mol) and 4-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (75.7 mg, 266 mol) in DMF (1.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (66.4 mg, 346 mol), 1-hydroxybenzotriazole hydrate (53.0 mg, 346 mol) and N,N-diisopropylethylamine (230 l, 1.3 mmol). The reaction mixture was stirred overnight at room temperature, diluted with ethyl acetate and washed with water. After phase separation, the combined organic phases were dried and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 41.0 mg (98% purity, 31% yield) of the desired product were obtained.
(2874) LC-MS (Method 7): R.sub.t=1.68 min; MS (ESIpos): m/z=493 [M+H].sup.+
(2875) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.157 (0.51), 2.365 (16.00), 3.306 (0.47), 4.080 (2.06), 4.087 (2.49), 4.097 (2.18), 7.227 (1.35), 7.232 (1.50), 7.242 (1.39), 7.247 (1.41), 7.398 (0.67), 7.402 (0.66), 7.412 (1.47), 7.417 (1.46), 7.426 (0.88), 7.431 (0.83), 7.492 (1.47), 7.501 (1.61), 7.506 (1.26), 7.515 (1.09), 7.554 (3.52), 7.568 (3.98), 7.766 (4.11), 7.779 (3.57), 8.328 (3.90), 8.772 (0.95), 8.782 (1.93), 8.792 (0.94), 8.851 (5.65), 11.074 (0.78).
Example 166
Ent-4-Fluoro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2876) ##STR00564##
(2877) Enantiomeric separation of rac-4-fluoro-N-{[4-(5-methyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (40 mg) by preparative chiral HPLC [column: Daicel Chiralpak AZ-H 5 m, 25020 mm; eluent: 50% n-heptane/50% ethanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 5.93 mg (98% purity) of the desired product.
(2878) Analytical chiral HPLC: R.sub.t=2.43 min, e.e. =99% [column: Daicel AZ-3 3 m, 504.6 mm; eluent: 50% n-heptane/50% ethanol; flow rate: 1 ml/min; UV detection: 220 nm]
(2879) LC-MS (Method 7): R.sub.t=1.66 min; MS (ESIpos): m/z=493 [M+H].sup.+
(2880) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.71), 0.845 (0.53), 0.862 (0.57), 1.236 (1.74), 1.259 (0.89), 1.282 (0.59), 1.298 (0.60), 2.365 (16.00), 4.079 (2.64), 4.095 (2.86), 7.221 (1.31), 7.228 (1.56), 7.244 (1.36), 7.251 (1.51), 7.388 (0.59), 7.394 (0.63), 7.409 (1.44), 7.415 (1.49), 7.430 (0.94), 7.437 (0.94), 7.485 (1.56), 7.499 (1.68), 7.506 (1.23), 7.520 (1.06), 7.550 (3.04), 7.570 (3.59), 7.761 (3.68), 7.781 (3.11), 8.319 (4.00), 8.756 (0.81), 8.772 (1.75), 8.787 (0.85), 8.851 (4.97).
Example 167
Rac-5-Methyl-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2881) ##STR00565##
(2882) To a solution of rac-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (70.0 mg, 266 mol) and 5-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (74.7 mg, 266 mol) in DMF (1.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (66.4 mg, 346 mol), 1-hydroxybenzotriazole hydrate (53.0 mg, 346 mol) and N,N-diisopropylethylamine (230 l, 1.3 mmol). The reaction mixture was stirred overnight at room temperature, then for 1 h at 50 C. The reactions mixture was concentrated under reduced pressure and the crude product was purified by preparative HPLC (Method 4f). After lyophilization, 66.1 mg (99% purity, 50% yield) of the desired product were obtained.
(2883) LC-MS (Method 7): R.sub.t=1.86 min, MS (ESIpos): m/z=489 [M+H].sup.+
(2884) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.360 (16.00), 2.378 (0.57), 2.388 (10.54), 4.066 (2.95), 4.076 (2.95), 7.257 (2.66), 7.266 (1.27), 7.279 (1.58), 7.343 (2.79), 7.355 (1.96), 7.549 (2.69), 7.562 (2.97), 7.750 (3.14), 7.763 (2.73), 8.245 (3.50), 8.499 (0.75), 8.509 (1.58), 8.520 (0.73), 8.843 (6.69), 11.035 (1.07).
Example 168
Ent-5-Methyl-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2885) ##STR00566##
(2886) Enantiomeric separation of rac-5-methyl-N-{[4-(5-methyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (63 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 50% n-heptane/50% ethanol; flow rate: 15 ml/min; temperature: 30 C.; UV detection: 220 nm] afforded 25 mg (98% purity) of the desired product.
(2887) Analytical chiral HPLC: R.sub.t=6.66 min, e.e. =97.9% [column: Daicel chiralcel ID 5 m, 2504.6 mm; eluent: 50% n-heptane/50% ethanol; flow rate: 1 ml/min; temperature: 40 C.; UV detection: 220 nm]
(2888) LC-MS (Method 7): R.sub.t=1.74 min; MS (ESIpos): m/z=489 [M+H].sup.+
(2889) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.80), 0.022 (0.45), 0.020 (0.57), 0.017 (0.68), 0.015 (0.98), 0.012 (1.44), 0.008 (7.02), 0.006 (4.88), 0.006 (4.98), 0.008 (7.08), 0.012 (1.56), 0.015 (1.09), 0.017 (0.84), 0.020 (0.64), 0.022 (0.49), 0.025 (0.41), 0.146 (0.80), 2.322 (0.49), 2.327 (0.70), 2.332 (0.57), 2.359 (16.00), 2.388 (9.95), 2.518 (3.43), 2.523 (2.58), 2.526 (1.95), 2.557 (0.82), 2.560 (0.64), 2.562 (0.53), 2.565 (0.43), 2.665 (0.49), 2.669 (0.66), 2.674 (0.49), 2.709 (0.59), 4.061 (2.71), 4.077 (2.71), 7.256 (2.97), 7.281 (1.72), 7.339 (2.85), 7.358 (1.74), 7.544 (2.56), 7.564 (3.00), 7.745 (3.12), 7.765 (2.58), 8.236 (3.55), 8.482 (0.68), 8.498 (1.50), 8.513 (0.68), 8.842 (5.78).
Example 169
Rac-4-Chloro-5-Fluoro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2890) ##STR00567##
(2891) To a solution of rac-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (120 mg, 457 mol) and 4-chloro-5-fluoro[1,1-biphenyl]-2-carboxylic acid (114 mg, 457 mol) in DMF (2.8 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (114 mg, 594 mol), 1-hydroxybenzotriazole hydrate (90.9 mg, 594 mol) and N,N-diisopropylethylamine (400 l, 2.3 mmol). The reaction mixture was stirred overnight at room temperature, diluted with ethyl acetate and extracted with water. After phase separation, the combined organic phases were dried and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 92.0 mg (98% purity, 43% yield) of the desired product were obtained.
(2892) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2893) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.361 (2.52), 3.333 (16.00), 3.341 (7.04), 4.057 (0.43), 4.068 (0.46), 7.398 (0.58), 7.412 (0.91), 7.475 (0.84), 7.489 (0.57), 8.273 (0.57), 8.845 (1.00).
Example 170
Ent-4-Chloro-5-Fluoro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2894) ##STR00568##
(2895) Enantiomeric separation of rac-4-chloro-5-fluoro-N-{[4-(5-methyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}[biphenyl]-2-carboxamide (92 mg) by preparative chiral SFC [column: Maisch Daicel OJ-H 5 m, 25025 mm; eluent: carbon dioxide/methanol 75:25; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm] afforded 17.9 mg (100% purity) of the desired product.
(2896) Analytical chiral SFC: R.sub.t=0.907 min, e.e. =>99% [column: OJ 3 m, 1004.6 mm; eluent: carbon dioxide/methanol 80:20; flow rate: 3 ml/min; UV detection: 210 nm]
(2897) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2898) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.363 (16.00), 4.055 (3.74), 4.065 (3.78), 7.250 (1.22), 7.254 (1.66), 7.270 (2.11), 7.282 (1.66), 7.286 (1.24), 7.296 (0.89), 7.300 (0.71), 7.397 (3.74), 7.411 (5.42), 7.415 (2.18), 7.425 (1.56), 7.429 (1.37), 7.439 (1.17), 7.471 (5.33), 7.485 (3.59), 8.237 (3.86), 8.503 (0.95), 8.514 (1.87), 8.524 (0.91), 8.839 (5.53), 11.008 (1.08).
Example 171
Rac-4-Chloro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2899) ##STR00569##
(2900) To a solution of rac-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (120 mg, 457 mol) and 4-chloro[1,1-biphenyl]-2-carboxylicacid (106 mg, 457 mol) in DMF (2.8 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (114 mg, 594 mol), 1-hydroxybenzotriazole hydrate (90.9 mg, 594 mol) and N,N-diisopropylethylamine (400 l, 2.3 mmol). The reaction mixture was stirred overnight at room temperature, diluted with ethyl acetate and extracted with water. After phase separation, the combined organic phases were dried and concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 64.0 mg (99% purity, 31% yield) of the desired product were obtained.
(2901) LC-MS (Method 7): R.sub.t=1.54 min; MS (ESIpos): m/z=441 [M+H].sup.+
(2902) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.363 (9.75), 2.501 (16.00), 3.300 (0.96), 4.056 (1.16), 4.064 (1.51), 4.074 (1.18), 7.377 (3.02), 7.390 (3.97), 7.400 (1.46), 7.412 (0.76), 7.425 (1.28), 7.437 (0.59), 7.460 (3.22), 7.474 (2.26), 7.502 (0.75), 7.514 (1.13), 7.526 (0.46), 8.250 (2.42), 8.508 (0.56), 8.519 (1.11), 8.529 (0.53), 8.846 (3.42), 11.032 (0.63).
Example 172
Ent-4-Chloro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2903) ##STR00570##
(2904) Enantiomeric separation of rac-4-chloro-N-{[4-(5-methyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4-yl]methyl}[biphenyl]-2-carboxamide (64 mg) by preparative chiral SFC [column: Maisch Daicel OJ-H 5 m, 25025 mm; eluent: carbon dioxide/methanol 75:25; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm] afforded 15.6 mg (100% purity) of the desired product.
(2905) Analytical chiral HPLC: R.sub.t=0.95 min, e.e. =>99% [column: OJ 3 m, 1004.6 mm; eluent: carbon dioxide/methanol 80:20; flow rate: 3 ml/min; UV detection: 210 nm]
(2906) LC-MS (Method 7): R.sub.t=1.54 min; MS (ESIpos): m/z=441 [M+H].sup.+
(2907) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.367 (16.00), 4.056 (2.04), 4.061 (2.14), 4.067 (2.12), 4.071 (2.14), 7.377 (4.86), 7.391 (7.56), 7.398 (2.56), 7.411 (1.26), 7.423 (1.95), 7.436 (0.88), 7.457 (5.17), 7.471 (3.62), 7.500 (1.15), 7.512 (1.76), 7.526 (0.73), 8.216 (3.53), 8.461 (0.85), 8.472 (1.72), 8.482 (0.83), 8.841 (5.66), 11.007 (2.04).
Example 173
Ent-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2908) ##STR00571##
(2909) To a solution of ent-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 190 mol) and 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (50.9 mg, 190 mol) in DMF (1.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (47.4 mg, 247 mol), 1-hydroxybenzotriazole hydrate (37.9 mg, 247 mol) and N,N-diisopropylethylamine (170 l, 950 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 50.6 mg (100% purity, 56% yield) of the desired product were obtained.
(2910) LC-MS (Method 7): R.sub.t=1.38 min, MS (ESIpos): m/z=476 [M+H].sup.+
(2911) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.92), 0.006 (0.67), 0.008 (1.01), 2.360 (16.00), 4.070 (2.69), 4.086 (2.70), 7.479 (0.99), 7.482 (0.81), 7.485 (0.58), 7.498 (2.17), 7.502 (1.40), 7.523 (2.06), 7.543 (4.08), 7.561 (1.06), 7.564 (0.64), 7.589 (1.42), 7.593 (1.39), 7.606 (0.77), 7.611 (1.64), 7.626 (0.53), 7.630 (0.49), 7.933 (1.31), 7.952 (2.70), 7.985 (1.52), 7.990 (1.47), 8.005 (0.71), 8.010 (0.72), 8.278 (3.08), 8.675 (0.66), 8.691 (1.45), 8.707 (0.66), 8.746 (1.92), 8.751 (1.89), 8.849 (5.53), 11.045 (1.80).
Example 174
Ent-4-Chloro-4-Fluoro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2912) ##STR00572##
(2913) To a solution of ent-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 190 mol) and 4-chloro-4-fluoro[1,1-biphenyl]-2-carboxylic acid (47.7 mg, 190 mol) in DMF (1.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (47.4 mg, 247 mol), 1-hydroxybenzotriazole hydrate (37.9 mg, 247 mol) and N,N-diisopropylethylamine (170 l, 950 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 39.5 mg (99% purity, 45% yield) of the desired product were obtained.
(2914) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2915) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.53), 0.008 (1.67), 2.363 (16.00), 2.523 (0.91), 4.061 (2.72), 4.076 (2.87), 7.162 (1.26), 7.169 (1.50), 7.185 (1.28), 7.191 (1.42), 7.344 (0.99), 7.351 (4.10), 7.355 (1.53), 7.366 (2.83), 7.372 (6.89), 7.387 (1.06), 7.394 (1.02), 7.425 (1.61), 7.439 (1.72), 7.447 (1.57), 7.454 (5.57), 7.459 (2.35), 7.471 (1.31), 7.476 (3.69), 8.298 (3.33), 8.658 (0.69), 8.673 (1.51), 8.689 (0.70), 8.850 (5.77), 11.059 (1.36).
Example 175
Ent-4-(Methylsulfonyl)-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2916) ##STR00573##
(2917) To a solution of ent-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 190 mol) and 4-(methanesulfonyl)[1,1-biphenyl]-2-carboxylic acid (52.6 mg, 190 mol) in DMF (1.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (47.4 mg, 247 mol), 1-hydroxybenzotriazole hydrate (37.9 mg, 247 mol) and N,N-diisopropylethylamine (170 l, 950 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 15.8 mg (100% purity, 17% yield) of the desired product were obtained.
(2918) LC-MS (Method 8): R.sub.t=0.64 min; MS (ESIpos): m/z=485 [M+H].sup.+
(2919) .sup.1H NMR (600 MHz, DMSO-d.sub.6) ppm 10.85-11.20 (m, 1H), 8.84 (s, 1H), 8.60 (t, 1H), 8.23 (s, 1H), 7.96 (d, 2H), 7.38-7.72 (m, 6H), 4.09 (dd, 2H), 3.25 (s, 3H), 2.37 (s, 3H).
Example 176
Ent-5-Fluoro-N-{[4-(5-Methyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2920) ##STR00574##
(2921) To a solution of ent-5-(aminomethyl)-5-(5-methyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 190 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (54.1 mg, 190 mol) in DMF (1.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (47.4 mg, 247 mol), 1-hydroxybenzotriazole hydrate (37.9 mg, 247 mol) and N,N-diisopropylethylamine (170 l, 950 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 50.6 mg (100% purity, 54% yield) of the desired product were obtained.
(2922) LC-MS (Method 7): R.sub.t=1.69 min, MS (ESIpos): m/z=493 [M+H].sup.+
(2923) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.38), 0.008 (1.54), 2.361 (16.00), 4.069 (2.60), 4.085 (2.72), 7.319 (2.78), 7.324 (1.29), 7.338 (1.28), 7.343 (2.68), 7.349 (1.33), 7.359 (1.07), 7.365 (0.58), 7.461 (0.90), 7.466 (0.57), 7.476 (1.20), 7.484 (1.07), 7.499 (0.84), 7.589 (2.60), 7.610 (3.05), 7.776 (3.21), 7.797 (2.64), 8.285 (3.42), 8.640 (0.68), 8.655 (1.46), 8.671 (0.67), 8.845 (6.61), 11.043 (0.99).
Example 177
Rac-4-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2924) ##STR00575##
(2925) To a solution of rac-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (139 mg, 488 mol) in DMF (2.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 66.0 mg (99% purity, 34% yield) of the desired product were obtained.
(2926) LC-MS (Method 7): R.sub.t=1.56 min; MS (ESIpos): m/z=476 [M+H].sup.+
(2927) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.302 (0.79), 3.369 (0.49), 3.373 (0.52), 3.790 (16.00), 3.864 (0.79), 3.873 (0.87), 3.886 (1.32), 3.896 (1.21), 3.947 (1.22), 3.959 (1.31), 3.970 (0.87), 3.981 (0.80), 6.483 (3.36), 6.486 (3.39), 7.236 (1.28), 7.240 (1.45), 7.251 (1.35), 7.255 (1.41), 7.389 (3.41), 7.392 (3.38), 7.413 (0.64), 7.418 (0.66), 7.428 (1.40), 7.432 (1.44), 7.442 (0.92), 7.446 (0.90), 7.489 (1.48), 7.499 (1.64), 7.508 (3.37), 7.521 (3.52), 7.752 (3.49), 7.766 (3.24), 8.463 (3.55), 8.908 (0.82), 8.919 (1.59), 8.929 (0.89), 11.294 (0.41).
Example 178
Ent-4-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2928) ##STR00576##
(2929) Enantiomeric separation of rac-4-fluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (66 mg) by preparative chiral SFC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 82% carbon dioxide/18% methanol; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm] afforded 14.8 mg (99% purity) of the desired product.
(2930) Analytical chiral SFC: R.sub.t=1.68 min, e.e. =98.1% [column: OJ 3 m, 1004.6 mm; eluent: carbon dioxide/isopropanol 80:20; flow rate: 3 ml/min; UV detection: 210 nm]
(2931) LC-MS (Method 7): R.sub.t=1.57 min; MS (ESIpos): m/z=476 [M+H].sup.+
(2932) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.035 (1.88), 1.045 (1.89), 3.794 (16.00), 3.861 (0.96), 3.870 (1.03), 3.883 (1.59), 3.893 (1.47), 3.945 (1.49), 3.956 (1.53), 3.967 (0.98), 3.979 (0.91), 6.477 (3.88), 7.239 (1.71), 7.250 (1.59), 7.254 (1.61), 7.386 (3.80), 7.412 (0.79), 7.422 (1.64), 7.426 (1.66), 7.436 (1.05), 7.486 (1.70), 7.495 (1.97), 7.508 (4.98), 7.521 (4.43), 7.748 (4.46), 7.762 (4.02), 8.431 (4.21), 8.871 (1.13), 8.881 (2.04), 8.892 (1.09), 11.272 (2.21).
Example 179
Rac-4-Chloro-5-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2933) ##STR00577##
(2934) To a solution of rac-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-chloro-5-fluoro[1,1-biphenyl]-2-carboxylic acid (122 mg, 488 mol) in DMF (2.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 7f). After lyophilization, 75.0 mg (100% purity, 42% yield) of the desired product were obtained.
(2935) LC-MS (Method 7): R.sub.t=1.47 min, MS (ESIpos): m/z=442 [M+H].sup.+
(2936) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.998 (2.46), 1.014 (2.59), 1.026 (0.44), 2.523 (0.61), 2.526 (0.50), 3.790 (16.00), 3.818 (0.70), 3.833 (0.73), 3.852 (1.15), 3.866 (1.02), 3.924 (1.05), 3.941 (1.13), 3.958 (0.70), 3.976 (0.64), 6.458 (3.59), 6.463 (3.63), 7.252 (1.09), 7.258 (1.65), 7.277 (1.21), 7.283 (1.81), 7.301 (1.61), 7.308 (1.27), 7.322 (0.93), 7.329 (0.83), 7.336 (0.48), 7.342 (3.79), 7.347 (1.37), 7.359 (1.61), 7.364 (5.54), 7.370 (0.82), 7.382 (3.58), 7.387 (3.51), 7.408 (1.44), 7.423 (1.50), 7.429 (1.21), 7.444 (1.12), 7.451 (0.77), 7.458 (5.43), 7.462 (1.52), 7.474 (1.30), 7.479 (3.69), 7.485 (0.43), 8.353 (1.22), 8.693 (0.66), 8.709 (1.26), 8.725 (0.66).
Example 180
Ent-4-Chloro-5-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2937) ##STR00578##
(2938) Enantiomeric separation of rac-4-chloro-5-fluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}[biphenyl]-2-carboxamide (75 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 50% n-heptan/50% isopropanol; flow rate: 15 ml/min; temperature: 50 C.; UV detection: 220 nm] afforded 25.7 mg (100% purity) of the desired product.
(2939) Analytical chiral HPLC: R.sub.t=7.43 min, e.e. =99% [column: 2504.6 mm filled with Daicel Chiralpak ID 5 m; eluent: 50% n-heptan/50% isopropanol; flow rate: 1 ml/min; temperature: 50 C.; UV detection: 220 nm]
(2940) LC-MS (Method 7): R.sub.t=1.49 min; MS (ESIpos): m/z=442 [M+H].sup.+
(2941) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.523 (0.97), 3.792 (16.00), 3.827 (0.67), 3.842 (0.73), 3.861 (1.20), 3.876 (1.06), 3.927 (1.09), 3.944 (1.16), 3.962 (0.68), 3.979 (0.62), 6.466 (3.56), 6.471 (3.60), 7.253 (1.11), 7.260 (1.67), 7.278 (1.23), 7.284 (1.89), 7.303 (1.63), 7.309 (1.29), 7.324 (0.96), 7.330 (0.86), 7.337 (0.51), 7.343 (3.87), 7.348 (1.38), 7.359 (1.63), 7.365 (5.63), 7.371 (0.81), 7.385 (3.51), 7.390 (3.46), 7.407 (1.48), 7.422 (1.54), 7.429 (1.24), 7.444 (1.14), 7.452 (0.75), 7.458 (5.51), 7.463 (1.54), 7.474 (1.30), 7.479 (3.76), 7.486 (0.43), 8.394 (3.39), 8.702 (0.70), 8.718 (1.35), 8.733 (0.70), 11.241 (0.72).
Example 181
Rac-4-Chloro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2942) ##STR00579##
(2943) To a solution of rac-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-chloro[1,1-biphenyl]-2-carboxylicacid (114 mg, 488 mol) in DMF (2.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 7f). After lyophilization, 136 mg (100% purity, 79% yield) of the desired product were obtained.
(2944) LC-MS (Method 7): R.sub.t=1.41 min, MS (ESIpos): m/z=424 [M+H].sup.+
(2945) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.037 (1.09), 1.040 (1.08), 1.053 (1.32), 1.065 (0.49), 2.100 (0.73), 2.524 (0.46), 3.795 (16.00), 3.831 (0.66), 3.846 (0.71), 3.866 (1.19), 3.880 (1.07), 3.929 (1.09), 3.946 (1.17), 3.963 (0.68), 3.980 (0.63), 6.462 (3.60), 6.467 (3.66), 7.314 (0.47), 7.320 (3.85), 7.325 (1.37), 7.337 (1.61), 7.342 (5.47), 7.348 (0.76), 7.368 (1.07), 7.372 (1.23), 7.384 (5.17), 7.389 (5.21), 7.401 (2.10), 7.415 (1.10), 7.418 (1.10), 7.434 (2.01), 7.437 (2.22), 7.443 (5.49), 7.448 (1.65), 7.453 (1.16), 7.456 (1.03), 7.459 (1.42), 7.464 (3.76), 7.471 (0.43), 7.505 (1.21), 7.508 (1.20), 7.523 (1.58), 7.527 (1.46), 7.542 (0.61), 7.545 (0.61), 8.359 (1.74), 8.664 (0.68), 8.680 (1.29), 8.695 (0.66).
Example 182
Ent-4-Chloro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2946) ##STR00580##
(2947) Enantiomeric separation of rac-4-chloro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}[biphenyl]-2-carboxamide (136 mg) by preparative chiral HPLC [column: Daicel Chiralpak IC 5 m, 25020 mm; eluent: 70% n-heptane/30% ethanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 14.3 mg (100% purity) of the desired product.
(2948) Analytical chiral HPLC: R.sub.t=1.63 min, e.e. =>99% [column: 504.6 mm filled with Daicel Chiralpak IC-3 3 m; eluent: 70% n-heptane/30% ethanol; flow rate: 1 ml/min; temperature: 30 C.; UV detection: 220 nm]
(2949) LC-MS (Method 7): R.sub.t=1.42 min; MS (ESIpos): m/z=424 [M+H].sup.+
(2950) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.799 (16.00), 3.845 (0.84), 3.854 (0.92), 3.867 (1.37), 3.877 (1.26), 3.937 (1.25), 3.948 (1.32), 3.959 (0.86), 3.971 (0.82), 6.460 (3.25), 6.463 (3.26), 7.324 (3.96), 7.339 (4.92), 7.375 (1.60), 7.383 (5.75), 7.386 (5.86), 7.395 (2.45), 7.421 (1.24), 7.433 (2.15), 7.443 (5.26), 7.457 (3.96), 7.510 (1.23), 7.522 (1.90), 7.535 (0.80), 8.350 (2.91), 8.638 (0.86), 8.648 (1.62), 8.659 (0.86), 11.223 (2.49).
Example 183
Rac-5-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2951) ##STR00581##
(2952) To a solution of rac-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (139 mg, 488 mol) in DMF (2.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 60.0 mg (100% purity, 31% yield) of the desired product were obtained.
(2953) LC-MS (Method 7): R.sub.t=1.57 min, MS (ESIpos): m/z=476 [M+H].sup.+
(2954) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.523 (0.49), 3.788 (16.00), 3.842 (0.61), 3.857 (0.68), 3.877 (1.16), 3.891 (1.05), 3.938 (1.07), 3.955 (1.14), 3.973 (0.65), 3.990 (0.59), 6.471 (3.61), 6.476 (3.67), 7.318 (0.97), 7.324 (1.69), 7.335 (0.93), 7.342 (1.31), 7.348 (1.79), 7.356 (1.79), 7.363 (1.16), 7.377 (1.08), 7.382 (4.07), 7.387 (3.67), 7.467 (1.37), 7.481 (1.39), 7.488 (1.16), 7.502 (1.01), 7.537 (2.64), 7.557 (3.10), 7.762 (3.22), 7.783 (2.70), 8.420 (3.37), 8.784 (0.68), 8.800 (1.31), 8.816 (0.68), 11.262 (0.78).
Example 184
Ent-5-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2955) ##STR00582##
(2956) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (121 mg, 425 mol) in DMF (2.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 2f). After lyophilization, 52.1 mg (98% purity, 26% yield) of the desired product were obtained.
(2957) LC-MS (Method 7): R.sub.t=1.57 min; MS (ESIpos): m/z=476 [M+H].sup.+
(2958) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.791 (16.00), 3.799 (1.04), 3.851 (0.80), 3.861 (0.88), 3.874 (1.29), 3.884 (1.15), 3.943 (1.18), 3.955 (1.25), 3.966 (0.81), 3.977 (0.76), 6.465 (3.24), 6.468 (3.25), 7.316 (1.09), 7.320 (1.55), 7.332 (1.13), 7.337 (2.01), 7.342 (0.63), 7.352 (1.48), 7.356 (1.23), 7.366 (0.81), 7.370 (0.72), 7.380 (3.27), 7.383 (3.25), 7.472 (1.30), 7.482 (1.39), 7.486 (1.21), 7.496 (1.08), 7.540 (3.07), 7.554 (3.33), 7.762 (3.49), 7.775 (3.09), 8.397 (2.61), 8.761 (0.83), 8.772 (1.50), 8.782 (0.79), 11.243 (2.31).
Example 185
Ent-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2959) ##STR00583##
(2960) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (94.4 mg, 354 mol) in DMF (2.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (88.3 mg, 461 mol), 1-hydroxybenzotriazole hydrate (70.6 mg, 461 mol) and N,N-diisopropylethylamine (190 l, 1.1 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 2f). After lyophilization, 62.9 mg (100% purity, 34% yield) of the desired product were obtained.
(2961) LC-MS (Method 7): R.sub.t=1.51 min; MS (ESIpos): m/z=458 [M+H].sup.+
(2962) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 3.793 (16.00), 3.853 (0.64), 3.867 (0.70), 3.887 (1.23), 3.902 (1.12), 3.944 (1.12), 3.961 (1.21), 3.978 (0.65), 3.995 (0.62), 6.472 (3.55), 6.477 (3.60), 7.383 (3.51), 7.388 (3.48), 7.424 (1.07), 7.428 (1.30), 7.435 (1.69), 7.443 (2.29), 7.447 (2.35), 7.453 (2.30), 7.466 (1.14), 7.469 (1.17), 7.484 (1.87), 7.488 (1.62), 7.503 (0.96), 7.506 (0.97), 7.516 (2.89), 7.536 (3.32), 7.546 (1.51), 7.550 (1.35), 7.565 (1.64), 7.568 (1.54), 7.584 (0.62), 7.587 (0.61), 7.749 (3.44), 7.769 (2.89), 8.400 (2.48), 8.751 (0.73), 8.767 (1.42), 8.783 (0.71), 11.260 (2.19).
Example 186
Ent-3-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2963) ##STR00584##
(2964) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 3-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (139 mg, 488 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 94.4 mg (98% purity, 48% yield) of the desired product were obtained.
(2965) LC-MS (Method 8): R.sub.t=0.78 min, MS (ESIpos): m/z=476 [M+H].sup.+
(2966) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.787 (16.00), 3.836 (0.73), 3.847 (0.77), 3.859 (1.00), 3.869 (0.94), 3.964 (0.98), 3.974 (1.06), 3.986 (0.80), 3.997 (0.71), 6.427 (3.33), 6.430 (3.35), 7.270 (1.64), 7.271 (1.69), 7.283 (1.78), 7.324 (0.72), 7.338 (1.49), 7.356 (3.56), 7.359 (3.37), 7.543 (0.61), 7.552 (0.69), 7.556 (0.97), 7.565 (0.93), 7.569 (0.61), 7.579 (0.56), 7.590 (2.40), 7.604 (2.67), 7.782 (2.78), 7.795 (2.43), 8.354 (0.55), 8.987 (0.65), 8.998 (1.35), 9.008 (0.63).
Example 187
Ent-4-Chloro-4-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2967) ##STR00585##
(2968) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-chloro-4-fluoro[1,1-biphenyl]-2-carboxylic acid (94.4 mg, 376 mol) in DMF (2.3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (88.3 mg, 461 mol), 1-hydroxybenzotriazole hydrate (70.6 mg, 461 mol) and N,N-diisopropylethylamine (310 l, 1.8 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 2f). After lyophilization, 42.5 mg (100% purity, 24% yield) of the desired product were obtained.
(2969) LC-MS (Method 7): R.sub.t=1.46 min, MS (ESIpos): m/z=442 [M+H].sup.+
(2970) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.072 (1.33), 3.791 (16.00), 3.833 (0.60), 3.848 (0.66), 3.867 (1.16), 3.882 (1.05), 3.925 (1.05), 3.942 (1.10), 3.959 (0.62), 3.976 (0.57), 6.475 (3.52), 6.480 (3.55), 7.167 (1.24), 7.174 (1.48), 7.190 (1.26), 7.197 (1.39), 7.299 (0.46), 7.306 (3.93), 7.311 (1.37), 7.322 (1.61), 7.327 (5.38), 7.333 (0.73), 7.359 (0.53), 7.366 (0.54), 7.381 (1.47), 7.389 (4.31), 7.394 (3.82), 7.402 (1.12), 7.408 (1.08), 7.425 (1.70), 7.441 (6.26), 7.447 (2.53), 7.458 (1.64), 7.463 (4.27), 7.469 (0.50), 8.428 (2.27), 8.431 (2.24), 8.815 (0.66), 8.831 (1.29), 8.846 (0.66), 11.276 (1.96).
Example 188
Ent-5-Chloro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2971) ##STR00586##
(2972) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 5-chloro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (147 mg, 488 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 84.2 mg (98% purity, 41% yield) of the desired product were obtained.
(2973) LC-MS (Method 8): R.sub.t=0.87 min, MS (ESIpos): m/z=492 [M+H].sup.+
(2974) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.790 (16.00), 3.855 (0.74), 3.864 (0.81), 3.877 (1.25), 3.887 (1.10), 3.935 (1.17), 3.946 (1.23), 3.957 (0.77), 3.969 (0.72), 6.464 (3.39), 6.467 (3.39), 7.378 (3.58), 7.381 (3.49), 7.437 (2.64), 7.450 (3.09), 7.522 (3.01), 7.525 (3.34), 7.547 (2.82), 7.561 (3.08), 7.575 (2.03), 7.579 (1.77), 7.589 (1.61), 7.592 (1.45), 7.762 (3.21), 7.776 (2.83), 8.412 (2.28), 8.808 (0.77), 8.818 (1.41), 8.829 (0.75).
Example 189
Ent-3,4-Dichloro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2975) ##STR00587##
(2976) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 3,4-dichloro[1,1-biphenyl]-2-carboxylic acid (130 mg, 488 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 31.7 mg (98% purity, 17% yield) of the desired product were obtained.
(2977) LC-MS (Method 8): R.sub.t=0.76 min; MS (ESIpos): m/z=458 [M+H].sup.+
(2978) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.794 (16.00), 6.391 (3.07), 6.394 (3.06), 7.308 (1.60), 7.311 (1.61), 7.321 (1.86), 7.323 (1.79), 7.345 (3.39), 7.348 (3.30), 7.404 (3.33), 7.408 (1.17), 7.415 (1.51), 7.418 (5.34), 7.423 (0.75), 7.458 (0.77), 7.462 (5.62), 7.465 (2.52), 7.473 (1.25), 7.476 (3.66), 7.478 (2.85), 7.491 (2.26), 7.499 (2.47), 7.501 (2.58), 7.513 (1.05), 7.515 (0.82), 8.316 (1.77), 8.820 (0.71), 8.830 (1.48), 8.840 (0.70).
Example 190
Ent-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(2979) ##STR00588##
(2980) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (131 mg, 488 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 86.8 mg (100% purity, 47% yield) of the desired product were obtained.
(2981) LC-MS (Method 8): R.sub.t=0.67 min; MS (ESIpos): m/z=459 [M+H].sup.+
(2982) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.785 (16.00), 3.861 (0.68), 3.870 (0.75), 3.883 (1.15), 3.893 (1.02), 3.940 (1.07), 3.952 (1.13), 3.963 (0.70), 3.974 (0.66), 6.479 (3.34), 6.482 (3.36), 7.376 (3.42), 7.379 (3.36), 7.490 (1.07), 7.493 (1.16), 7.503 (1.70), 7.505 (1.69), 7.519 (1.36), 7.532 (1.80), 7.540 (0.92), 7.542 (0.90), 7.552 (1.74), 7.554 (1.48), 7.565 (0.86), 7.567 (0.75), 7.604 (1.15), 7.606 (1.14), 7.616 (1.55), 7.619 (1.51), 7.629 (0.60), 7.631 (0.58), 7.910 (0.69), 7.911 (0.78), 7.924 (2.92), 7.925 (2.95), 7.931 (1.91), 7.934 (1.77), 7.944 (0.41), 7.948 (0.45), 8.388 (3.11), 8.728 (1.89), 8.801 (0.66), 8.811 (1.23), 8.822 (0.64), 11.240 (0.74).
Example 191
Ent-5,6-Difluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2983) ##STR00589##
(2984) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (148 mg, 488 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 90.9 mg (97% purity, 44% yield) of the desired product were obtained.
(2985) LC-MS (Method 8): R.sub.t=0.83 min, MS (ESIpos): m/z=494 [M+H].sup.+
(2986) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.767 (16.00), 3.802 (0.67), 3.812 (0.75), 3.825 (1.30), 3.835 (1.17), 3.867 (1.21), 3.878 (1.28), 3.890 (0.71), 3.901 (0.67), 6.445 (3.35), 6.448 (3.31), 7.284 (0.66), 7.291 (0.71), 7.298 (0.77), 7.306 (0.75), 7.366 (3.46), 7.369 (3.36), 7.527 (2.47), 7.541 (2.72), 7.603 (0.50), 7.617 (0.81), 7.633 (0.83), 7.647 (0.41), 7.801 (3.10), 7.814 (2.91), 8.392 (0.57), 8.786 (0.72), 8.796 (1.38), 8.807 (0.72).
Example 192
Ent-4,5-Difluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2987) ##STR00590##
(2988) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4,5-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (148 mg, 488 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 96.3 mg (98% purity, 47% yield) of the desired product were obtained.
(2989) LC-MS (Method 8): R.sub.t=0.84 min, MS (ESIpos): m/z=494 [M+H].sup.+
(2990) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.65), 2.513 (0.66), 2.517 (0.69), 2.520 (0.61), 2.570 (0.45), 2.731 (0.41), 2.889 (0.53), 3.298 (5.55), 3.758 (0.48), 3.824 (0.41), 3.855 (3.18), 3.864 (3.56), 3.877 (5.24), 3.887 (4.59), 3.907 (0.41), 3.942 (4.81), 3.954 (5.10), 3.965 (3.35), 3.977 (3.10), 6.471 (15.31), 6.474 (15.49), 7.384 (16.00), 7.387 (15.73), 7.463 (3.31), 7.477 (3.99), 7.481 (3.87), 7.495 (3.58), 7.525 (11.28), 7.539 (12.44), 7.560 (0.54), 7.565 (0.48), 7.590 (3.31), 7.603 (4.18), 7.609 (3.95), 7.616 (1.21), 7.622 (4.29), 7.636 (0.60), 7.761 (12.81), 7.775 (11.53), 8.170 (0.99), 8.459 (5.50), 8.881 (2.99), 8.891 (5.53), 8.902 (2.97).
Example 193
Ent-4,5-Dichloro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(2991) ##STR00591##
(2992) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4,5-dichloro[1,1-biphenyl]-2-carboxylic acid (130 mg, 488 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (method 4f). After lyophilization, 67.5 mg (100% purity, 36% yield) of the desired product were obtained.
(2993) LC-MS (Method 8): R.sub.t=0.83 min, MS (ESIpos): m/z=458 [M+H].sup.+
(2994) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.792 (16.00), 3.839 (0.67), 3.848 (0.75), 3.861 (1.14), 3.871 (0.99), 3.922 (1.05), 3.933 (1.11), 3.944 (0.72), 3.956 (0.67), 6.459 (3.28), 6.462 (3.32), 7.346 (0.40), 7.351 (3.77), 7.354 (1.25), 7.362 (1.42), 7.365 (4.80), 7.370 (0.63), 7.378 (2.76), 7.381 (3.67), 7.384 (3.48), 7.392 (3.09), 7.453 (0.62), 7.457 (5.08), 7.461 (4.03), 7.465 (3.41), 7.469 (1.38), 7.472 (3.76), 7.476 (0.40), 7.523 (1.92), 7.526 (1.68), 7.536 (1.54), 7.540 (1.43), 8.384 (3.09), 8.723 (0.66), 8.734 (1.21), 8.744 (0.65).
Example 194
Ent-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Methylsulfonyl)[Biphenyl]-2-Carboxamide
(2995) ##STR00592##
(2996) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 4-(methanesulfonyl)[1,1-biphenyl]-2-carboxylicacid (135 mg, 488 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 76.1 mg (100% purity, 40% yield) of the desired product were obtained.
(2997) LC-MS (Method 7): R.sub.t=1.01 min, MS (ESIpos): m/z=468 [M+H].sup.+
(2998) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 2.071 (0.61), 3.261 (16.00), 3.793 (15.82), 3.861 (0.61), 3.873 (0.69), 3.888 (1.05), 3.900 (0.91), 3.955 (0.96), 3.969 (1.01), 3.982 (0.65), 3.996 (0.60), 6.479 (3.53), 6.483 (3.47), 7.387 (3.90), 7.391 (3.72), 7.436 (2.26), 7.452 (3.34), 7.481 (0.98), 7.483 (0.94), 7.496 (1.72), 7.498 (1.38), 7.511 (0.76), 7.513 (0.77), 7.559 (4.82), 7.562 (1.48), 7.572 (2.97), 7.575 (4.95), 7.579 (0.73), 7.587 (0.61), 7.589 (0.62), 7.937 (0.73), 7.941 (4.51), 7.945 (1.35), 7.954 (1.40), 7.958 (3.97), 7.962 (0.53), 8.397 (3.16), 8.764 (0.65), 8.777 (1.19), 8.789 (0.62), 11.255 (0.46).
Example 195
Ent-6-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(2999) ##STR00593##
(3000) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) and 6-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (249 mg, 46% purity, 407 mol) in DMF (2.3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol), 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 52.8 mg (93% purity, 25% yield) of the desired product were obtained.
(3001) LC-MS (Method 7): R.sub.t=1.55 min; MS (ESIpos): m/z=476 [M+H].sup.+
(3002) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 3.768 (16.00), 3.807 (0.49), 3.819 (0.56), 3.834 (1.15), 3.846 (1.01), 3.864 (1.06), 3.877 (1.12), 3.891 (0.51), 3.905 (0.50), 6.454 (3.48), 6.457 (3.44), 7.263 (1.50), 7.265 (1.49), 7.278 (1.64), 7.280 (1.55), 7.370 (3.87), 7.374 (3.70), 7.433 (0.62), 7.435 (0.63), 7.449 (0.97), 7.452 (1.16), 7.454 (0.72), 7.469 (0.87), 7.471 (0.80), 7.498 (2.04), 7.514 (2.22), 7.527 (0.75), 7.538 (0.90), 7.544 (0.99), 7.547 (0.47), 7.553 (1.11), 7.559 (0.71), 7.564 (0.43), 7.570 (0.78), 7.602 (0.44), 7.616 (0.41), 7.623 (0.45), 7.626 (0.57), 7.775 (2.74), 7.791 (2.41), 8.393 (1.42), 8.787 (0.61), 8.800 (1.18), 8.812 (0.59).
Example 196
Rac-N-{[2,5-Dioxo-4-(1,3-Thiazol-4-Yl)Imidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3003) ##STR00594##
(3004) To a solution of rac-5-(aminomethyl)-5-(1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (67.0 mg, 269 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (71.7 mg, 269 mol) in DMF (1.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (67.1 mg, 350 mol), 1-hydroxybenzotriazole hydrate (53.6 mg, 350 mol) and N,N-diisopropylethylamine (230 l, 1.3 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 65.9 mg (99% purity, 52% yield) of the desired product were obtained.
(3005) LC-MS (Method 7): R.sub.t=1.66 min; MS (ESIpos): m/z=461 [M+H].sup.+
(3006) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.385 (0.46), 2.424 (0.50), 2.612 (0.41), 2.653 (0.46), 3.896 (2.61), 3.907 (2.77), 3.919 (4.57), 3.930 (4.25), 3.971 (4.38), 3.981 (4.74), 3.993 (2.80), 4.003 (2.50), 7.424 (4.54), 7.437 (12.20), 7.451 (7.39), 7.461 (3.81), 7.473 (6.39), 7.486 (2.91), 7.541 (4.09), 7.543 (4.25), 7.556 (16.00), 7.569 (13.69), 7.750 (12.04), 7.764 (10.71), 7.784 (11.71), 7.787 (12.25), 8.292 (12.53), 8.697 (2.88), 8.707 (5.72), 8.717 (2.83), 9.129 (10.40), 9.132 (10.86), 10.919 (5.43).
Example 197
Ent-N-{[2,5-Dioxo-4-(1,3-Thiazol-4-Yl)Imidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3007) ##STR00595##
(3008) Enantiomeric separation of rac-N-{[2,5-dioxo-4-(1,3-thiazol-4-yl)imidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (63.3 mg) by preparative chiral HPLC [Daicel Chiralpak IA 5 m, 25020 mm; eluent: 40% n-heptane/60% ethanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 19.4 mg (95% purity) of the desired product.
(3009) Analytical chiral HPLC: R.sub.t=3.22 min, e.e. =>99% [column: 504.6 mm filled with Daicel Chiralpak IA-3 3 m; eluent: 50% n-heptane/50% ethanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3010) LC-MS (Method 7): R.sub.t=1.53 min; MS (ESIpos): m/z=461 [M+H].sup.+
(3011) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.846 (1.06), 0.861 (1.32), 0.872 (1.09), 1.089 (0.81), 1.100 (0.84), 1.108 (0.76), 1.118 (0.71), 1.145 (0.46), 1.158 (0.84), 1.170 (0.51), 1.236 (1.09), 1.258 (0.94), 1.299 (0.81), 2.386 (0.41), 2.424 (0.66), 2.572 (1.01), 2.613 (0.43), 2.653 (0.76), 3.304 (1.70), 3.895 (2.35), 3.906 (2.53), 3.918 (4.20), 3.929 (3.97), 3.971 (4.03), 3.981 (4.41), 3.994 (2.56), 4.003 (2.41), 7.422 (4.51), 7.436 (11.04), 7.451 (7.32), 7.462 (3.90), 7.474 (6.35), 7.486 (3.01), 7.543 (4.10), 7.555 (16.00), 7.568 (13.77), 7.750 (11.77), 7.763 (10.35), 7.784 (10.28), 7.786 (10.35), 8.291 (9.47), 8.696 (2.81), 8.706 (5.52), 8.716 (2.78), 9.128 (9.72), 9.131 (9.70), 10.921 (8.28).
Example 198
Rac-N-{[2,5-Dioxo-4-(1,3-Thiazol-4-Yl)Imidazolidin-4-Yl]Methyl}-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3012) ##STR00596##
(3013) To a solution of rac-5-(aminomethyl)-5-(1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (67.0 mg, 269 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (76.6 mg, 269 mol) in DMF (1.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (67.1 mg, 350 mol), 1-hydroxybenzotriazole hydrate (53.6 mg, 350 mol) and N,N-diisopropylethylamine (230 l, 1.3 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 71.5 mg (98% purity, 54% yield) of the desired product were obtained.
(3014) LC-MS (Method 7): R.sub.t=1.72 min, MS (ESIpos): m/z=479 [M+H].sup.+
(3015) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.385 (0.57), 2.424 (0.65), 2.519 (1.08), 2.522 (0.96), 2.613 (0.58), 2.653 (0.65), 2.890 (0.48), 3.891 (2.93), 3.902 (3.12), 3.914 (5.14), 3.924 (4.73), 3.965 (5.01), 3.974 (5.54), 3.988 (3.28), 3.997 (2.90), 7.322 (3.14), 7.327 (9.19), 7.342 (13.62), 7.355 (3.58), 7.359 (2.42), 7.471 (4.51), 7.481 (4.12), 7.485 (4.39), 7.495 (3.34), 7.575 (11.52), 7.588 (12.72), 7.765 (13.50), 7.778 (12.09), 7.786 (16.00), 7.789 (15.88), 8.316 (10.03), 8.318 (9.83), 8.734 (3.22), 8.745 (6.52), 8.755 (3.17), 9.128 (13.82), 9.132 (13.92), 10.921 (8.56).
Example 199
Ent-N-{[2,5-Dioxo-4-(1,3-Thiazol-4-Yl)Imidazolidin-4-Yl]Methyl}-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3016) ##STR00597##
(3017) Enantiomeric separation of rac-N-{[2,5-dioxo-4-(1,3-thiazol-4-yl)imidazolidin-4-yl]methyl}-5-fluoro-4-(trifluoromethyl)[biphenyl]-2-carboxamide (68.9 mg) by preparative chiral SFC [column: Chiralpak AD SFC, 25020 mm; eluent: 65% carbon dioxide/35% ethanol; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm] afforded 25.5 mg (100% purity) of the desired product.
(3018) Analytical chiral SFC: R.sub.t=4.14 min, e.e. =>99% [column: OJ 3 m, 1004.6 mm; eluent: carbon dioxide/ethanol 70:30; flow rate: 3 ml/min; UV detection: 210 nm]
(3019) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=479 [M+H].sup.+
(3020) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.41), 0.008 (3.67), 0.008 (3.97), 0.146 (0.41), 2.327 (0.75), 2.366 (0.59), 2.669 (0.75), 2.710 (0.55), 3.879 (1.48), 3.895 (1.60), 3.913 (3.35), 3.929 (3.14), 3.956 (3.16), 3.971 (3.49), 3.991 (1.64), 4.005 (1.46), 7.318 (7.44), 7.341 (8.19), 7.359 (2.70), 7.366 (1.66), 7.465 (2.43), 7.479 (2.80), 7.484 (2.84), 7.501 (2.03), 7.570 (7.30), 7.590 (8.56), 7.760 (8.96), 7.782 (16.00), 7.787 (11.05), 8.307 (7.97), 8.719 (1.93), 8.734 (3.99), 8.750 (1.91), 9.126 (6.65), 9.131 (6.63), 10.915 (5.52).
Example 200
Rac-N-{[2,5-Dioxo-4-(1,3-Thiazol-2-Yl)Imidazolidin-4-Yl]Methyl}-4-Methyl[Biphenyl]-2-Carboxamide
(3021) ##STR00598##
(3022) To a solution of rac-5-(aminomethyl)-5-(1,3-thiazol-2-yl)imidazolidine-2,4-dione hydrochloride (70.0 mg, 281 mol) and 4-methyl[1,1-biphenyl]-2-carboxylic acid (59.7 mg, 281 mol) in DMF (1.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (70.1 mg, 366 mol), 1-hydroxybenzotriazole hydrate (56.0 mg, 366 mol) and N,N-diisopropylethylamine (250 l, 1.4 mmol). The reaction mixture was stirred overnight at room temperature, diluted with ethyl acetate and extracted with water. After phase separation, the organic phase was concentrated under reduced pressure, dried and purified by preparative HPLC. 24 mg of the desired product contaminated with impurities were obtained.
(3023) The aqueous phase was also concentrated under reduced pressure, dried and purified by preparative HPLC. 15 mg (98% purity) of the desired product were obtained.
(3024) LC-MS (Method 7): R.sub.t=1.46 min; MS (ESIpos): m/z=407 [M+H].sup.+
(3025) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.244 (1.42), 1.256 (1.64), 1.270 (1.05), 2.073 (2.45), 2.326 (16.00), 3.820 (1.33), 3.830 (1.39), 3.843 (1.58), 3.853 (1.45), 4.086 (1.55), 4.096 (1.61), 4.109 (1.39), 4.119 (1.25), 7.183 (3.45), 7.197 (6.18), 7.224 (6.97), 7.238 (3.52), 7.302 (2.14), 7.314 (2.95), 7.357 (2.66), 7.369 (3.59), 7.378 (2.77), 7.391 (1.31), 7.473 (1.63), 7.485 (2.42), 7.498 (1.03), 7.809 (3.51), 7.814 (4.01), 7.867 (4.12), 7.872 (3.33), 8.545 (1.25), 8.555 (2.32), 8.565 (1.12), 8.664 (3.85), 11.102 (3.30).
Example 201
Ent-N-{[2,5-Dioxo-4-(1,3-Thiazol-2-Yl)Imidazolidin-4-Yl]Methyl}-4-Methyl[Biphenyl]-2-Carboxamide
(3026) ##STR00599##
(3027) Enantiomeric separation of rac-N-{[2,5-dioxo-4-(1,3-thiazol-2-yl)imidazolidin-4-yl]methyl}-4-methyl[biphenyl]-2-carboxamide (39 mg of impure material) by preparative chiral HPLC [column: Daicel Chiralpak AD-H 5 m, 25020 mm; eluent: 70% n-heptane/30% isopropanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 3.88 mg (98% purity) of the desired product.
(3028) Analytical chiral HPLC: R.sub.t=13.36 min, e.e. =96.3% [column: Daicel Chiralpak AD-H 5 m, 2504.6 mm; eluent: 65% n-heptane/35% isopropanol; flow rate: 1 ml/min; temperature: 40 C.; UV detection: 220 nm]
(3029) LC-MS (Method 8): R.sub.t=0.78 min; MS (ESIpos): m/z=407 [M+H].sup.+
(3030) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.94), 0.008 (2.20), 1.029 (0.50), 1.045 (0.65), 1.120 (0.42), 1.235 (0.42), 2.326 (16.00), 2.365 (0.48), 2.669 (0.69), 2.709 (0.44), 3.812 (1.16), 3.828 (1.25), 3.846 (1.45), 3.862 (1.37), 4.074 (1.38), 4.089 (1.57), 4.108 (1.22), 4.123 (1.15), 7.178 (2.49), 7.198 (6.67), 7.222 (8.20), 7.242 (2.90), 7.296 (1.56), 7.315 (2.81), 7.353 (2.35), 7.358 (1.81), 7.372 (3.45), 7.377 (3.45), 7.396 (1.36), 7.465 (1.66), 7.469 (1.69), 7.484 (2.23), 7.488 (2.13), 7.503 (0.91), 7.806 (4.83), 7.815 (6.32), 7.864 (6.31), 7.872 (4.77), 8.527 (0.97), 8.543 (2.03), 8.558 (0.93), 8.654 (3.41), 11.094 (2.44).
Example 202
Rac-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-5-Methyl-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3031) ##STR00600##
(3032) To a solution of rac-5-(aminomethyl)-5-isopropylimidazolidine-2,4-dione hydrochloride (150 mg, 722 mol) and 5-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (202 mg, 722 mol) in DMF (4.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (180 mg, 939 mol), 1-hydroxybenzotriazole hydrate (144 mg, 939 mol) and N,N-diisopropylethylamine (630 l, 3.6 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 211 mg (98% purity, 66% yield) of the desired product were obtained.
(3033) LC-MS (Method 7): R.sub.t=1.74 min, MS (ESIpos): m/z=434 [M+H].sup.+
(3034) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.788 (8.00), 0.805 (8.35), 0.872 (7.96), 0.889 (8.31), 1.813 (0.47), 1.830 (1.25), 1.847 (1.68), 1.864 (1.17), 1.881 (0.43), 2.367 (0.59), 2.382 (16.00), 2.519 (1.29), 2.524 (0.98), 2.558 (0.47), 3.292 (0.82), 3.350 (1.56), 3.365 (1.37), 3.385 (1.68), 3.400 (1.52), 3.499 (1.44), 3.515 (1.52), 3.534 (1.09), 3.549 (0.98), 7.240 (4.02), 7.256 (1.68), 7.276 (2.65), 7.326 (4.88), 7.345 (2.77), 7.526 (4.02), 7.547 (4.72), 7.692 (3.36), 7.737 (4.88), 7.757 (4.06), 8.291 (1.01), 8.306 (2.11), 8.322 (0.98), 10.662 (2.89).
Example 203
Ent-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-5-Methyl-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3035) ##STR00601##
(3036) Enantiomeric separation of rac-N-[(4-isopropyl-2,5-dioxoimidazolidin-4-yl)methyl]-5-methyl-4-(trifluoromethyl)[biphenyl]-2-carboxamide (211 mg) by preparative chiral SFC [column: Daicel Chiralpak AD-H 5 m SFC, 25030 mm; eluent: carbon dioxide/isopropanol 72:28; flow rate: 100 ml/min; temperature: 38 C.; UV detection: 210 nm] afforded 39.5 mg (95% purity) of the desired product.
(3037) Analytical chiral SFC: R.sub.t=3.09 min, e.e. =97.5% [column: AD-3, 504.6 mm; eluent: carbon dioxide (95%.fwdarw.50%)/isopropanol (5%.fwdarw.50%); flow rate: 3 ml/min; UV detection: 220 nm]
(3038) LC-MS (Method 7): R.sub.t=1.74 min; MS (ESIpos): m/z=434 [M+H].sup.+
(3039) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.77), 0.008 (0.80), 0.788 (8.20), 0.805 (8.51), 0.872 (8.16), 0.889 (8.45), 1.030 (4.46), 1.045 (4.53), 1.813 (0.46), 1.830 (1.26), 1.847 (1.68), 1.864 (1.19), 1.881 (0.42), 1.908 (0.41), 2.382 (16.00), 2.523 (0.80), 2.526 (0.66), 3.350 (1.15), 3.365 (1.21), 3.384 (1.64), 3.399 (1.49), 3.500 (1.48), 3.515 (1.57), 3.534 (1.09), 3.550 (1.02), 4.324 (0.62), 4.334 (0.61), 7.240 (4.07), 7.256 (1.70), 7.275 (2.67), 7.326 (4.87), 7.345 (2.80), 7.526 (4.07), 7.547 (4.75), 7.693 (3.85), 7.737 (4.97), 7.757 (4.10), 8.291 (1.04), 8.306 (2.17), 8.322 (1.03), 10.661 (3.00).
Example 204
Rac-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-Methyl[Biphenyl]-2-Carboxamide
(3040) ##STR00602##
(3041) To a solution of rac-5-(aminomethyl)-5-isopropylimidazolidine-2,4-dione hydrochloride (60.0 mg, 289 mol) and 4-methyl[1,1-biphenyl]-2-carboxylic acid (61.3 mg, 289 mol) in DMF (5.9 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (72.0 mg, 376 mol), 1-hydroxybenzotriazole hydrate (57.5 mg, 376 mol) and N,N-diisopropylethylamine (140 l, 810 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 99.4 mg (99% purity, 93% yield) of the desired product were obtained.
(3042) LC-MS (Method 8): R.sub.t=0.80 min; MS (ESIpos): m/z=366 [M+H].sup.+
(3043) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.794 (8.17), 0.805 (8.14), 0.873 (8.12), 0.884 (8.10), 1.822 (0.52), 1.833 (1.26), 1.844 (1.64), 1.856 (1.17), 1.867 (0.43), 2.322 (16.00), 3.355 (1.18), 3.365 (1.25), 3.377 (1.68), 3.388 (1.50), 3.473 (1.57), 3.483 (1.62), 3.495 (1.17), 3.506 (1.07), 7.186 (3.77), 7.199 (5.44), 7.249 (6.65), 7.263 (4.19), 7.325 (1.75), 7.339 (4.76), 7.353 (2.99), 7.360 (1.67), 7.372 (2.58), 7.384 (1.14), 7.461 (1.51), 7.463 (1.45), 7.473 (2.27), 7.475 (2.13), 7.486 (0.94), 7.488 (0.89), 7.663 (3.63), 8.199 (1.13), 8.209 (2.19), 8.219 (1.03), 10.648 (2.96).
Example 205
Ent-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-Methyl[Biphenyl]-2-Carboxamide
(3044) ##STR00603##
(3045) Enantiomeric separation of rac-N-[(4-isopropyl-2,5-dioxoimidazolidin-4-yl)methyl]-4-methyl[biphenyl]-2-carboxamide (99 mg) by preparative chiral SFC [column: Maisch Daicel AD-H 5 m, 25025 mm; eluent: carbon dioxide/methanol 75:25; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm] afforded 35.6 mg (100% purity) of the desired product.
(3046) Analytical chiral SFC: R.sub.t=2.26 min, e.e. =>99% [column: OJ 3 m, 1004.6 mm; eluent: carbon dioxide/methanol 80:20; flow rate: 3 ml/min; UV detection: 210 nm
(3047) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=366 [M+H].sup.+
(3048) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.98), 0.008 (1.11), 0.791 (8.11), 0.808 (8.43), 0.869 (8.03), 0.886 (8.38), 1.809 (0.45), 1.826 (1.23), 1.843 (1.65), 1.860 (1.16), 1.877 (0.42), 2.322 (16.00), 2.523 (0.66), 3.345 (1.26), 3.361 (1.19), 3.379 (1.75), 3.395 (1.58), 3.464 (1.55), 3.479 (1.65), 3.498 (1.03), 3.514 (0.98), 7.182 (3.23), 7.201 (6.02), 7.246 (7.72), 7.251 (2.25), 7.267 (3.97), 7.319 (1.16), 7.322 (1.40), 7.337 (6.36), 7.341 (3.18), 7.354 (4.61), 7.356 (4.54), 7.372 (2.91), 7.375 (2.17), 7.391 (1.25), 7.394 (0.98), 7.455 (1.80), 7.459 (1.78), 7.473 (2.36), 7.478 (2.07), 7.492 (0.84), 7.496 (0.94), 7.653 (3.50), 8.181 (0.96), 8.196 (2.07), 8.211 (0.98), 10.641 (2.81).
Example 206
Rac-5-Fluoro-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3049) ##STR00604##
(3050) To a solution of rac-5-(aminomethyl)-5-isopropylimidazolidine-2,4-dione hydrochloride (150 mg, 722 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (205 mg, 722 mol) in DMF (4.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (180 mg, 939 mol), 1-hydroxybenzotriazole hydrate (144 mg, 939 mol) and N,N-diisopropylethylamine (630 l, 3.6 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 198 mg (100% purity, 63% yield) of the desired product were obtained.
(3051) LC-MS (Method 7): R.sub.t=1.68 min, MS (ESIpos): m/z=438 [M+H].sup.+
(3052) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.48), 0.008 (0.48), 0.793 (15.41), 0.810 (16.00), 0.879 (15.25), 0.896 (15.95), 1.834 (0.86), 1.851 (2.37), 1.868 (3.12), 1.885 (2.21), 1.902 (0.81), 2.367 (0.48), 2.524 (1.62), 2.558 (0.75), 2.710 (0.48), 3.356 (2.69), 3.371 (2.53), 3.390 (3.23), 3.405 (2.96), 3.505 (2.80), 3.521 (2.96), 3.539 (2.05), 3.555 (1.94), 7.301 (2.21), 7.307 (6.41), 7.315 (1.13), 7.330 (9.64), 7.350 (2.86), 7.357 (1.94), 7.452 (3.34), 7.466 (3.02), 7.472 (3.07), 7.487 (2.32), 7.569 (7.60), 7.589 (8.94), 7.746 (6.46), 7.768 (9.43), 7.788 (7.70), 8.464 (1.94), 8.480 (4.04), 8.495 (1.94), 10.674 (5.49).
Example 207
Ent-5-Fluoro-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3053) ##STR00605##
(3054) Enantiomeric separation of rac-5-fluoro-N-[(4-isopropyl-2,5-dioxoimidazolidin-4-yl)methyl]-4-(trifluoromethyl)[biphenyl]-2-carboxamide (198 mg) by preparative chiral SFC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: carbon dioxide/isopropanol 82:18; flow rate: 80 ml/min; temperature: 40 C.; UV detection: 210 nm] afforded 63.6 mg (100% purity) of the desired product.
(3055) Analytical chiral SFC: R.sub.t=1.74 min, e.e. =>99% [column: Daicel ID 3 m, 1004.6 mm; eluent: carbon dioxide/isopropanol 80:20; flow rate: 3 ml/min; UV detection: 210 nm]
(3056) LC-MS (Method 7): R.sub.t=1.69 min; MS (ESIpos): m/z=438 [M+H].sup.+
(3057) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.798 (15.81), 0.809 (16.00), 0.881 (15.68), 0.893 (15.98), 1.843 (1.00), 1.855 (2.49), 1.866 (3.25), 1.877 (2.38), 1.889 (0.89), 3.264 (1.71), 3.332 (0.64), 3.368 (2.36), 3.378 (2.41), 3.391 (3.16), 3.401 (2.92), 3.508 (3.00), 3.519 (3.09), 3.530 (2.30), 3.541 (2.17), 7.303 (4.29), 7.316 (4.08), 7.319 (4.79), 7.325 (4.39), 7.339 (2.23), 7.459 (3.27), 7.469 (3.59), 7.472 (3.32), 7.482 (2.74), 7.573 (8.42), 7.587 (9.51), 7.716 (7.80), 7.767 (9.75), 7.780 (8.52), 8.436 (2.23), 8.447 (4.40), 8.457 (2.23), 10.654 (6.46).
Example 208
Rac-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3058) ##STR00606##
(3059) To a solution of rac-5-(aminomethyl)-5-isopropylimidazolidine-2,4-dione hydrochloride (150 mg, 722 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (192 mg, 722 mol) in DMF (4.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (180 mg, 939 mol), 1-hydroxybenzotriazole hydrate (144 mg, 939 mol) and N,N-diisopropylethylamine (630 l, 3.6 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 302 mg (100% purity, 99.6% yield) of the desired product were obtained.
(3060) LC-MS (Method 7): R.sub.t=1.62 min; MS (ESIpos): m/z=420 [M+H].sup.+
(3061) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.793 (15.36), 0.810 (16.00), 0.878 (15.18), 0.895 (15.90), 1.824 (0.87), 1.841 (2.35), 1.858 (3.13), 1.875 (2.22), 1.892 (0.80), 2.524 (0.58), 3.369 (2.14), 3.385 (2.24), 3.404 (3.19), 3.419 (2.90), 3.506 (2.84), 3.522 (3.01), 3.540 (2.00), 3.556 (1.89), 7.410 (2.61), 7.414 (3.25), 7.418 (4.08), 7.421 (4.39), 7.429 (6.12), 7.432 (6.36), 7.437 (5.81), 7.440 (6.26), 7.447 (3.50), 7.451 (3.36), 7.466 (5.29), 7.469 (4.24), 7.484 (2.43), 7.488 (1.98), 7.525 (3.67), 7.530 (3.62), 7.544 (5.56), 7.549 (8.22), 7.551 (8.26), 7.563 (3.09), 7.572 (9.00), 7.722 (6.24), 7.724 (6.26), 7.752 (9.22), 7.773 (7.60), 8.413 (1.91), 8.429 (4.00), 8.444 (1.91), 10.671 (5.35).
Example 209
Ent-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3062) ##STR00607##
(3063) Enantiomeric separation of rac-N-[(4-isopropyl-2,5-dioxoimidazolidin-4-yl)methyl]-4-(trifluoromethyl)[biphenyl]-2-carboxamide (302 mg) by preparative chiral SFC [column: Daicel Chiralpak AD-H 5 m SFC, 25030 mm; eluent: carbon dioxide/isopropanol 72:28; flow rate: 90 ml/min; temperature: 38 C.; UV detection: 210 nm] afforded 138 mg (99% purity) of the desired product.
(3064) Analytical chiral SFC: R.sub.t=2.76 min, e.e.=92.7% [column: AD-3, 504.6 mm; eluent: carbon dioxide (95%.fwdarw.50%)/isopropanol (5%.fwdarw.50%); flow rate: 3 ml/min; UV detection: 220 nm]
(3065) LC-MS (Method 8): R.sub.t=0.88 min; MS (ESIpos): m/z=420 [M+H].sup.+
(3066) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.007 (1.16), 0.008 (1.35), 0.793 (15.39), 0.810 (16.00), 0.878 (15.22), 0.896 (15.82), 0.988 (1.02), 1.003 (1.03), 1.030 (1.92), 1.046 (1.93), 1.236 (0.82), 1.824 (0.90), 1.841 (2.35), 1.858 (3.15), 1.875 (2.23), 1.892 (0.80), 3.369 (2.02), 3.384 (2.17), 3.403 (3.21), 3.419 (2.96), 3.506 (2.93), 3.522 (3.09), 3.541 (2.06), 3.556 (2.01), 7.414 (3.36), 7.421 (4.69), 7.429 (6.32), 7.432 (6.57), 7.439 (6.57), 7.450 (3.34), 7.466 (4.85), 7.485 (2.18), 7.526 (3.24), 7.529 (3.28), 7.551 (8.95), 7.572 (9.43), 7.724 (6.91), 7.752 (9.58), 7.773 (7.89), 8.414 (2.00), 8.429 (4.13), 8.444 (1.99), 10.671 (5.89).
Example 210
Ent-6-Fluoro-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3067) ##STR00608##
(3068) To a solution of ent-5-(aminomethyl)-5-isopropylimidazolidine-2,4-dione hydrochloride (100 mg, 482 mol) and 6-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (295 mg, 46% purity, 482 mol) in DMF (2.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (120 mg, 626 mol), 1-hydroxybenzotriazole hydrate (95.9 mg, 626 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and concentrated under reduced pressure. The crude product was first purified by preparative HPLC (Method 2f). A second purification by preparative HPLC (Method 4f) gave, after lyophilization, 26.2 mg (100% purity, 12% yield) of the desired product were obtained.
(3069) LC-MS (Method 7): R.sub.t=1.66 min; MS (ESIpos): m/z=438 [M+H].sup.+
(3070) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.766 (15.65), 0.779 (16.00), 0.845 (15.49), 0.859 (15.92), 1.775 (0.89), 1.789 (2.35), 1.802 (3.13), 1.816 (2.21), 1.830 (0.78), 3.332 (2.68), 3.347 (3.35), 3.360 (2.97), 3.423 (3.00), 3.436 (3.17), 3.450 (2.05), 3.463 (1.91), 7.246 (4.84), 7.248 (4.81), 7.261 (5.34), 7.263 (5.02), 7.408 (2.01), 7.410 (2.05), 7.424 (3.14), 7.427 (3.69), 7.430 (2.29), 7.444 (2.79), 7.446 (2.54), 7.506 (2.42), 7.517 (3.40), 7.523 (8.92), 7.534 (4.12), 7.539 (7.98), 7.549 (1.92), 7.713 (7.73), 7.774 (8.86), 7.791 (7.71), 8.427 (1.90), 8.439 (3.87), 8.452 (1.81), 10.665 (3.64).
Example 211
Ent-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(3071) ##STR00609##
(3072) To a solution of ent-5-(aminomethyl)-5-isopropylimidazolidine-2,4-dione hydrochloride (100 mg, 482 mol) and 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (154 mg, 578 mol) in DMF (4.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (120 mg, 626 mol), 1-hydroxybenzotriazole hydrate (95.9 mg, 626 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 129 mg (100% purity, 64% yield) of the desired product were obtained.
(3073) LC-MS (Method 8): R.sub.t=0.72 min, MS (ESIpos): m/z=421 [M+H].sup.+
(3074) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.799 (15.92), 0.810 (16.00), 0.885 (15.79), 0.897 (15.98), 1.859 (0.92), 1.870 (2.40), 1.882 (3.16), 1.893 (2.22), 1.904 (0.80), 2.069 (0.78), 2.383 (0.41), 2.422 (0.49), 2.469 (0.70), 2.514 (0.70), 2.517 (0.70), 2.520 (0.60), 2.611 (0.41), 2.651 (0.43), 3.262 (1.17), 3.371 (2.26), 3.381 (2.42), 3.394 (3.14), 3.404 (2.79), 3.513 (2.86), 3.524 (2.94), 3.536 (2.24), 3.547 (2.10), 7.475 (3.16), 7.477 (3.31), 7.488 (5.20), 7.490 (4.99), 7.507 (3.92), 7.519 (5.59), 7.524 (2.85), 7.534 (5.24), 7.536 (4.21), 7.547 (2.61), 7.549 (2.05), 7.583 (3.51), 7.586 (3.37), 7.596 (4.58), 7.598 (4.38), 7.608 (1.77), 7.611 (1.68), 7.719 (5.75), 7.929 (4.00), 7.943 (7.44), 7.970 (4.15), 7.973 (3.94), 7.983 (2.09), 7.987 (2.10), 8.485 (1.85), 8.496 (3.74), 8.506 (1.79), 8.732 (5.57), 8.735 (5.46), 10.651 (4.87).
Example 212
Ent-4-Fluoro-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3075) ##STR00610##
(3076) To a solution of ent-5-(aminomethyl)-5-isopropylimidazolidine-2,4-dione hydrochloride (100 mg, 482 mol) and 4-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (164 mg, 578 mol) in DMF (4.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (120 mg, 626 mol), 1-hydroxybenzotriazole hydrate (95.9 mg, 626 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 111 mg (100% purity, 53% yield) of the desired product were obtained.
(3077) LC-MS (Method 8): R.sub.t=0.86 min, MS (ESIpos): m/z=438 [M+H].sup.+
(3078) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.804 (15.73), 0.815 (16.00), 0.887 (15.60), 0.898 (15.93), 1.855 (0.90), 1.866 (2.34), 1.877 (3.13), 1.888 (2.25), 1.900 (0.82), 2.731 (0.43), 3.329 (0.52), 3.372 (2.22), 3.382 (2.43), 3.395 (3.11), 3.405 (2.83), 3.516 (2.85), 3.527 (2.98), 3.539 (2.24), 3.549 (2.13), 7.219 (3.27), 7.223 (3.72), 7.234 (3.26), 7.238 (3.50), 7.381 (1.58), 7.386 (1.65), 7.395 (3.56), 7.400 (3.64), 7.410 (2.14), 7.414 (2.14), 7.469 (3.74), 7.478 (3.87), 7.483 (3.03), 7.492 (2.75), 7.533 (7.55), 7.547 (8.15), 7.750 (14.62), 7.764 (7.65), 8.554 (1.93), 8.565 (3.85), 8.575 (1.86), 10.681 (4.90).
Example 213
Ent-4,5-Difluoro-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3079) ##STR00611##
(3080) To a solution of ent-5-(aminomethyl)-5-isopropylimidazolidine-2,4-dione hydrochloride (100 mg, 482 mol) and 4,5-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (175 mg, 578 mol) in DMF (4.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (120 mg, 626 mol), 1-hydroxybenzotriazole hydrate (95.9 mg, 626 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 125 mg (100% purity, 57% yield) of the desired product were obtained.
(3081) LC-MS (Method 8): R.sub.t=0.89 min, MS (ESIpos): m/z=456 [M+H].sup.+
(3082) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.804 (15.62), 0.815 (16.00), 0.886 (15.54), 0.897 (15.92), 1.857 (0.89), 1.869 (2.32), 1.880 (3.13), 1.891 (2.20), 1.903 (0.82), 2.514 (0.61), 2.517 (0.61), 2.520 (0.46), 3.259 (0.44), 3.261 (0.51), 3.263 (0.52), 3.366 (2.26), 3.376 (2.40), 3.389 (3.08), 3.399 (2.73), 3.512 (2.76), 3.523 (2.89), 3.535 (2.20), 3.546 (2.07), 7.451 (2.18), 7.465 (2.61), 7.469 (2.50), 7.482 (2.33), 7.551 (7.26), 7.564 (8.10), 7.570 (2.71), 7.583 (2.48), 7.590 (2.45), 7.602 (2.36), 7.767 (12.01), 7.780 (7.55), 8.559 (1.86), 8.569 (3.73), 8.580 (1.83), 10.684 (4.81).
Example 214
Ent-5,6-Difluoro-N-[(4-Isopropyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3083) ##STR00612##
(3084) To a solution of ent-5-(aminomethyl)-5-isopropylimidazolidine-2,4-dione hydrochloride (100 mg, 482 mol) and 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (175 mg, 578 mol) in DMF (3.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (120 mg, 626 mol), 1-hydroxybenzotriazole hydrate (95.9 mg, 626 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 9f). After lyophilization, 117 mg (100% purity, 53% yield) of the desired product were obtained.
(3085) LC-MS (Method 12): R.sub.t=2.78 min; MS (ESIpos): m/z=456 [M+H].sup.+
(3086) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (1.38), 0.771 (15.62), 0.782 (16.00), 0.848 (15.50), 0.859 (15.94), 1.790 (0.91), 1.802 (2.36), 1.813 (3.14), 1.825 (2.27), 1.836 (0.86), 2.518 (0.69), 3.281 (0.53), 3.332 (5.54), 3.345 (4.29), 3.355 (3.36), 3.424 (2.96), 3.435 (3.12), 3.447 (2.14), 3.457 (2.02), 7.270 (1.85), 7.278 (2.01), 7.285 (2.21), 7.292 (2.10), 7.554 (6.89), 7.567 (7.71), 7.587 (2.30), 7.603 (2.40), 7.617 (1.25), 7.692 (0.85), 7.702 (6.12), 7.803 (8.66), 7.817 (7.99), 8.426 (1.96), 8.436 (3.99), 8.446 (1.98), 10.653 (5.32).
Example 215
5-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Methyl[Biphenyl]-2-Carboxamide
(3087) ##STR00613##
(3088) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 5-chloro-4-methyl[1,1-biphenyl]-2-carboxylic acid (175 mg, 709 mol) in DMF (3.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (147 mg, 768 mol), 1-hydroxybenzotriazole hydrate (118 mg, 768 mol) and N,N-diisopropylethylamine (510 l, 2.9 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 124 mg (100% purity, 64% yield) of the desired product were obtained.
(3089) LC-MS (Method 7): R.sub.t=1.66 min; MS (ESIpos): m/z=398 [M+H].sup.+
(3090) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.42), 0.008 (1.24), 0.106 (0.71), 0.117 (1.27), 0.130 (1.31), 0.140 (0.94), 0.154 (0.42), 0.293 (0.45), 0.301 (0.80), 0.313 (0.99), 0.324 (0.95), 0.335 (0.72), 0.346 (0.55), 0.360 (0.46), 0.371 (0.81), 0.386 (0.88), 0.393 (1.22), 0.407 (1.01), 0.414 (0.99), 0.427 (1.25), 0.438 (1.23), 0.451 (1.15), 0.463 (0.70), 1.024 (0.42), 1.037 (0.85), 1.044 (0.91), 1.050 (0.67), 1.058 (1.56), 1.065 (0.64), 1.071 (0.83), 1.078 (0.74), 2.325 (16.00), 2.523 (0.91), 2.526 (0.70), 3.463 (2.86), 3.468 (2.84), 3.478 (2.74), 3.483 (2.72), 7.198 (3.41), 7.218 (6.01), 7.268 (7.63), 7.288 (4.15), 7.348 (3.79), 7.369 (5.20), 7.403 (4.32), 7.409 (5.06), 7.458 (3.41), 7.464 (2.82), 7.479 (2.40), 7.484 (2.16), 7.501 (4.18), 8.407 (1.03), 8.422 (2.20), 8.438 (1.02), 10.623 (2.99).
Example 216
5-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(3091) ##STR00614##
(3092) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 5-chloro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (213 mg, 709 mol) in DMF (3.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (147 mg, 768 mol), 1-hydroxybenzotriazole hydrate (118 mg, 768 mol) and N,N-diisopropylethylamine (510 l, 2.9 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 158 mg (99% purity, 71% yield) of the desired product were obtained.
(3093) LC-MS (Method 7): R.sub.t=1.78 min, MS (ESIpos): m/z=452 [M+H].sup.+
(3094) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.008 (0.45), 0.248 (0.43), 0.310 (0.46), 0.318 (0.43), 0.923 (0.52), 2.350 (5.08), 2.389 (11.86), 3.145 (16.00), 3.346 (0.90), 3.352 (1.02), 3.355 (0.96), 3.362 (0.83), 7.299 (1.07), 7.312 (1.33), 7.365 (1.37), 7.368 (1.39), 7.388 (1.35), 7.409 (0.88), 7.412 (0.72), 7.425 (1.94), 7.438 (1.63), 7.615 (1.66), 7.628 (1.44), 8.457 (0.76), 10.486 (1.11).
Example 217
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Methanesulfonyl)[1,1-Biphenyl]-2-Carboxamide
(3095) ##STR00615##
(3096) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 4-(methanesulfonyl)[1,1-biphenyl]-2-carboxylic acid (196 mg, 709 mol) in DMF (3.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (147 mg, 768 mol), 1-hydroxybenzotriazole hydrate (118 mg, 768 mol) and N,N-diisopropylethylamine (510 l, 2.9 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 147 mg (100% purity, 71% yield) of the desired product were obtained.
(3097) LC-MS (Method 7): R.sub.t=1.06 min, MS (ESIpos): m/z=428 [M+H].sup.+
(3098) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.122 (0.44), 0.133 (0.80), 0.145 (0.88), 0.156 (0.59), 0.316 (0.50), 0.329 (0.63), 0.339 (0.59), 0.351 (0.48), 0.383 (0.50), 0.397 (0.55), 0.405 (0.75), 0.419 (0.59), 0.446 (0.67), 0.458 (0.79), 0.471 (0.75), 0.483 (0.46), 1.061 (0.54), 1.068 (0.57), 1.074 (0.41), 1.081 (0.99), 1.089 (0.41), 1.094 (0.53), 1.102 (0.48), 2.523 (0.84), 3.255 (16.00), 3.507 (1.86), 3.511 (1.86), 3.522 (1.78), 3.527 (1.78), 7.433 (1.39), 7.442 (0.99), 7.452 (2.09), 7.456 (2.18), 7.460 (2.14), 7.468 (1.20), 7.471 (1.16), 7.486 (1.73), 7.488 (1.42), 7.505 (0.82), 7.508 (0.76), 7.522 (2.45), 7.537 (1.30), 7.542 (1.20), 7.556 (1.39), 7.560 (1.34), 7.574 (0.62), 7.579 (0.68), 7.587 (3.90), 7.592 (1.39), 7.604 (1.48), 7.608 (4.35), 7.936 (4.35), 7.940 (1.39), 7.952 (1.37), 7.957 (3.81), 8.542 (0.67), 8.558 (1.43), 8.573 (0.66), 10.641 (1.83).
Example 218
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Methyl-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3099) ##STR00616##
(3100) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol) and 5-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (68.1 mg, 243 mol) in DMF (3.3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (60.6 mg, 316 mol), 1-hydroxybenzotriazole hydrate (48.4 mg, 316 mol) and N,N-diisopropylethylamine (120 l, 680 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 83.5 mg (100% purity, 80% yield) of the desired product were obtained.
(3101) LC-MS (Method 7): R.sub.t=1.75 min, MS (ESIpos): m/z=432 [M+H].sup.+
(3102) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.122 (0.72), 0.130 (1.25), 0.138 (1.28), 0.146 (0.90), 0.155 (0.41), 0.303 (0.43), 0.309 (0.81), 0.316 (1.00), 0.323 (0.89), 0.332 (0.67), 0.339 (0.48), 0.370 (0.41), 0.377 (0.73), 0.384 (0.80), 0.386 (0.81), 0.392 (1.13), 0.401 (0.86), 0.406 (0.52), 0.441 (0.43), 0.449 (0.95), 0.457 (1.26), 0.466 (1.20), 0.474 (0.79), 1.042 (0.43), 1.051 (0.84), 1.056 (0.91), 1.060 (0.61), 1.065 (1.56), 1.070 (0.61), 1.074 (0.82), 1.079 (0.78), 2.383 (16.00), 3.462 (0.87), 3.472 (0.98), 3.485 (1.98), 3.495 (1.78), 3.516 (1.84), 3.527 (1.95), 3.538 (0.93), 3.550 (0.88), 7.250 (3.85), 7.268 (1.75), 7.281 (2.28), 7.351 (4.18), 7.364 (3.03), 7.507 (4.70), 7.529 (4.06), 7.543 (4.41), 7.739 (4.66), 7.753 (4.08), 8.442 (1.10), 8.453 (2.12), 8.463 (1.08), 10.648 (2.72).
Example 219
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Fluoro-4-Methyl[Biphenyl]-2-Carboxamide
(3103) ##STR00617##
(3104) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 4-fluoro-4-methyl[1,1-biphenyl]-2-carboxylic acid (134 mg, 584 mol) in DMF (3.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred for 2 days at 40 C. and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 122.5 mg (99% purity, 65% yield) of the desired product were obtained.
(3105) LC-MS (Method 7): R.sub.t=1.51 min, MS (ESIpos): m/z=382 [M+H].sup.+
(3106) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.119 (0.78), 0.126 (1.26), 0.135 (1.27), 0.143 (0.90), 0.312 (0.85), 0.319 (1.06), 0.327 (0.92), 0.334 (0.65), 0.342 (0.44), 0.378 (0.41), 0.386 (0.74), 0.395 (0.83), 0.401 (1.19), 0.410 (0.88), 0.416 (0.55), 0.435 (0.46), 0.443 (1.01), 0.451 (1.24), 0.459 (1.19), 0.468 (0.81), 1.045 (0.42), 1.054 (0.83), 1.059 (0.88), 1.067 (1.50), 1.076 (0.81), 1.081 (0.74), 2.316 (16.00), 2.327 (1.31), 2.501 (15.88), 3.302 (0.44), 3.363 (0.90), 3.458 (0.48), 3.471 (2.41), 3.478 (2.96), 3.488 (2.35), 3.500 (0.41), 3.511 (0.41), 7.146 (1.61), 7.150 (1.82), 7.161 (1.63), 7.165 (1.73), 7.182 (3.36), 7.196 (5.95), 7.228 (6.88), 7.241 (3.70), 7.314 (0.80), 7.319 (0.80), 7.328 (1.75), 7.333 (1.79), 7.343 (1.10), 7.347 (1.10), 7.385 (1.93), 7.394 (2.00), 7.399 (1.43), 7.408 (1.26), 7.539 (3.98), 8.489 (1.08), 8.499 (2.14), 8.509 (1.04), 10.656 (2.55).
Example 220
4-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}[1,1-Biphenyl]-2-Carboxamide
(3107) ##STR00618##
(3108) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (70.0 mg, 340 mol) and 4-chloro[1,1-biphenyl]-2-carboxylic acid (79.2 mg, 340 mol) in DMF (7.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (84.8 mg, 443 mol), 1-hydroxybenzotriazole hydrate (67.8 mg, 443 mol) and N,N-diisopropylethylamine (170 l, 950 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 89.4 mg (100% purity, 68% yield)
(3109) LC-MS (Method 8): R.sub.t=0.85 min, MS (ESIpos): m/z=384 [M+H].sup.+
(3110) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.106 (0.55), 0.120 (1.40), 0.131 (2.37), 0.144 (2.53), 0.155 (1.82), 0.167 (0.82), 0.291 (0.46), 0.313 (1.50), 0.326 (1.94), 0.336 (1.84), 0.347 (1.39), 0.358 (1.03), 0.372 (0.83), 0.383 (1.45), 0.397 (1.66), 0.405 (2.29), 0.419 (1.75), 0.433 (1.21), 0.447 (2.05), 0.458 (2.36), 0.471 (2.27), 0.483 (1.40), 0.497 (0.50), 1.036 (0.73), 1.049 (1.54), 1.056 (1.68), 1.069 (2.84), 1.077 (1.21), 1.083 (1.57), 1.090 (1.41), 1.103 (0.63), 3.459 (0.59), 3.474 (0.76), 3.493 (4.70), 3.501 (5.12), 3.508 (5.03), 3.517 (4.65), 3.535 (0.75), 3.551 (0.67), 7.353 (8.99), 7.375 (16.00), 7.399 (11.34), 7.425 (4.97), 7.444 (15.56), 7.466 (8.80), 7.490 (3.26), 7.495 (3.32), 7.508 (12.54), 7.526 (1.69), 7.531 (1.64), 8.444 (1.91), 8.459 (3.99), 8.474 (1.90), 10.629 (1.65).
Example 221
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-3-Fluoro-4-Methyl[1,1-Biphenyl]-2-Carboxamide
(3111) ##STR00619##
(3112) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol) and 3-fluoro-4-methyl[1,1-biphenyl]-2-carboxylic acid (56.0 mg, 243 mol) in DMF (2.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (60.6 mg, 316 mol), 1-hydroxybenzotriazole hydrate (48.4 mg, 316 mol) and N,N-diisopropylethylamine (120 l, 680 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 77.5 mg (100% purity, 84% yield) of the desired product were obtained.
(3113) LC-MS (Method 8): R.sub.t=0.82 min, MS (ESIpos): m/z=382 [M+H].sup.+
(3114) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.13), 0.007 (1.26), 0.006 (1.56), 0.008 (2.36), 0.096 (0.52), 0.109 (1.15), 0.120 (2.08), 0.133 (2.18), 0.145 (1.64), 0.157 (0.73), 0.279 (0.45), 0.294 (0.75), 0.301 (1.28), 0.314 (1.61), 0.325 (1.53), 0.336 (1.18), 0.347 (0.88), 0.366 (0.73), 0.377 (1.31), 0.388 (1.30), 0.392 (1.38), 0.399 (1.99), 0.413 (1.79), 0.431 (1.88), 0.442 (2.03), 0.455 (1.88), 0.467 (1.16), 1.034 (0.68), 1.047 (1.41), 1.055 (1.48), 1.061 (1.05), 1.068 (2.61), 1.076 (1.01), 1.081 (1.36), 1.089 (1.25), 1.102 (0.53), 2.247 (16.00), 2.250 (15.85), 2.322 (0.45), 2.327 (0.63), 2.332 (0.45), 2.366 (0.53), 2.523 (2.34), 2.665 (0.45), 2.669 (0.61), 2.674 (0.47), 2.709 (0.52), 3.453 (0.55), 3.472 (4.74), 3.477 (4.75), 3.488 (4.59), 3.493 (4.64), 3.511 (0.52), 3.527 (0.43), 7.072 (3.09), 7.077 (3.61), 7.092 (3.51), 7.096 (4.45), 7.113 (3.57), 7.118 (2.79), 7.141 (3.32), 7.145 (2.99), 7.266 (2.28), 7.286 (4.10), 7.306 (1.96), 7.348 (2.46), 7.352 (2.66), 7.367 (5.02), 7.370 (4.74), 7.379 (3.34), 7.381 (3.71), 7.398 (6.58), 7.401 (7.54), 7.416 (5.13), 7.419 (3.77), 7.435 (2.48), 7.438 (1.89), 7.477 (3.56), 7.481 (3.64), 7.495 (10.72), 7.499 (5.65), 7.514 (1.78), 7.518 (1.60), 8.366 (1.63), 8.381 (3.52), 8.396 (1.63), 10.618 (2.53).
Example 222
3-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Methyl[1,1-Biphenyl]-2-Carboxamide
(3115) ##STR00620##
(3116) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol) and 3-chloro-4-methyl[1,1-biphenyl]-2-carboxylic acid (60.0 mg, 243 mol) in DMF (3.3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (60.6 mg, 316 mol), 1-hydroxybenzotriazole hydrate (48.4 mg, 316 mol) and N,N-diisopropylethylamine (120 l, 680 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 46.6 mg (100% purity, 48% yield) of the desired product were obtained.
(3117) LC-MS (Method 7): R.sub.t=1.53 min, MS (ESIpos): m/z=398 [M+H].sup.+
(3118) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.100 (0.73), 0.108 (1.26), 0.117 (1.26), 0.124 (0.90), 0.279 (0.81), 0.286 (1.02), 0.293 (0.92), 0.302 (0.67), 0.309 (0.49), 0.327 (0.43), 0.335 (0.73), 0.342 (0.81), 0.349 (1.11), 0.358 (0.82), 0.364 (0.47), 0.424 (0.90), 0.432 (1.20), 0.440 (1.13), 0.448 (0.76), 0.969 (0.42), 0.977 (0.83), 0.982 (0.91), 0.991 (1.52), 1.000 (0.81), 1.005 (0.74), 2.320 (16.00), 7.190 (3.95), 7.203 (5.07), 7.266 (2.10), 7.271 (2.02), 7.277 (2.34), 7.281 (2.46), 7.292 (6.35), 7.306 (4.71), 7.418 (1.13), 7.426 (4.13), 7.431 (4.47), 7.438 (4.32), 7.442 (8.05), 7.451 (0.79), 8.573 (1.07), 8.583 (2.17), 8.594 (1.04), 10.539 (2.67).
Example 223
4-Cyano-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}[1,1-Biphenyl]-2-Carboxamide
(3119) ##STR00621##
(3120) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (70.0 mg, 340 mol) and 4-cyano[1,1-biphenyl]-2-carboxylic acid (76.0 mg, 340 mol) in DMF (7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (84.8 mg, 443 mol), 1-hydroxybenzotriazole hydrate (67.8 mg, 443 mol) and N,N-diisopropylethylamine (170 l, 950 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 101 mg (100% purity, 80% yield) of the desired product were obtained.
(3121) LC-MS (Method 8): R.sub.t=0.75 min, MS (ESIpos): m/z=375 [M+H].sup.+
(3122) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.109 (0.45), 0.123 (1.09), 0.133 (1.94), 0.147 (2.10), 0.157 (1.45), 0.170 (0.67), 0.311 (0.66), 0.319 (1.20), 0.332 (1.51), 0.343 (1.45), 0.354 (1.12), 0.364 (0.86), 0.377 (0.72), 0.388 (1.19), 0.402 (1.33), 0.410 (1.83), 0.424 (1.43), 0.438 (0.97), 0.452 (1.62), 0.463 (1.92), 0.476 (1.84), 0.488 (1.14), 1.046 (0.63), 1.060 (1.30), 1.067 (1.38), 1.073 (1.00), 1.080 (2.42), 1.088 (0.96), 1.093 (1.29), 1.101 (1.16), 1.114 (0.50), 2.073 (0.73), 3.462 (0.42), 3.477 (0.58), 3.497 (4.12), 3.502 (4.23), 3.512 (4.08), 3.518 (4.02), 3.536 (0.53), 3.552 (0.47), 7.423 (3.24), 7.432 (1.94), 7.440 (4.40), 7.442 (4.62), 7.450 (4.98), 7.454 (5.05), 7.462 (2.76), 7.465 (2.78), 7.480 (4.13), 7.483 (3.49), 7.499 (2.00), 7.502 (1.92), 7.517 (16.00), 7.538 (11.58), 7.549 (3.67), 7.554 (3.43), 7.568 (1.39), 7.572 (1.28), 7.848 (10.12), 7.853 (3.38), 7.865 (3.13), 7.869 (9.09), 8.537 (1.55), 8.553 (3.30), 8.568 (1.55), 10.627 (1.00).
Example 224
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(3123) ##STR00622##
(3124) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (130 mg, 486 mol) in DMF (4.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (240 l, 1.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 157 mg (99% purity, 76% yield) of the desired product were obtained.
(3125) LC-MS (Method 7): R.sub.t=1.34 min, MS (ESIpos): m/z=419 [M+H].sup.+
(3126) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.116 (0.98), 0.125 (2.48), 0.133 (3.89), 0.141 (3.95), 0.149 (2.91), 0.157 (1.21), 0.303 (0.88), 0.318 (2.71), 0.325 (3.43), 0.332 (3.04), 0.339 (2.19), 0.348 (1.37), 0.381 (1.24), 0.389 (2.35), 0.396 (2.78), 0.403 (3.76), 0.412 (2.78), 0.427 (0.98), 0.445 (1.37), 0.453 (3.13), 0.462 (4.02), 0.470 (3.76), 0.478 (2.55), 0.487 (0.88), 1.061 (1.21), 1.070 (2.55), 1.075 (2.87), 1.084 (4.54), 1.092 (2.58), 1.097 (2.25), 1.106 (1.01), 2.574 (0.56), 2.731 (0.42), 2.890 (0.46), 3.305 (1.11), 3.367 (2.38), 3.397 (0.42), 3.473 (2.35), 3.483 (2.55), 3.496 (5.91), 3.506 (5.45), 3.521 (5.55), 3.532 (5.75), 3.544 (2.45), 3.555 (2.35), 7.507 (4.64), 7.520 (16.00), 7.534 (13.19), 7.547 (8.29), 7.559 (15.09), 7.592 (5.39), 7.605 (6.86), 7.617 (2.58), 7.931 (5.39), 7.945 (12.77), 7.962 (8.13), 7.976 (3.43), 8.628 (3.43), 8.639 (6.56), 8.649 (3.27), 8.739 (10.84), 10.661 (9.47).
Example 225
3-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Methyl[1,1-Biphenyl]-2-Carboxamide
(3127) ##STR00623##
(3128) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (50.0 mg, 243 mol) and 3-chloro-4-methyl[1,1-biphenyl]-2-carboxylic acid (60.0 mg, 243 mol) in DMF (2.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (60.6 mg, 316 mol), 1-hydroxybenzotriazole hydrate (48.4 mg, 316 mol) and N,N-diisopropylethylamine (120 l, 680 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 56.5 mg (100% purity, 58% yield) of the desired product were obtained.
(3129) LC-MS (Method 7): R.sub.t=1.65 min, MS (ESIpos): m/z=398 [M+H].sup.+
(3130) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.110 (0.66), 0.121 (1.17), 0.134 (1.19), 0.145 (0.89), 0.302 (0.72), 0.315 (0.90), 0.327 (0.86), 0.348 (0.51), 0.380 (0.73), 0.394 (0.80), 0.402 (1.15), 0.416 (1.22), 0.431 (1.06), 0.442 (1.18), 0.455 (1.07), 0.466 (0.67), 1.037 (0.41), 1.050 (0.79), 1.058 (0.86), 1.071 (1.47), 1.084 (0.77), 1.091 (0.73), 2.344 (16.00), 2.366 (0.46), 3.435 (0.41), 3.450 (0.46), 3.470 (2.13), 3.482 (3.04), 3.497 (2.13), 3.515 (0.46), 3.532 (0.41), 7.203 (1.80), 7.208 (1.88), 7.223 (2.27), 7.227 (2.38), 7.350 (3.20), 7.359 (1.80), 7.371 (2.95), 7.375 (3.33), 7.378 (3.04), 7.385 (2.34), 7.397 (4.59), 7.402 (6.54), 7.424 (2.82), 7.427 (2.18), 7.443 (1.39), 7.446 (1.08), 7.482 (1.90), 7.486 (1.96), 7.500 (6.09), 7.519 (0.95), 7.523 (0.88), 8.392 (0.94), 8.407 (1.94), 8.423 (0.95), 10.624 (0.82).
Example 226
3-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(3131) ##STR00624##
(3132) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (60.0 mg, 292 mol) and 3-chloro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (87.7 mg, 292 mol) in DMF (4 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (72.7 mg, 379 mol), 1-hydroxybenzotriazole hydrate (58.1 mg, 379 mol) and N,N-diisopropylethylamine (140 l, 820 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 99.1 mg (100% purity, 75% yield) of the desired product were obtained.
(3133) LC-MS (Method 7): R.sub.t=1.75 min, MS (ESIpos): m/z=452 [M+H].sup.+
(3134) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.111 (0.75), 0.124 (1.81), 0.135 (3.25), 0.148 (3.41), 0.159 (2.42), 0.172 (1.10), 0.291 (0.64), 0.305 (1.10), 0.313 (2.03), 0.325 (2.56), 0.336 (2.38), 0.347 (1.87), 0.358 (1.39), 0.372 (1.17), 0.383 (2.01), 0.398 (2.19), 0.406 (3.02), 0.419 (2.33), 0.427 (1.42), 0.438 (1.58), 0.451 (2.58), 0.462 (3.18), 0.475 (3.02), 0.487 (1.90), 0.500 (0.69), 1.052 (1.05), 1.065 (2.15), 1.073 (2.29), 1.078 (1.69), 1.086 (3.95), 1.094 (1.65), 1.099 (2.15), 1.107 (1.92), 1.120 (0.82), 2.890 (0.43), 3.464 (1.19), 3.479 (1.44), 3.499 (5.65), 3.513 (9.71), 3.528 (5.58), 3.546 (1.37), 3.563 (1.26), 7.449 (8.43), 7.468 (11.47), 7.472 (10.15), 7.491 (9.74), 7.494 (11.22), 7.509 (7.43), 7.512 (5.33), 7.527 (4.14), 7.531 (3.22), 7.546 (16.00), 7.564 (5.94), 7.568 (5.42), 7.583 (2.03), 7.587 (1.78), 7.689 (9.46), 7.877 (8.57), 7.898 (7.95), 8.571 (2.58), 8.587 (5.39), 8.602 (2.58), 10.651 (6.81).
Example 227
3,4-Dichloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}[1,1-Biphenyl]-2-Carboxamide
(3135) ##STR00625##
(3136) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 3,4-dichloro[1,1-biphenyl]-2-carboxylic acid (130 mg, 486 mol) in DMF (4.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (240 l, 1.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 48.0 mg (100% purity, 24% yield) of the desired product were obtained.
(3137) LC-MS (Method 11): R.sub.t=1.16 min, MS (ESIneg): m/z=416 [MH].sup.
(3138) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.117 (0.49), 0.125 (1.13), 0.133 (1.82), 0.141 (1.85), 0.149 (1.33), 0.158 (0.57), 0.304 (0.44), 0.319 (1.22), 0.327 (1.54), 0.334 (1.36), 0.341 (0.96), 0.349 (0.64), 0.386 (0.57), 0.394 (1.06), 0.402 (1.22), 0.409 (1.73), 0.418 (1.30), 0.423 (0.81), 0.433 (0.51), 0.442 (0.66), 0.451 (1.45), 0.459 (1.81), 0.467 (1.72), 0.475 (1.16), 1.058 (0.61), 1.066 (1.18), 1.071 (1.30), 1.080 (2.14), 1.089 (1.19), 1.094 (1.07), 1.103 (0.48), 1.756 (0.44), 3.468 (2.70), 3.478 (4.10), 3.491 (9.66), 3.502 (16.00), 3.512 (13.44), 7.288 (2.91), 7.291 (2.90), 7.302 (3.09), 7.305 (3.12), 7.401 (2.75), 7.413 (4.13), 7.428 (3.27), 7.441 (4.23), 7.452 (1.96), 7.465 (3.72), 7.477 (1.91), 7.515 (2.42), 7.529 (3.50), 7.539 (5.85), 7.603 (5.86), 7.606 (5.72), 7.647 (5.70), 7.661 (5.23), 8.500 (1.58), 8.510 (3.13), 8.520 (1.54), 10.650 (4.39).
Example 228
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-(6-Methylpyridin-3-Yl)Benzamide
(3139) ##STR00626##
(3140) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 2-(6-methylpyridin-3-yl)benzoic acid (104 mg, 486 mol) in DMF (4.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (240 l, 1.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 5f). After lyophilization, 21.4 mg (100% purity, 12% yield) of the desired product were obtained.
(3141) LC-MS (Method 12): R.sub.t=0.97 min, MS (ESIpos): m/z=365 [M+H].sup.+
(3142) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.36), 0.008 (1.33), 0.103 (0.68), 0.115 (1.21), 0.128 (1.26), 0.139 (0.92), 0.152 (0.41), 0.301 (0.77), 0.315 (0.97), 0.325 (0.94), 0.336 (0.68), 0.346 (0.53), 0.380 (0.77), 0.394 (0.85), 0.401 (1.23), 0.415 (1.19), 0.424 (1.40), 0.436 (1.43), 0.449 (1.09), 0.461 (0.68), 1.051 (0.80), 1.059 (0.87), 1.072 (1.50), 1.085 (0.80), 1.092 (0.70), 2.328 (16.00), 2.366 (0.56), 2.669 (0.46), 2.710 (0.53), 3.449 (0.41), 3.468 (2.44), 3.476 (2.61), 3.483 (2.57), 3.491 (2.40), 7.411 (3.15), 7.430 (5.47), 7.453 (1.48), 7.469 (2.57), 7.490 (1.36), 7.501 (3.87), 7.521 (1.77), 7.525 (1.72), 7.540 (2.13), 7.544 (2.03), 7.562 (2.61), 7.567 (3.24), 8.341 (3.17), 8.346 (3.22), 8.361 (2.98), 8.365 (2.95), 8.414 (0.99), 8.429 (2.06), 8.445 (0.99), 10.625 (2.64).
Example 229
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-3-Fluoro-4-Methyl[1,1-Biphenyl]-2-Carboxamide
(3143) ##STR00627##
(3144) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 3-fluoro-4-methyl[1,1-biphenyl]-2-carboxylic acid (112 mg, 486 mol) in DMF (2.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 118 mg (98% purity, 62% yield) of the desired product were obtained.
(3145) LC-MS (Method 7): R.sub.t=1.46 min; MS (ESIpos): m/z=382 [M+H].sup.+
(3146) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.41), 0.008 (0.42), 0.099 (0.75), 0.110 (1.30), 0.123 (1.38), 0.134 (0.99), 0.147 (0.49), 0.273 (0.43), 0.282 (0.83), 0.294 (1.04), 0.304 (1.03), 0.316 (0.81), 0.327 (1.03), 0.338 (0.85), 0.351 (0.95), 0.360 (1.23), 0.374 (0.91), 0.382 (0.51), 0.400 (0.56), 0.414 (1.03), 0.425 (1.30), 0.438 (1.25), 0.450 (0.77), 0.976 (0.41), 0.990 (0.85), 0.997 (0.91), 1.002 (0.68), 1.010 (1.54), 1.018 (0.66), 1.023 (0.84), 1.031 (0.75), 2.072 (0.53), 2.322 (16.00), 3.372 (1.16), 3.387 (1.21), 3.407 (1.67), 3.421 (1.57), 3.535 (1.58), 3.550 (1.70), 3.569 (1.19), 3.584 (1.11), 7.175 (2.91), 7.194 (4.63), 7.200 (4.24), 7.220 (6.00), 7.235 (1.67), 7.297 (6.93), 7.317 (4.54), 7.432 (4.86), 7.442 (1.45), 7.458 (1.30), 7.463 (1.80), 7.477 (1.73), 7.482 (1.08), 7.497 (0.87), 8.610 (1.05), 8.624 (2.17), 8.639 (1.03), 10.556 (0.60).
Example 230
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-3-Fluoro-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(3147) ##STR00628##
(3148) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and (3-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (138 mg, 486 mol) in DMF (2.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 150 mg (100% purity, 71% yield) of the desired product were obtained.
(3149) LC-MS (Method 7): R.sub.t=1.60 min; MS (ESIpos): m/z=436 [M+H].sup.+
(3150) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.48), 0.008 (3.94), 0.008 (3.80), 0.102 (0.99), 0.115 (2.32), 0.126 (4.19), 0.139 (4.47), 0.149 (3.16), 0.162 (1.42), 0.271 (0.80), 0.285 (1.31), 0.293 (2.66), 0.305 (3.23), 0.314 (3.26), 0.328 (2.64), 0.337 (3.44), 0.347 (2.78), 0.361 (3.05), 0.369 (3.81), 0.383 (2.93), 0.391 (1.56), 0.405 (0.98), 0.421 (1.51), 0.435 (3.25), 0.445 (4.29), 0.458 (4.06), 0.470 (2.45), 0.483 (0.85), 0.994 (1.37), 1.007 (2.75), 1.015 (2.94), 1.020 (2.15), 1.028 (5.06), 1.036 (2.09), 1.041 (2.68), 1.048 (2.41), 1.061 (1.05), 2.327 (0.46), 2.366 (0.66), 2.523 (1.90), 2.670 (0.46), 2.710 (0.64), 3.391 (3.57), 3.405 (3.78), 3.425 (5.02), 3.440 (4.74), 3.578 (4.93), 3.593 (5.37), 3.612 (4.01), 3.628 (3.65), 7.263 (9.22), 7.280 (9.74), 7.282 (10.36), 7.296 (4.10), 7.298 (4.19), 7.319 (8.39), 7.340 (4.93), 7.516 (4.59), 7.530 (15.11), 7.535 (8.14), 7.551 (5.75), 7.556 (3.80), 7.570 (3.19), 7.601 (12.86), 7.621 (15.38), 7.780 (16.00), 7.800 (12.91), 8.800 (3.37), 8.815 (7.01), 8.829 (3.33), 10.615 (9.81).
Example 231
3,4-Dichloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazoidin-4-Yl]Methyl}[1,1-Biphenyl]-2-Carboxamide
(3151) ##STR00629##
(3152) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 3,4-dichloro[1,1-biphenyl]-2-carboxylicacid (130 mg, 486 mol) in DMF (2.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 31.1 mg (99% purity, 15% yield) of the desired product were obtained.
(3153) LC-MS (Method 7): R.sub.t=1.55 min, MS (ESIpos): m/z=418 [M+H].sup.+
(3154) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.13), 0.008 (2.17), 0.094 (0.45), 0.108 (1.10), 0.119 (1.96), 0.132 (2.08), 0.142 (1.47), 0.155 (0.67), 0.283 (0.63), 0.291 (1.27), 0.302 (1.57), 0.312 (1.57), 0.325 (1.26), 0.335 (1.61), 0.345 (1.30), 0.358 (1.49), 0.367 (1.80), 0.380 (1.37), 0.388 (0.73), 0.403 (0.45), 0.424 (0.68), 0.438 (1.49), 0.448 (2.01), 0.461 (1.90), 0.473 (1.17), 0.486 (0.41), 0.973 (0.64), 0.986 (1.30), 0.993 (1.39), 0.999 (1.03), 1.006 (2.33), 1.019 (1.26), 1.027 (1.13), 1.040 (0.49), 2.523 (1.05), 3.338 (1.52), 3.352 (1.35), 3.503 (1.09), 3.518 (1.17), 3.537 (0.90), 3.551 (0.80), 7.294 (3.49), 7.298 (3.65), 7.311 (4.45), 7.316 (4.37), 7.399 (6.48), 7.404 (2.62), 7.415 (3.62), 7.420 (14.08), 7.426 (2.41), 7.441 (2.59), 7.458 (16.00), 7.479 (12.83), 7.486 (8.80), 7.492 (7.63), 7.502 (2.68), 7.506 (1.59), 8.653 (1.59), 8.668 (3.33), 8.683 (1.57), 10.550 (1.27).
Example 232
4,5-Dichloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}[1,1-Biphenyl]-2-Carboxamide
(3155) ##STR00630##
(3156) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 4,5-dichloro[1,1-biphenyl]-2-carboxylicacid (130 mg, 486 mol) in DMF (2.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 129 mg (98% purity, 62% yield) of the desired product were obtained.
(3157) LC-MS (Method 7): R.sub.t=1.70 min, MS (ESIpos): m/z=418 [M+H].sup.+
(3158) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (2.05), 0.008 (1.98), 0.106 (0.45), 0.119 (1.07), 0.130 (1.92), 0.143 (2.05), 0.154 (1.42), 0.167 (0.66), 0.307 (0.65), 0.315 (1.20), 0.327 (1.49), 0.338 (1.43), 0.349 (1.13), 0.360 (0.88), 0.370 (0.75), 0.381 (1.22), 0.395 (1.34), 0.403 (1.78), 0.417 (1.39), 0.425 (0.84), 0.435 (0.91), 0.448 (1.53), 0.459 (1.90), 0.472 (1.80), 0.484 (1.11), 1.037 (0.62), 1.050 (1.26), 1.058 (1.36), 1.064 (0.99), 1.071 (2.34), 1.079 (0.95), 1.084 (1.26), 1.092 (1.12), 1.105 (0.51), 2.523 (1.01), 3.466 (0.53), 3.485 (4.14), 3.490 (4.17), 3.500 (4.01), 3.506 (4.01), 3.524 (0.51), 3.541 (0.45), 7.366 (0.92), 7.372 (7.96), 7.377 (3.08), 7.394 (15.10), 7.400 (2.24), 7.412 (8.12), 7.460 (16.00), 7.463 (10.79), 7.476 (2.96), 7.481 (7.95), 7.488 (1.07), 7.507 (5.34), 7.512 (4.38), 7.527 (3.78), 7.533 (3.52), 7.546 (6.92), 8.537 (1.51), 8.553 (3.24), 8.568 (1.52), 10.640 (3.59).
Example 233
4-Chloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Fluoro[1,1-Biphenyl]-2-Carboxamide
(3159) ##STR00631##
(3160) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 4-chloro-4-fluoro[1,1-biphenyl]-2-carboxylic acid (122 mg, 486 mol) in DMF (2.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 126 mg (100% purity, 64% yield) of the desired product were obtained.
(3161) LC-MS (Method 7): R.sub.t=1.56 min, MS (ESIpos): m/z=402 [M+H].sup.+
(3162) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.57), 0.008 (1.60), 0.113 (0.59), 0.126 (1.42), 0.137 (2.51), 0.150 (2.65), 0.161 (1.87), 0.174 (0.85), 0.297 (0.49), 0.312 (0.86), 0.320 (1.60), 0.332 (2.00), 0.342 (1.88), 0.354 (1.46), 0.365 (1.11), 0.376 (0.96), 0.387 (1.54), 0.401 (1.74), 0.409 (2.35), 0.423 (1.82), 0.431 (1.04), 0.445 (1.49), 0.459 (1.99), 0.470 (2.50), 0.483 (2.38), 0.495 (1.48), 0.508 (0.51), 1.046 (0.79), 1.060 (1.64), 1.067 (1.77), 1.072 (1.31), 1.080 (3.03), 1.088 (1.27), 1.093 (1.63), 1.101 (1.49), 1.114 (0.65), 2.366 (0.45), 2.523 (1.08), 2.709 (0.45), 3.456 (0.58), 3.471 (0.76), 3.491 (5.11), 3.497 (5.28), 3.506 (5.17), 3.513 (4.97), 3.531 (0.74), 3.548 (0.63), 7.197 (3.58), 7.203 (4.23), 7.219 (3.65), 7.226 (4.05), 7.322 (1.32), 7.328 (10.64), 7.333 (3.88), 7.340 (2.44), 7.349 (15.66), 7.355 (2.65), 7.361 (4.30), 7.367 (4.06), 7.382 (2.76), 7.389 (2.63), 7.418 (4.61), 7.432 (5.29), 7.442 (16.00), 7.447 (4.64), 7.454 (3.48), 7.458 (3.96), 7.463 (10.19), 7.575 (7.62), 8.598 (1.98), 8.614 (4.15), 8.629 (1.96), 10.664 (5.97).
Example 234
3,4-Dichloro-N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Fluoro[1,1-Biphenyl]-2-Carboxamide
(3163) ##STR00632##
(3164) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 3,4-dichloro-4-fluoro[1,1-biphenyl]-2-carboxylic acid (139 mg, 486 mol) in DMF (2.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 129 mg (98% purity, 60% yield) of the desired product were obtained.
(3165) LC-MS (Method 7): R.sub.t=1.71 min, MS (ESIpos): m/z=436 [M+H].sup.+
(3166) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.45), 0.008 (3.52), 0.008 (3.64), 0.112 (0.61), 0.125 (1.41), 0.136 (2.49), 0.149 (2.61), 0.160 (1.83), 0.173 (0.82), 0.296 (0.52), 0.310 (0.89), 0.319 (1.57), 0.331 (1.95), 0.342 (1.83), 0.353 (1.48), 0.364 (1.13), 0.377 (0.94), 0.388 (1.55), 0.402 (1.72), 0.410 (2.30), 0.424 (1.81), 0.432 (1.15), 0.440 (1.20), 0.454 (2.00), 0.465 (2.42), 0.478 (2.30), 0.490 (1.43), 0.503 (0.49), 1.053 (0.80), 1.066 (1.64), 1.074 (1.74), 1.079 (1.27), 1.087 (3.03), 1.094 (1.25), 1.100 (1.60), 1.107 (1.46), 1.120 (0.66), 2.327 (0.42), 2.366 (0.80), 2.518 (2.61), 2.523 (2.26), 2.526 (1.95), 2.557 (1.06), 2.561 (0.80), 2.669 (0.42), 2.710 (0.80), 3.451 (0.59), 3.466 (0.78), 3.485 (4.93), 3.492 (5.10), 3.500 (4.96), 3.508 (4.79), 3.526 (0.75), 3.542 (0.68), 7.210 (3.57), 7.216 (4.32), 7.232 (3.69), 7.239 (4.16), 7.254 (5.12), 7.260 (5.17), 7.275 (5.50), 7.281 (5.73), 7.363 (1.76), 7.370 (1.81), 7.384 (4.14), 7.391 (4.28), 7.405 (2.58), 7.412 (2.58), 7.476 (4.44), 7.490 (4.63), 7.497 (3.55), 7.511 (3.17), 7.592 (16.00), 7.598 (11.86), 7.639 (10.08), 7.660 (9.09), 8.628 (1.95), 8.644 (4.09), 8.659 (1.93), 10.670 (5.52).
Example 235
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-6-Fluoro-4-(Trifluoromethyl)[1,1-Biphenyl]-2-Carboxamide
(3167) ##STR00633##
(3168) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (100 mg, 486 mol) and 6-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (298 mg, 46% purity, 486 mol) in DMF (2.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (121 mg, 632 mol), 1-hydroxybenzotriazole hydrate (96.8 mg, 632 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 97.5 mg (96% purity, 44% yield) of the desired product were obtained.
(3169) LC-MS (Method 7): R.sub.t=1.63 min; MS (ESIneg): m/z=434 [MH].sup.
(3170) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.007 (0.60), 0.006 (0.46), 0.105 (0.82), 0.116 (1.84), 0.124 (3.22), 0.134 (3.32), 0.143 (2.30), 0.154 (1.06), 0.276 (0.72), 0.284 (1.08), 0.287 (1.14), 0.294 (2.06), 0.303 (2.48), 0.312 (2.22), 0.319 (1.58), 0.322 (1.76), 0.330 (1.32), 0.350 (1.16), 0.359 (2.02), 0.367 (2.06), 0.370 (2.14), 0.377 (2.88), 0.387 (2.26), 0.394 (1.28), 0.405 (0.84), 0.419 (1.18), 0.430 (2.44), 0.439 (3.20), 0.450 (3.00), 0.459 (1.94), 0.470 (0.72), 1.008 (1.14), 1.018 (2.24), 1.024 (2.38), 1.029 (1.62), 1.035 (4.15), 1.041 (1.58), 1.045 (2.14), 1.051 (1.96), 1.062 (0.86), 2.072 (1.10), 3.407 (0.44), 3.420 (0.58), 3.435 (9.45), 3.448 (10.39), 3.464 (0.54), 7.274 (6.57), 7.276 (6.55), 7.289 (7.31), 7.291 (6.91), 7.413 (2.74), 7.415 (2.78), 7.429 (4.29), 7.432 (4.99), 7.435 (3.16), 7.450 (3.80), 7.452 (3.50), 7.518 (10.49), 7.525 (16.00), 7.531 (11.09), 7.534 (11.35), 7.540 (5.73), 7.546 (2.86), 7.557 (2.52), 7.564 (0.58), 7.570 (0.46), 7.599 (0.46), 7.602 (0.70), 7.616 (0.60), 7.623 (0.68), 7.626 (0.76), 7.642 (0.42), 7.772 (12.12), 7.788 (10.59), 8.556 (2.64), 8.569 (5.45), 8.581 (2.50), 10.643 (5.19).
Example 236
Ent-N-[(4-Cyclobutyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-Methyl[Biphenyl]-2-Carboxamide
(3171) ##STR00634##
(3172) To a solution of ent-5-(aminomethyl)-5-cyclobutylimidazolidine-2,4-dione hydrochloride (50.0 mg, 228 mol) and 4-methyl[1,1-biphenyl]-2-carboxylic acid (48.3 mg, 228 mol) in DMF (2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (56.7 mg, 296 mol), 1-hydroxybenzotriazole hydrate (45.3 mg, 296 mol) and N,N-diisopropylethylamine (110 l, 640 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 71.3 mg (99% purity, 82% yield) of the desired product were obtained.
(3173) LC-MS (Method 8): R.sub.t=0.83 min, MS (ESIpos): m/z=378 [M+H].sup.+
(3174) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.630 (1.11), 1.644 (1.55), 1.657 (1.45), 1.752 (0.79), 1.768 (1.61), 1.780 (2.37), 1.791 (2.00), 1.806 (0.87), 1.821 (0.67), 1.839 (0.98), 1.847 (1.11), 1.852 (1.09), 1.861 (0.97), 1.879 (1.16), 1.895 (1.30), 1.911 (0.71), 2.325 (16.00), 2.566 (1.08), 2.581 (1.46), 2.595 (0.89), 3.229 (0.89), 3.239 (0.98), 3.252 (2.08), 3.261 (1.92), 3.279 (2.02), 3.290 (2.09), 3.302 (1.22), 7.192 (3.95), 7.205 (5.88), 7.249 (6.62), 7.263 (4.13), 7.345 (3.24), 7.354 (4.29), 7.365 (2.01), 7.377 (2.56), 7.390 (1.02), 7.462 (1.54), 7.464 (1.61), 7.474 (2.34), 7.489 (0.98), 7.816 (3.99), 8.225 (1.29), 8.235 (2.33), 8.245 (1.14), 10.629 (3.45).
Example 237
Ent-N-[(4-Cyclobutyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3175) ##STR00635##
(3176) To a solution of ent-5-(aminomethyl)-5-cyclobutylimidazolidine-2,4-dione hydrochloride (100 mg, 455 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (145 mg, 546 mol) in DMF (2.8 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (113 mg, 592 mol), 1-hydroxybenzotriazole hydrate (90.6 mg, 592 mol) and N,N-diisopropylethylamine (400 l, 2.3 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 82.0 mg (100% purity, 42% yield) of the desired product were obtained.
(3177) LC-MS (Method 7): R.sub.t=1.69 min; MS (ESIpos): m/z=432 [M+H].sup.+
(3178) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.635 (2.50), 1.649 (3.78), 1.665 (3.52), 1.680 (3.12), 1.741 (0.51), 1.755 (1.60), 1.770 (2.88), 1.788 (5.43), 1.802 (5.11), 1.817 (2.56), 1.840 (2.50), 1.853 (2.82), 1.887 (1.15), 1.902 (2.76), 1.918 (3.50), 1.935 (2.07), 1.951 (0.58), 2.572 (0.83), 2.587 (2.84), 2.601 (3.82), 2.615 (2.61), 3.264 (2.29), 3.274 (2.54), 3.286 (5.49), 3.296 (5.51), 3.304 (3.76), 3.315 (7.11), 7.427 (10.83), 7.440 (16.00), 7.459 (4.68), 7.471 (7.05), 7.484 (3.05), 7.533 (4.66), 7.546 (7.16), 7.557 (13.67), 7.570 (12.82), 7.762 (12.99), 7.775 (11.49), 7.895 (10.19), 8.477 (3.23), 8.487 (6.02), 8.497 (3.16), 10.661 (8.84).
Example 238
Ent-N-[(4-Cyclobutyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-5-Methyl-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3179) ##STR00636##
(3180) To a solution of ent-5-(aminomethyl)-5-cyclobutylimidazolidine-2,4-dione hydrochloride (100 mg, 455 mol) and 5-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (153 mg, 546 mol) in DMF (2.8 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (113 mg, 592 mol), 1-hydroxybenzotriazole hydrate (90.6 mg, 592 mol) and N,N-diisopropylethylamine (400 l, 2.3 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative chiral HPLC [Daicel Chiralcel OX-H 5 m, 25020 mm; eluent: 65% n-heptane/35% ethanol; flow rate: 25 ml/min; temperature: 50 C.; UV detection: 220 nm]. After lyophilization, 15.4 mg (96% purity, 7% yield) of the desired product were obtained.
(3181) LC-MS (Method 7): R.sub.t=1.80 min; MS (ESIpos): m/z=446 [M+H].sup.+
(3182) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.629 (0.94), 1.645 (1.39), 1.658 (1.31), 1.749 (0.58), 1.765 (1.03), 1.779 (2.22), 1.794 (1.95), 1.809 (0.91), 1.844 (1.05), 1.877 (0.42), 1.893 (1.05), 1.909 (1.36), 1.925 (0.78), 2.380 (16.00), 2.562 (0.50), 2.577 (1.08), 2.591 (1.50), 2.605 (0.98), 3.241 (0.94), 3.251 (1.05), 3.264 (1.81), 3.274 (1.72), 3.293 (0.56), 3.309 (2.26), 3.342 (1.69), 7.242 (4.43), 7.264 (1.95), 7.277 (2.67), 7.337 (3.84), 7.350 (2.70), 7.531 (4.43), 7.544 (4.89), 7.745 (5.00), 7.759 (4.53), 7.862 (4.07), 8.361 (1.19), 8.371 (2.29), 8.381 (1.17), 10.649 (3.53).
Example 239
Ent-N-[(4-Cyclobutyl-2,5-Dioxoimidazolidin-4-Yl)Methyl]-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3183) ##STR00637##
(3184) To a solution of ent-5-(aminomethyl)-5-cyclobutylimidazolidine-2,4-dione hydrochloride (100 mg, 455 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (155 mg, 546 mol) in DMF (2.8 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (113 mg, 592 mol), 1-hydroxybenzotriazole hydrate (90.6 mg, 592 mol) and N,N-diisopropylethylamine (400 l, 2.3 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative chiral HPLC [Daicel Chiralcel OX-H 5 m, 25020 mm; eluent: 65% n-heptane/35% ethanol; flow rate: 25 ml/min; temperature: 50 C.; UV detection: 220 nm]. After lyophilization, 13.8 mg (93% purity, 6% yield) of the desired product were obtained.
(3185) LC-MS (Method 7): R.sub.t=1.74 min; MS (ESIpos): m/z=450 [M+H].sup.+
(3186) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.419 (0.79), 0.431 (0.79), 0.875 (0.92), 0.887 (1.21), 0.899 (1.05), 0.911 (0.52), 1.148 (0.52), 1.179 (0.68), 1.234 (0.63), 1.633 (2.68), 1.647 (3.86), 1.665 (3.38), 1.672 (3.23), 1.679 (3.23), 1.739 (0.50), 1.754 (1.78), 1.769 (3.12), 1.784 (6.37), 1.790 (5.27), 1.799 (5.77), 1.814 (2.68), 1.838 (2.70), 1.843 (2.54), 1.850 (2.99), 1.855 (2.75), 1.863 (2.10), 1.886 (1.15), 1.901 (3.10), 1.917 (4.14), 1.934 (2.41), 1.949 (0.71), 2.422 (0.45), 2.572 (1.02), 2.587 (3.33), 2.602 (4.59), 2.616 (2.89), 2.630 (0.73), 2.652 (0.55), 3.249 (2.81), 3.259 (3.07), 3.272 (6.06), 3.282 (5.53), 3.293 (1.65), 3.310 (7.00), 3.344 (5.01), 3.365 (0.89), 3.397 (0.42), 7.313 (6.92), 7.325 (6.30), 7.329 (7.63), 7.335 (7.21), 7.339 (4.75), 7.349 (3.70), 7.353 (2.89), 7.470 (5.43), 7.480 (5.82), 7.484 (5.35), 7.494 (4.51), 7.513 (0.68), 7.573 (13.95), 7.586 (15.50), 7.652 (0.58), 7.666 (0.58), 7.752 (0.55), 7.775 (16.00), 7.788 (14.58), 7.918 (14.24), 8.519 (3.67), 8.529 (7.27), 8.540 (3.67), 10.661 (9.47).
Example 240
Rac-N-({2,5-Dioxo-4-[3-(Trifluoromethyl)Pyridin-2-Yl]Imidazolidin-4-Yl}Methyl)-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3187) ##STR00638##
(3188) To a solution of rac-5-(aminomethyl)-5-[3-(trifluoromethyl)pyridin-2-yl]imidazolidine-2,4-dione hydrochloride (100 mg, 322 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (104 mg, 365 mol) in DMF (1.8 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (90.9 mg, 474 mol), 1-hydroxybenzotriazole hydrate (72.6 mg, 474 mol) and N,N-diisopropylethylamine (320 l, 1.8 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 8f). After lyophilization, 64.7 mg (96% purity, 36% yield) of the desired product were obtained.
(3189) LC-MS (Method 7): R.sub.t=1.78 min, MS (ESIpos): m/z=541 [M+H].sup.+
(3190) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.045 (0.46), 2.069 (8.29), 2.422 (0.41), 2.510 (3.07), 2.776 (2.26), 4.015 (4.00), 4.026 (4.28), 4.037 (4.93), 4.048 (4.59), 4.238 (4.74), 4.249 (5.09), 4.261 (4.25), 4.271 (3.84), 7.311 (4.33), 7.315 (6.72), 7.327 (6.92), 7.331 (8.33), 7.340 (6.59), 7.345 (4.69), 7.354 (3.62), 7.359 (2.77), 7.495 (5.38), 7.504 (5.63), 7.508 (5.12), 7.518 (4.58), 7.602 (12.83), 7.615 (14.73), 7.669 (4.44), 7.677 (4.63), 7.682 (4.62), 7.690 (4.52), 7.769 (15.14), 7.783 (12.89), 7.805 (0.57), 7.819 (0.50), 8.077 (16.00), 8.283 (6.86), 8.297 (6.45), 8.473 (3.51), 8.484 (7.10), 8.494 (3.39), 8.850 (6.76), 8.857 (6.59), 11.024 (1.48).
Example 241
Rac-4-Chloro-N-({2,5-Dioxo-4-[3-(Trifluoromethyl)Pyridin-2-Yl]Imidazolidin-4-Yl}Methyl)-5-Fluoro[Biphenyl]-2-Carboxamide
(3191) ##STR00639##
(3192) To a solution of rac-5-(aminomethyl)-5-[3-(trifluoromethyl)pyridin-2-yl]imidazolidine-2,4-dione hydrochloride (100 mg, 322 mol) and 4-chloro-5-fluoro[1,1-biphenyl]-2-carboxylic acid (91.5 mg, 365 mol) in DMF (1.8 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (90.9 mg, 474 mol), 1-hydroxybenzotriazole hydrate (72.6 mg, 474 mol) and N,N-diisopropylethylamine (320 l, 1.8 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 77.8 mg (97% purity, 46% yield) of the desired product were obtained.
(3193) LC-MS (Method 7): R.sub.t=1.72 min, MS (ESIpos): m/z=507 [M+H].sup.+
(3194) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.465 (2.26), 2.778 (2.15), 4.006 (2.58), 4.017 (2.77), 4.029 (3.23), 4.040 (2.98), 4.217 (3.08), 4.228 (3.34), 4.240 (2.73), 4.250 (2.49), 7.243 (3.22), 7.247 (4.36), 7.260 (3.23), 7.264 (4.16), 7.273 (1.99), 7.277 (1.66), 7.287 (3.97), 7.291 (3.49), 7.301 (2.26), 7.305 (2.04), 7.372 (0.72), 7.386 (1.20), 7.405 (9.12), 7.419 (15.28), 7.428 (1.94), 7.442 (0.75), 7.452 (3.95), 7.459 (16.00), 7.462 (8.39), 7.466 (4.32), 7.473 (9.56), 7.503 (0.70), 7.517 (0.48), 7.668 (2.81), 7.676 (2.96), 7.681 (2.95), 7.689 (2.91), 8.077 (7.74), 8.178 (0.55), 8.285 (4.36), 8.296 (4.07), 8.298 (4.11), 8.362 (2.18), 8.373 (4.47), 8.383 (2.19), 8.844 (4.27), 8.850 (4.19).
Example 242
Rac-4-Chloro-N-({2,5-Dioxo-4-[3-(Trifluoromethyl)Pyridin-2-Yl]Imidazolidin-4-Yl}Methyl)[Biphenyl]-2-Carboxamide
(3195) ##STR00640##
(3196) To a solution of rac-5-(aminomethyl)-5-[3-(trifluoromethyl)pyridin-2-yl]imidazolidine-2,4-dione hydrochloride (100 mg, 322 mol) and 4-chloro[1,1-biphenyl]-2-carboxylic acid (84.9 mg, 365 mol) in DMF (1.8 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (90.9 mg, 474 mol), 1-hydroxybenzotriazole hydrate (72.6 mg, 474 mol) and N,N-diisopropylethylamine (320 l, 1.8 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 45.9 mg (95% purity, 28% yield) of the desired product were obtained.
(3197) LC-MS (Method 7): R.sub.t=1.67 min, MS (ESIpos): m/z=489 [M+H].sup.+
(3198) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.58), 0.008 (1.75), 1.175 (0.68), 1.988 (1.21), 2.366 (0.50), 2.466 (2.81), 2.523 (1.73), 2.710 (0.50), 2.782 (2.67), 3.987 (1.71), 4.003 (1.93), 4.021 (2.56), 4.037 (2.32), 4.220 (2.02), 4.236 (2.19), 4.254 (1.73), 4.270 (1.53), 7.345 (0.44), 7.377 (10.26), 7.398 (16.00), 7.404 (3.05), 7.418 (8.07), 7.426 (5.94), 7.429 (5.85), 7.438 (2.72), 7.444 (13.52), 7.449 (4.19), 7.460 (3.29), 7.466 (6.82), 7.488 (1.12), 7.494 (2.74), 7.503 (2.61), 7.508 (2.24), 7.513 (2.28), 7.516 (1.99), 7.521 (1.91), 7.527 (1.47), 7.535 (1.27), 7.666 (2.02), 7.678 (2.13), 7.685 (2.15), 7.698 (2.10), 8.045 (3.84), 8.283 (3.02), 8.286 (3.24), 8.303 (3.00), 8.306 (2.94), 8.327 (1.47), 8.343 (3.05), 8.358 (1.42), 8.848 (3.07), 8.856 (3.05), 11.036 (3.35).
Example 243
Rac-N-({2,5-Dioxo-4-[3-(Trifluoromethyl)Pyridin-2-Yl]Imidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3199) ##STR00641##
(3200) To a solution of rac-5-(aminomethyl)-5-[3-(trifluoromethyl)pyridin-2-yl]imidazolidine-2,4-dione hydrochloride (100 mg, 322 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (85.7 mg, 322 mol) in DMF (2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (80.2 mg, 418 mol), 1-hydroxybenzotriazole hydrate (64.1 mg, 418 mol) and N,N-diisopropylethylamine (280 l, 1.6 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 90.0 mg (99% purity, 53% yield) of the desired product were obtained.
(3201) LC-MS (Method 7): R.sub.t=1.74 min, MS (ESIpos): m/z=523 [M+H].sup.+
(3202) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.069 (3.51), 3.635 (0.49), 4.013 (3.68), 4.024 (3.91), 4.036 (4.45), 4.047 (4.15), 4.255 (4.30), 4.266 (4.63), 4.278 (3.88), 4.288 (3.54), 7.432 (7.35), 7.444 (8.81), 7.459 (1.81), 7.466 (16.00), 7.471 (10.24), 7.475 (8.86), 7.488 (1.39), 7.531 (0.62), 7.538 (3.83), 7.543 (3.58), 7.548 (3.10), 7.551 (3.96), 7.556 (3.01), 7.561 (2.62), 7.565 (2.30), 7.581 (11.67), 7.594 (13.26), 7.667 (4.00), 7.675 (4.20), 7.681 (4.16), 7.689 (4.09), 7.755 (13.64), 7.768 (11.77), 8.042 (14.40), 8.283 (6.22), 8.296 (5.86), 8.430 (3.18), 8.441 (6.46), 8.451 (3.14), 8.851 (6.14), 8.858 (6.00), 11.031 (4.23).
Example 244
Ent-N-({2,5-Dioxo-4-[3-(Trifluoromethyl)Pyridin-2-Yl]Imidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3203) ##STR00642##
(3204) Enantiomeric separation of rac-N-({2,5-dioxo-4-[3-(trifluoromethyl)pyridin-2-yl]imidazolidin-4 yl}methyl)-4-(trifluoromethyl)[biphenyl]-2-carboxamide (89 mg) by preparative chiral HPLC [column: Daicel Chiralcel OD-H 5 m, 25020 mm; eluent: 80% n-heptane/20% ethanol; flow rate: 20 ml/min; temperature: 30 C.; UV detection: 220 nm] afforded 33.5 mg (100% purity) of the desired product.
(3205) Analytical chiral HPLC: R.sub.t=1.46 min, e.e. =99% [column: 504.6 mm filled with Phen.
(3206) Cellulose-1 3 m; eluent: 80% n-heptane/20% ethanol; flow rate: 1 ml/min; temperature: 30 C. UV detection: 220 nm]
(3207) LC-MS (Method 7): R.sub.t=1.77 min; MS (ESIpos): m/z=523 [M+H].sup.+
(3208) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.236 (0.81), 2.328 (0.99), 2.366 (0.99), 2.670 (1.11), 2.710 (1.05), 3.997 (3.49), 4.013 (3.72), 4.031 (4.54), 4.047 (4.25), 4.252 (4.31), 4.268 (4.71), 4.286 (3.72), 4.302 (3.37), 7.431 (6.87), 7.451 (10.71), 7.463 (16.00), 7.470 (10.71), 7.477 (8.67), 7.498 (1.80), 7.523 (0.76), 7.535 (4.65), 7.542 (4.19), 7.553 (4.13), 7.557 (3.84), 7.560 (3.78), 7.577 (13.21), 7.597 (13.73), 7.667 (4.01), 7.679 (4.36), 7.687 (4.25), 7.698 (4.25), 7.756 (14.14), 7.776 (11.40), 8.068 (14.84), 8.286 (6.40), 8.306 (5.82), 8.459 (3.08), 8.475 (6.52), 8.491 (3.03), 8.854 (5.99), 8.863 (5.70), 11.044 (3.84).
Example 245
Rac-4-Chloro-N-{[4-(3,3-Difluorocyclobutyl)-2,5-Dioxoimidazoidin-4-Yl]Methyl}-5-Fluoro[Biphenyl]-2-Carboxamide
(3209) ##STR00643##
(3210) To a solution of rac-5-(aminomethyl)-5-(3,3-difluorocyclobutyl)imidazolidine-2,4-dione hydrochloride (100 mg, 391 mol) and 4-chloro-5-fluoro[1,1-biphenyl]-2-carboxylic acid (98.0 mg, 391 mol) in DMF (1.9 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (97.5 mg, 509 mol), 1-hydroxybenzotriazole hydrate (77.9 mg, 509 mol) and N,N-diisopropylethylamine (340 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 109 mg (100% purity, 62% yield) of the desired product were obtained.
(3211) LC-MS (Method 7): R.sub.t=1.68 min, MS (ESIpos): m/z=452 [M+H].sup.+
(3212) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.54), 0.008 (4.47), 0.008 (4.85), 0.146 (0.54), 2.056 (0.57), 2.072 (0.52), 2.297 (0.71), 2.327 (1.28), 2.345 (1.04), 2.366 (1.54), 2.375 (1.04), 2.407 (1.16), 2.443 (1.92), 2.469 (2.15), 2.576 (2.11), 2.670 (0.62), 2.710 (0.88), 3.351 (6.60), 3.367 (6.49), 7.248 (2.89), 7.255 (4.31), 7.274 (3.10), 7.280 (5.99), 7.286 (1.78), 7.300 (4.14), 7.307 (3.29), 7.322 (2.37), 7.328 (1.92), 7.372 (8.88), 7.377 (3.31), 7.388 (4.14), 7.393 (15.01), 7.399 (2.18), 7.445 (3.98), 7.450 (2.77), 7.456 (16.00), 7.461 (7.53), 7.466 (4.02), 7.472 (3.64), 7.477 (9.49), 8.061 (7.24), 8.546 (1.73), 8.562 (3.69), 8.577 (1.70), 10.852 (5.23).
Example 246
Rac-4-Chloro-N-{[4-(3,3-Difluorocyclobutyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(3213) ##STR00644##
(3214) To a solution of rac-5-(aminomethyl)-5-(3,3-difluorocyclobutyl)imidazolidine-2,4-dione hydrochloride (100 mg, 391 mol) and 4-chloro[1,1-biphenyl]-2-carboxylic acid (91.0 mg, 391 mol) in DMF (1.9 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (97.5 mg, 509 mol), 1-hydroxybenzotriazole hydrate (77.9 mg, 509 mol) and N,N-diisopropylethylamine (340 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 96.1 mg (100% purity, 57% yield) of the desired product were obtained.
(3215) LC-MS (Method 7): R.sub.t=1.62 min; MS (ESIpos): m/z=434 [M+H].sup.+
(3216) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.40), 0.008 (3.82), 0.008 (4.02), 0.146 (0.40), 2.298 (0.63), 2.318 (0.97), 2.327 (1.04), 2.348 (0.92), 2.366 (1.18), 2.376 (0.98), 2.394 (0.86), 2.407 (1.12), 2.442 (1.85), 2.467 (1.92), 2.523 (2.90), 2.574 (1.99), 2.669 (0.41), 2.709 (0.52), 3.356 (6.50), 3.372 (6.48), 7.352 (7.85), 7.356 (3.11), 7.368 (3.92), 7.373 (13.30), 7.379 (5.38), 7.398 (5.41), 7.417 (5.35), 7.421 (8.02), 7.440 (16.00), 7.457 (4.28), 7.461 (8.49), 7.498 (2.84), 7.503 (2.71), 7.517 (2.96), 7.522 (2.80), 7.534 (1.43), 7.539 (1.33), 8.038 (5.49), 8.504 (1.52), 8.519 (3.23), 8.535 (1.50), 10.848 (4.67).
Example 247
Ent-4-Chloro-N-{[4-(3,3-Difluorocyclobutyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(3217) ##STR00645##
(3218) Enantiomeric separation of rac-4-chloro-N-{[4-(3,3-difluorocyclobutyl)-2,5-dioxoimidazolidin-4 yl]methyl}[biphenyl]-2-carboxamide (95 mg) by preparative chiral HPLC [column: Daicel Chiralpak OX-H 5 m, 25020 mm; eluent: 80% n-heptane/20% ethanol; flow rate: 20 ml/min; temperature: 30 C.; UV detection: 220 nm] afforded 41.2 mg (99% purity) of the desired product.
(3219) Analytical chiral HPLC: R.sub.t=1.82 min, e.e. =>99% [column: Daicel OX-3 3 m, 504.6 mm; eluent: 80% n-heptane/20% ethanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3220) LC-MS (Method 7): R.sub.t=1.65 min; MS (ESIpos): m/z=434 [M+H].sup.+
(3221) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.316 (0.80), 2.331 (1.11), 2.351 (1.13), 2.364 (0.82), 2.383 (0.60), 2.412 (1.00), 2.422 (1.27), 2.434 (1.51), 2.454 (1.84), 2.464 (1.84), 2.481 (1.27), 2.520 (1.31), 2.565 (2.09), 3.262 (0.47), 3.266 (0.71), 3.270 (0.47), 3.329 (0.40), 3.360 (8.71), 3.370 (8.73), 7.356 (9.96), 7.367 (4.38), 7.370 (13.71), 7.374 (2.16), 7.379 (4.62), 7.393 (5.22), 7.405 (1.78), 7.408 (2.36), 7.418 (5.89), 7.420 (6.04), 7.425 (4.04), 7.426 (3.82), 7.440 (16.00), 7.451 (5.29), 7.454 (9.78), 7.502 (2.89), 7.505 (2.76), 7.515 (3.78), 7.517 (3.67), 7.527 (1.76), 7.530 (1.67), 8.010 (8.80), 8.475 (1.93), 8.486 (4.07), 8.496 (1.91), 10.823 (0.96).
Example 248
Ent-N-{[4-(3,3-Difluorocyclobutyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3222) ##STR00646##
(3223) To a solution of rac-5-(aminomethyl)-5-(3,3-difluorocyclobutyl)imidazolidine-2,4-dione hydrochloride (100 mg, 391 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (104 mg, 391 mol) in DMF (1.9 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (97.5 mg, 509 mol), 1-hydroxybenzotriazole hydrate (77.9 mg, 509 mol) and N,N-diisopropylethylamine (340 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 123 mg (98.5% purity, 67% yield) of the racemic product were obtained.
(3224) Enantiomeric separation of rac-N-{[4-(3,3-difluorocyclobutyl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (112 mg) by preparative chiral HPLC [column: Daicel Chiralpak OX-H 5 m, 25020 mm; eluent: 80% n-heptane/20% ethanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 54.4 mg (99% purity) of the desired product.
(3225) Analytical chiral HPLC: R.sub.t=1.15 min, e.e. =>99% [column: Daicel OX-3 3 m, 504.6 mm; eluent: 80% n-heptane/20% ethanol; flow rate: 1 ml/min; temperature=30 C.; UV detection: 220 nm]
(3226) LC-MS (Method 7): R.sub.t=1.73 min; MS (ESIpos): m/z=468 [M+H].sup.+
(3227) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.237 (1.14), 1.361 (1.55), 2.297 (0.41), 2.319 (1.10), 2.333 (1.59), 2.340 (1.43), 2.353 (1.55), 2.366 (1.35), 2.387 (1.59), 2.403 (1.43), 2.409 (1.43), 2.422 (2.29), 2.453 (2.00), 2.466 (2.53), 2.484 (1.71), 2.517 (2.61), 2.561 (3.35), 2.573 (1.14), 2.576 (1.22), 2.652 (0.53), 3.264 (1.84), 3.267 (3.02), 3.327 (1.35), 3.330 (1.51), 3.358 (0.49), 3.371 (11.31), 3.382 (12.00), 7.431 (6.37), 7.444 (7.47), 7.455 (2.33), 7.458 (3.27), 7.467 (8.57), 7.470 (8.98), 7.473 (6.45), 7.475 (5.71), 7.485 (6.78), 7.497 (2.65), 7.542 (4.45), 7.545 (4.24), 7.558 (16.00), 7.571 (12.86), 7.745 (12.69), 7.759 (11.10), 8.029 (9.02), 8.566 (2.86), 8.576 (6.00), 8.587 (2.90), 10.844 (7.67).
Example 249
Rac-4-Chloro-5-Fluoro-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(3228) ##STR00647##
(3229) To a solution of rac-5-(aminomethyl)-5-(1-fluorocyclopropyl)imidazolidine-2,4-dione hydrochloride (100 mg, 447 mol) and 4-chloro-5-fluoro[1,1-biphenyl]-2-carboxylic acid (112 mg, 447 mol) in DMF (2.2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (111 mg, 581 mol), 1-hydroxybenzotriazole hydrate (89.0 mg, 581 mol) and N,N-diisopropylethylamine (390 l, 2.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 139 mg (100% purity, 74% yield) of the desired product were obtained.
(3230) LC-MS (Method 7): R.sub.t=1.59 min, MS (ESIpos): m/z=420 [M+H].sup.+
(3231) .sup.1H-NMR (400 MHz, DMSO-d.sub.6) [ppm]: 0.149 (0.52), 0.008 (4.50), 0.007 (2.91), 0.006 (3.25), 0.008 (4.88), 0.146 (0.54), 0.821 (0.65), 0.848 (1.95), 0.875 (1.57), 0.912 (1.45), 0.943 (1.99), 0.962 (1.57), 0.974 (1.30), 0.984 (1.78), 0.993 (3.94), 1.007 (2.22), 1.034 (1.63), 1.043 (3.90), 1.050 (2.18), 2.072 (2.68), 2.366 (0.71), 2.518 (2.76), 2.523 (2.18), 2.526 (1.82), 2.560 (0.77), 2.709 (0.71), 3.491 (1.51), 3.507 (1.59), 3.525 (3.08), 3.541 (2.91), 3.575 (2.74), 3.590 (2.97), 3.609 (1.45), 3.624 (1.30), 7.250 (2.76), 7.257 (4.75), 7.269 (2.60), 7.275 (3.85), 7.282 (4.86), 7.290 (4.98), 7.296 (3.25), 7.311 (2.70), 7.317 (2.09), 7.356 (1.17), 7.363 (10.16), 7.368 (3.71), 7.379 (4.52), 7.385 (16.00), 7.391 (2.79), 7.395 (4.36), 7.410 (4.06), 7.416 (3.35), 7.431 (2.87), 7.455 (2.12), 7.462 (15.75), 7.467 (4.27), 7.478 (3.54), 7.483 (9.95), 7.490 (1.17), 8.106 (6.55), 8.613 (1.84), 8.628 (3.83), 8.643 (1.80), 10.876 (4.90).
Example 250
Rac-4-Chloro-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(3232) ##STR00648##
(3233) To a solution of rac-5-(aminomethyl)-5-(1-fluorocyclopropyl)imidazolidine-2,4-dione hydrochloride (100 mg, 447 mol) and 4-chloro[1,1-biphenyl]-2-carboxylicacid (104 mg, 447 mol) in DMF (2.2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (111 mg, 581 mol), 1-hydroxybenzotriazole hydrate (89.0 mg, 581 mol) and N,N-diisopropylethylamine (390 l, 2.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 95.4 mg (100% purity, 53% yield) of the desired product were obtained.
(3234) LC-MS (Method 7): R.sub.t=1.53 min, MS (ESIpos): m/z=402 [M+H].sup.+
(3235) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.45), 0.008 (4.07), 0.008 (4.13), 0.146 (0.43), 0.818 (0.64), 0.837 (1.04), 0.849 (1.94), 0.875 (1.54), 0.914 (1.38), 0.944 (2.08), 0.961 (1.52), 0.982 (1.89), 0.992 (3.86), 1.006 (1.94), 1.032 (1.54), 1.042 (3.81), 1.056 (1.14), 2.072 (5.59), 2.366 (0.93), 2.518 (2.64), 2.521 (2.16), 2.522 (2.18), 2.524 (2.16), 2.558 (1.09), 2.561 (0.85), 2.563 (0.72), 2.565 (0.64), 2.568 (0.51), 2.570 (0.43), 2.709 (0.93), 3.489 (1.54), 3.504 (1.65), 3.523 (2.90), 3.539 (2.77), 3.586 (2.58), 3.601 (2.77), 3.620 (1.46), 3.635 (1.36), 7.337 (1.12), 7.344 (9.53), 7.349 (3.86), 7.353 (3.54), 7.357 (3.94), 7.360 (4.87), 7.365 (15.17), 7.372 (7.29), 7.375 (5.80), 7.381 (4.23), 7.383 (4.39), 7.402 (5.56), 7.407 (3.41), 7.410 (3.06), 7.425 (5.03), 7.429 (4.23), 7.439 (2.32), 7.446 (16.00), 7.451 (4.37), 7.462 (3.33), 7.467 (9.37), 7.473 (1.17), 7.495 (3.33), 7.499 (3.30), 7.513 (4.26), 7.517 (4.13), 7.532 (1.70), 7.536 (1.62), 8.078 (6.47), 8.575 (1.70), 8.591 (3.62), 8.606 (1.73), 10.871 (4.63).
Example 251
Ent-4-Chloro-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(3236) ##STR00649##
(3237) Enantiomeric separation of rac-4-chloro-N-{[4-(1-fluorocyclopropyl)-2,5-dioxoimidazolidin-4 yl]methyl}[biphenyl]-2-carboxamide (92.6 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 60% n-heptan/40% isopropanol; flow rate: 30 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 31.0 mg (98% purity) of the desired product.
(3238) Analytical chiral HPLC: R.sub.t=1.86 min, e.e. =97.8% [column: 504.6 mm filled with Daicel Chiralpak ID-3 3 m; eluent: 50% n-heptan/50% isopropanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3239) LC-MS (Method 7): R.sub.t=1.55 min; MS (ESIpos): m/z=402 [M+H].sup.+
(3240) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.834 (0.71), 0.842 (1.04), 0.852 (2.29), 0.869 (1.77), 0.920 (1.63), 0.937 (2.17), 0.955 (0.83), 0.971 (0.68), 0.990 (1.25), 0.998 (3.85), 1.009 (1.27), 1.023 (1.42), 1.031 (4.08), 1.043 (1.53), 2.383 (0.54), 2.422 (0.73), 2.517 (1.30), 2.573 (1.56), 2.611 (0.57), 2.651 (0.71), 3.264 (1.77), 3.331 (2.67), 3.500 (1.96), 3.511 (2.05), 3.523 (3.04), 3.534 (2.83), 3.592 (2.55), 3.603 (2.71), 3.615 (1.72), 3.625 (1.60), 7.348 (9.70), 7.351 (3.68), 7.362 (16.00), 7.373 (5.12), 7.374 (4.91), 7.383 (4.22), 7.396 (5.05), 7.411 (2.50), 7.413 (2.53), 7.424 (4.60), 7.426 (4.18), 7.436 (2.50), 7.438 (2.50), 7.441 (2.17), 7.445 (13.12), 7.448 (3.99), 7.456 (3.49), 7.459 (9.63), 7.499 (2.93), 7.501 (2.88), 7.512 (4.18), 7.514 (4.06), 7.524 (1.82), 7.526 (1.75), 8.048 (7.62), 8.547 (1.84), 8.557 (3.66), 8.567 (1.77), 10.172 (2.01).
Example 252
Rac-5-Fluoro-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3241) ##STR00650##
(3242) To a solution of rac-5-(aminomethyl)-5-(1-fluorocyclopropyl)imidazolidine-2,4-dione hydrochloride (100 mg, 447 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (127 mg, 447 mol) in DMF (2.2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (111 mg, 581 mol), 1-hydroxybenzotriazole hydrate (89.0 mg, 581 mol) and N,N-diisopropylethylamine (390 l, 2.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 123 mg (100% purity, 61% yield) of the desired product were obtained.
(3243) LC-MS (Method 7): R.sub.t=1.69 min, MS (ESIpos): m/z=454 [M+H].sup.+
(3244) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.47),-0.008 (3.88), 0.008 (4.16), 0.146 (0.45), 0.819 (1.20), 0.824 (1.16), 0.837 (1.94), 0.850 (3.41), 0.859 (1.41), 0.871 (2.51), 0.877 (2.76), 0.914 (2.49), 0.944 (3.63), 0.962 (2.82), 0.976 (2.55), 0.984 (3.53), 0.992 (6.94), 0.999 (3.06), 1.006 (3.82), 1.034 (3.02), 1.043 (6.88), 1.049 (3.82), 1.084 (0.43), 2.073 (2.00), 2.327 (0.41), 2.366 (0.69), 2.524 (1.98), 2.557 (1.04), 2.561 (0.76), 2.670 (0.43), 2.710 (0.69), 2.890 (0.43), 3.503 (2.63), 3.519 (2.84), 3.537 (5.53), 3.553 (5.27), 3.585 (4.88), 3.600 (5.29), 3.619 (2.49), 3.635 (2.29), 7.316 (3.69), 7.322 (12.39), 7.344 (16.00), 7.364 (5.02), 7.370 (3.37), 7.451 (5.29), 7.464 (4.96), 7.467 (4.67), 7.471 (4.88), 7.486 (3.65), 7.558 (12.73), 7.579 (14.96), 7.768 (15.61), 7.789 (13.00), 8.128 (14.06), 8.148 (0.84), 8.696 (3.24), 8.711 (6.84), 8.726 (3.24), 10.893 (7.33).
Example 253
Ent-5-Fluoro-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3245) ##STR00651##
(3246) Enantiomeric separation of rac-5-fluoro-N-{[4-(1-fluorocyclopropyl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (120.1 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 60% n-heptan/40% isopropanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 39.3 mg (100% purity) of the desired product.
(3247) Analytical chiral HPLC: R.sub.t=1.41 min, e.e. =>99% [column: 504.6 mm filled with Daicel Chiralpak ID-3 3 m; eluent: 50% n-heptan/50% isopropanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3248) LC-MS (Method 7): R.sub.t=1.69 min; MS (ESIpos): m/z=454 [M+H].sup.+
(3249) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.831 (1.62), 0.840 (2.12), 0.849 (4.63), 0.866 (3.75), 0.926 (3.37), 0.943 (4.37), 0.962 (1.62), 0.976 (1.62), 0.995 (2.50), 1.002 (7.75), 1.014 (2.63), 1.032 (7.12), 1.036 (8.12), 1.042 (6.25), 1.088 (0.37), 2.386 (1.12), 2.425 (1.37), 2.615 (1.00), 2.654 (1.25), 3.510 (3.50), 3.521 (3.63), 3.533 (5.63), 3.544 (5.25), 3.591 (5.12), 3.601 (5.37), 3.614 (3.37), 3.624 (3.00), 4.352 (0.63), 4.359 (0.63), 7.330 (8.25), 7.347 (13.63), 7.362 (4.00), 7.366 (2.75), 7.454 (5.50), 7.464 (6.00), 7.468 (5.12), 7.477 (4.37), 7.561 (13.88), 7.575 (15.25), 7.774 (16.00), 7.788 (14.00), 8.150 (15.87), 8.725 (3.75), 8.735 (7.50), 8.745 (3.75), 10.897 (1.75).
Example 254
Rac-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3250) ##STR00652##
(3251) To a solution of rac-5-(aminomethyl)-5-(1-fluorocyclopropyl)imidazolidine-2,4-dione hydrochloride (100 mg, 447 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (119 mg, 447 mol) in DMF (2.2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (111 mg, 581 mol), 1-hydroxybenzotriazole hydrate (89.0 mg, 581 mol) and N,N-diisopropylethylamine (390 l, 2.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilisation, 133 mg (100% purity, 68% yield) of the desired product were obtained.
(3252) LC-MS (Method 7): R.sub.t=1.63 min; MS (ESIpos): m/z=436 [M+H].sup.+
(3253) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.828 (0.87), 0.836 (1.31), 0.845 (1.91), 0.854 (4.29), 0.862 (1.54), 0.871 (3.45), 0.896 (0.60), 0.923 (2.98), 0.940 (4.06), 0.958 (1.71), 0.965 (1.49), 0.971 (1.74), 0.990 (2.47), 0.998 (7.47), 1.008 (2.69), 1.023 (2.70), 1.031 (7.69), 1.042 (2.16), 1.061 (0.61), 2.068 (0.43), 2.084 (1.73), 3.515 (3.44), 3.526 (3.66), 3.538 (5.56), 3.548 (5.37), 3.606 (4.82), 3.616 (5.23), 3.629 (3.40), 3.639 (3.25), 7.414 (6.07), 7.426 (9.79), 7.435 (8.21), 7.448 (9.87), 7.461 (5.11), 7.473 (8.67), 7.486 (4.35), 7.546 (14.05), 7.554 (10.30), 7.559 (16.00), 7.753 (15.24), 7.767 (13.91), 8.074 (15.47), 8.637 (3.46), 8.647 (7.11), 8.658 (3.70), 10.868 (2.80).
Example 255
Ent-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3254) ##STR00653##
(3255) Enantiomeric separation of rac-N-{[4-(1-fluorocyclopropyl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide by preparative chiral HPLC [sample preparation: 130.3 mg; column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 75% n-heptan/25% isopropanol; flow rate: 25 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 64.2 mg of the desired product. A second purification by chromatography on silica gel (10 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 16%.fwdarw.100%; flow: 36 ml/min) gave 30.4 mg (97% purity) of the desired product Analytical chiral HPLC: R.sub.t=2.15 min, e.e. =96.8% [column: 504.6 mm filled with Daicel Chiralpak ID-3 3 m; eluent: 70% n-heptan/30% isopropanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3256) LC-MS (Method 7): R.sub.t=1.65 min; MS (ESIpos): m/z=436 [M+H].sup.+
(3257) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.81), 0.008 (0.98), 0.820 (1.31), 0.825 (1.19), 0.838 (2.02), 0.851 (3.56), 0.878 (2.79), 0.915 (2.44), 0.945 (3.83), 0.961 (2.85), 0.982 (4.10), 0.991 (6.92), 1.006 (3.56), 1.032 (2.88), 1.041 (6.83), 1.082 (0.42), 1.157 (1.19), 1.175 (2.40), 1.192 (1.25), 1.236 (0.46), 1.988 (4.35), 2.072 (1.00), 2.327 (0.42), 2.366 (0.40), 2.669 (0.44), 2.709 (0.42), 3.502 (2.83), 3.518 (3.02), 3.536 (5.35), 3.552 (5.10), 3.598 (4.69), 3.613 (5.06), 3.632 (2.67), 3.647 (2.46), 4.021 (1.06), 4.038 (1.04), 7.406 (4.79), 7.409 (5.31), 7.425 (9.73), 7.428 (9.81), 7.436 (7.44), 7.455 (13.13), 7.474 (8.56), 7.477 (7.17), 7.493 (4.19), 7.496 (3.52), 7.540 (15.31), 7.558 (15.25), 7.561 (16.00), 7.572 (3.56), 7.576 (3.02), 7.754 (15.38), 7.774 (12.63), 8.100 (14.73), 8.662 (3.27), 8.678 (6.83), 8.693 (3.25), 10.889 (10.27).
Example 256
Rac-5,6-Difluoro-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3258) ##STR00654##
(3259) To a solution of rac-5-(aminomethyl)-5-(1-fluorocyclopropyl)imidazolidine-2,4-dione hydrochloride (35.4 mg, 158 mol) and 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (47.8 mg, 158 mol) in DMF (1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (39.4 mg, 206 mol), 1-hydroxybenzotriazole hydrate (31.5 mg, 206 mol) and N,N-diisopropylethylamine (140 l, 790 mol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilisation, 29.1 mg (100% purity, 39% yield) of the desired product were obtained.
(3260) LC-MS (Method 7): R.sub.t=1.72 min, MS (ESIpos): m/z=472 [M+H].sup.+
(3261) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.007 (0.48), 0.803 (0.99), 0.813 (1.29), 0.823 (2.00), 0.834 (4.09), 0.843 (1.38), 0.855 (3.29), 0.875 (0.47), 0.884 (0.63), 0.902 (2.99), 0.922 (3.91), 0.930 (2.09), 0.945 (1.61), 0.953 (2.42), 0.959 (1.48), 0.974 (2.57), 0.983 (7.66), 0.997 (2.48), 1.014 (2.82), 1.023 (7.42), 1.037 (1.76), 2.072 (0.43), 2.731 (0.41), 2.890 (0.50), 3.434 (3.54), 3.446 (3.71), 3.461 (5.68), 3.474 (5.23), 3.531 (4.91), 3.543 (5.20), 3.558 (3.16), 3.570 (2.87), 7.268 (3.35), 7.276 (3.68), 7.284 (4.00), 7.293 (3.77), 7.539 (12.25), 7.555 (13.20), 7.591 (2.32), 7.607 (4.09), 7.627 (4.12), 7.644 (2.26), 7.806 (16.00), 7.823 (13.99), 8.125 (13.99), 8.699 (3.61), 8.711 (7.26), 8.724 (3.40), 10.823 (0.82).
Example 257
Rac-4-Chloro-N-({4-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)-5-Fluoro[Biphenyl]-2-Carboxamide
(3262) ##STR00655##
(3263) To a solution of rac-5-(aminomethyl)-5-[1-(difluoromethyl)-1H-pyrazol-5-yl]imidazolidine-2,4-dione hydrochloride (57.0 mg, 202 mol) and 4-chloro-5-fluoro[1, 1-biphenyl]-2-carboxylic acid (50.7 mg, 202 mol) in DMF (990 l) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (50.4 mg, 263 mol), 1-hydroxybenzotriazole hydrate (40.3 mg, 263 mol) and N,N-diisopropylethylamine (180 l, 1.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 57.5 mg (100% purity, 59% yield) of the desired product were obtained.
(3264) LC-MS (Method 7): R.sub.t=1.61 min; MS (ESIpos): m/z=478 [M+H].sup.+
(3265) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.084 (2.10), 2.517 (0.58), 3.263 (0.42), 3.267 (0.54), 3.790 (2.44), 3.801 (2.59), 3.813 (4.11), 3.824 (3.86), 3.871 (3.91), 3.881 (4.18), 3.894 (2.54), 3.904 (2.32), 6.708 (9.77), 6.710 (10.16), 7.259 (3.71), 7.263 (4.83), 7.275 (3.79), 7.279 (4.69), 7.295 (2.10), 7.299 (1.91), 7.309 (4.52), 7.313 (4.11), 7.323 (2.59), 7.328 (2.30), 7.351 (12.09), 7.365 (15.90), 7.418 (4.30), 7.428 (4.55), 7.432 (4.05), 7.442 (3.91), 7.450 (16.00), 7.464 (12.02), 7.783 (9.48), 7.785 (9.77), 7.816 (2.68), 7.909 (2.73), 7.916 (2.57), 8.009 (2.29), 8.490 (10.48), 8.767 (2.69), 8.777 (5.32), 8.787 (2.61), 11.244 (2.23).
Example 258
Rac-4-Chloro-N-({4-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)[Biphenyl]-2-Carboxamide
(3266) ##STR00656##
(3267) To a solution of rac-5-(aminomethyl)-5-[1-(difluoromethyl)-1H-pyrazol-5-yl]imidazolidine-2,4-dione hydrochloride (57.0 mg, 202 mol) and 4-chloro[1,1-biphenyl]-2-carboxylicacid (47.1 mg, 202 mol) in DMF (990 l) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (50.4 mg, 263 mol), 1-hydroxybenzotriazole hydrate (40.3 mg, 263 mol) and N,N-diisopropylethylamine (180 l, 1.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 49.5 mg (100% purity, 53% yield) of the desired product were obtained.
(3268) LC-MS (Method 7): R.sub.t=1.55 min; MS (ESIpos): m/z=460 [M+H].sup.+
(3269) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.069 (1.66), 2.084 (2.94), 2.422 (0.58), 2.651 (0.50), 2.889 (0.47), 3.328 (0.87), 3.788 (2.47), 3.799 (2.65), 3.811 (4.06), 3.822 (3.80), 3.875 (3.80), 3.885 (4.09), 3.898 (2.54), 3.909 (2.40), 6.703 (9.65), 6.705 (9.83), 7.330 (12.05), 7.344 (15.48), 7.376 (4.83), 7.388 (12.71), 7.401 (6.92), 7.430 (5.38), 7.435 (16.00), 7.442 (7.11), 7.449 (12.22), 7.454 (3.98), 7.518 (3.64), 7.531 (5.48), 7.543 (2.24), 7.783 (9.40), 7.785 (9.48), 7.823 (2.66), 7.916 (2.66), 7.923 (2.55), 8.016 (2.25), 8.465 (3.67), 8.734 (2.64), 8.744 (5.15), 8.755 (2.54).
Example 259
Ent-4-Chloro-N-({4-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)[Biphenyl]-2-Carboxamide
(3270) ##STR00657##
(3271) Enantiomeric separation of rac-4-chloro-N-({4-[1-(difluoromethyl)-1H-pyrazol-5-yl]-2,5-dioxoimidazolidin-4-yl}methyl)[biphenyl]-2-carboxamide (47.2 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 55% n-heptan/45% isopropanol; flow rate: 25 ml/min; temperature: 50 C.; UV detection: 220 nm] afforded 20.0 mg (98% purity) of the desired product.
(3272) Analytical chiral HPLC: R.sub.t=1.86 min, e.e. =97.7% [column: 504.6 mm filled with Daicel Chiralpak ID-3 3 m; eluent: 50% n-heptan/50% isopropanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3273) LC-MS (Method 7): R.sub.t=1.56 min; MS (ESIpos): m/z=460 [M+H].sup.+
(3274) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.991 (0.41), 1.001 (0.41), 1.033 (1.75), 1.044 (1.69), 1.121 (0.80), 1.133 (1.63), 1.145 (0.80), 2.383 (0.92), 2.422 (1.15), 2.460 (0.61), 2.464 (1.08), 2.467 (1.27), 2.470 (1.08), 2.514 (1.43), 2.517 (1.53), 2.520 (1.40), 2.572 (2.93), 2.611 (1.02), 2.614 (0.64), 2.651 (1.08), 2.859 (0.64), 2.872 (0.61), 3.259 (1.50), 3.264 (1.82), 3.329 (2.45), 3.339 (0.45), 3.787 (2.17), 3.799 (2.33), 3.811 (3.54), 3.822 (3.28), 3.871 (3.22), 3.881 (3.47), 3.894 (2.20), 3.904 (1.94), 6.700 (8.48), 6.703 (8.51), 7.329 (11.86), 7.332 (3.86), 7.340 (4.53), 7.343 (15.36), 7.347 (1.75), 7.373 (3.67), 7.375 (3.76), 7.388 (9.53), 7.401 (5.42), 7.430 (4.59), 7.434 (16.00), 7.438 (4.69), 7.441 (5.96), 7.443 (5.71), 7.445 (4.59), 7.448 (11.89), 7.453 (3.44), 7.516 (3.35), 7.518 (3.35), 7.529 (4.81), 7.531 (4.62), 7.541 (2.01), 7.544 (1.98), 7.781 (8.19), 7.784 (8.03), 7.823 (2.20), 7.916 (2.10), 7.923 (2.04), 8.016 (1.75), 8.451 (1.59), 8.729 (2.07), 8.739 (3.98), 8.750 (1.91).
Example 260
Rac-N-({4-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3275) ##STR00658##
(3276) To a solution of rac-5-(aminomethyl)-5-[1-(difluoromethyl)-1H-pyrazol-5-yl]imidazolidine-2,4-dione hydrochloride (57.0 mg, 202 mol) and 4-(trifluoromethyl)[1, 1-biphenyl]-2-carboxylic add (53.9 mg, 202 mol) in DMF (990 l) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (50.4 mg, 263 mol), 1-hydroxybenzotriazole hydrate (40.3 mg, 263 mol) and N,N-diisopropylethylamine (180 l, 1.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 66.4 mg (100% purity, 66% yield) of the desired product were obtained.
(3277) LC-MS (Method 7): R.sub.t=1.64 min; MS (ESIpos): m/z=494 [M+H].sup.+
(3278) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.069 (0.81), 2.084 (3.39), 2.384 (0.47), 2.422 (0.76), 2.572 (0.50), 2.611 (0.39), 2.651 (0.68), 2.731 (0.42), 2.889 (0.42), 3.260 (0.42), 3.266 (1.12), 3.330 (0.99), 3.803 (3.39), 3.815 (3.52), 3.827 (5.52), 3.838 (5.19), 3.892 (5.34), 3.902 (5.65), 3.915 (3.52), 3.925 (3.34), 6.715 (14.07), 7.430 (6.75), 7.441 (14.12), 7.452 (10.06), 7.479 (4.93), 7.492 (8.78), 7.505 (4.33), 7.525 (14.07), 7.538 (15.61), 7.558 (5.45), 7.570 (8.13), 7.583 (3.34), 7.740 (16.00), 7.753 (14.23), 7.780 (13.79), 7.819 (3.70), 7.912 (3.80), 7.919 (3.67), 8.012 (3.15), 8.494 (14.38), 8.818 (3.70), 8.828 (7.40), 8.839 (3.70), 11.255 (2.50).
Example 261
Ent-N-({4-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3279) ##STR00659##
(3280) Enantiomeric separation of rac-N-({4-[1-(difluoromethyl)-1H-pyrazol-5-yl]-2,5-dioxoimidazolidin-4-yl}methyl)-4-(trifluoromethyl)[biphenyl]-2-carboxamide (64.4 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 70% n-heptan/30% isopropanol; flow rate: 25 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 28.0 mg (100% purity) of the desired product.
(3281) Analytical chiral HPLC: R.sub.t=1.43 min, e.e. =>99% [column: 504.6 mm filled with Daicel Chiralpak ID-3 3 m; eluent: 70% n-heptan/30% isopropanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3282) LC-MS (Method 7): R.sub.t=1.65 min; MS (ESIpos): m/z=494 [M+H].sup.+
(3283) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.96), 0.008 (7.84), 0.008 (8.56), 0.146 (0.90), 0.841 (0.93), 0.859 (2.31), 0.875 (0.80), 1.030 (4.89), 1.045 (4.94), 1.055 (0.66), 1.150 (0.61), 1.248 (1.73), 2.327 (0.74), 2.366 (1.04), 2.523 (3.48), 2.670 (0.74), 2.710 (1.01), 3.792 (2.92), 3.809 (3.08), 3.827 (5.45), 3.844 (5.08), 3.887 (5.05), 3.902 (5.50), 3.921 (2.95), 3.936 (2.68), 4.323 (0.90), 4.334 (0.85), 6.717 (14.11), 6.721 (14.35), 7.424 (5.08), 7.428 (5.74), 7.442 (11.69), 7.447 (10.18), 7.458 (9.91), 7.474 (4.84), 7.477 (4.94), 7.493 (8.40), 7.496 (7.65), 7.511 (5.05), 7.521 (13.29), 7.541 (15.34), 7.553 (6.54), 7.557 (6.22), 7.572 (7.55), 7.575 (7.18), 7.591 (2.76), 7.594 (2.82), 7.740 (16.00), 7.760 (13.34), 7.781 (14.03), 7.786 (13.50), 7.916 (4.07), 7.926 (3.83), 8.065 (3.51), 8.514 (11.64), 8.839 (3.30), 8.855 (6.91), 8.871 (3.30), 11.258 (1.65).
Example 262
Rac-N-({4-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3284) ##STR00660##
(3285) To a solution of rac-5-(aminomethyl)-5-[1-(difluoromethyl)-1H-pyrazol-5-yl]imidazolidine-2,4-dione hydrochloride (57.0 mg, 202 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (57.5 mg, 202 mol) in DMF (990 l) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (50.4 mg, 263 mol), 1-hydroxybenzotriazole hydrate (40.3 mg, 263 mol) and N,N-diisopropylethylamine (180 l, 1.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 66.4 mg (100% purity, 66% yield) of the desired product were obtained.
(3286) LC-MS (Method 7): R.sub.t=1.70 min, MS (ESIpos): m/z=512 [M+H].sup.+
(3287) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.069 (0.82), 2.084 (4.72), 2.422 (0.97), 2.570 (1.31), 2.651 (0.94), 3.249 (0.41), 3.329 (3.00), 3.802 (3.30), 3.813 (3.56), 3.825 (5.66), 3.836 (5.32), 3.882 (5.40), 3.892 (5.73), 3.905 (3.52), 3.915 (3.22), 6.715 (13.86), 6.717 (13.83), 7.322 (4.95), 7.326 (6.71), 7.338 (5.06), 7.342 (6.63), 7.348 (3.26), 7.352 (2.55), 7.362 (6.33), 7.366 (5.43), 7.376 (3.52), 7.380 (3.07), 7.475 (5.81), 7.484 (6.15), 7.489 (5.36), 7.499 (4.72), 7.544 (13.94), 7.558 (15.44), 7.753 (16.00), 7.767 (14.31), 7.777 (13.68), 7.780 (13.45), 7.810 (3.93), 7.903 (3.86), 7.910 (3.52), 8.003 (3.19), 8.510 (13.60), 8.845 (3.67), 8.855 (7.34), 8.865 (3.60), 11.257 (2.32).
Example 263
Rac-N-({2,5-Dioxo-4-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Imidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3288) ##STR00661##
(3289) To a solution of rac-5-(aminomethyl)-5-[5-(trifluoromethyl)-1,3-thiazol-4-yl]imidazolidine-2,4-dione hydrochloride (109 mg, 343 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (110 mg, 412 mol) in DMF (2.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (85.5 mg, 446 mol), 1-hydroxybenzotriazole hydrate (68.3 mg, 446 mol) and N,N-diisopropylethylamine (300 l, 1.7 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 109 mg (85% purity, 51% yield) of the desired product were obtained.
(3290) LC-MS (Method 7): R.sub.t=1.72 min; MS (ESIpos): m/z=529 [M+H].sup.+
(3291) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.056 (2.52), 2.073 (16.00), 3.359 (0.54), 4.010 (2.01), 4.020 (2.15), 4.032 (2.51), 4.043 (2.34), 4.239 (2.41), 4.250 (2.61), 4.262 (2.19), 4.273 (2.01), 7.424 (3.16), 7.436 (5.10), 7.444 (4.14), 7.456 (4.91), 7.471 (2.51), 7.483 (4.32), 7.495 (2.10), 7.550 (2.76), 7.562 (10.78), 7.575 (9.18), 7.760 (7.86), 7.773 (6.95), 7.793 (0.72), 7.806 (0.60), 8.230 (7.11), 8.638 (1.88), 8.649 (3.85), 8.659 (1.90), 9.379 (10.42), 11.126 (4.37).
Example 264
Ent-N-({2,5-Dioxo-4-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Imidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3292) ##STR00662##
(3293) Enantiomeric separation of rac-N-({2,5-dioxo-4-[5-(trifluoromethyl)-1,3-thiazol-4-yl]imidazolidin-4-yl}methyl)-4-(trifluoromethyl)[biphenyl]-2-carboxamide (108 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 50% n-heptan/50% isopropanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 31.1 mg (100% purity) of the desired product.
(3294) Analytical chiral HPLC: R.sub.t=1.63 min, e.e. =>99% [column: 504.6 mm filled with Daicel Chiralpak ID-3 3 m; eluent: 50% n-heptan/50% isopropanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3295) LC-MS (Method 7): R.sub.t=1.73 min; MS (ESIpos): m/z=529 [M+H].sup.+
(3296) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.067 (0.43), 1.034 (0.52), 1.043 (0.54), 2.069 (7.89), 2.422 (0.57), 2.572 (0.83), 2.651 (0.57), 3.269 (1.46), 3.331 (2.04), 4.012 (2.98), 4.022 (3.04), 4.034 (3.67), 4.045 (3.44), 4.226 (3.81), 4.236 (4.04), 4.249 (3.38), 4.259 (3.10), 7.422 (4.99), 7.437 (10.29), 7.451 (7.46), 7.466 (3.87), 7.479 (6.68), 7.492 (3.15), 7.546 (4.33), 7.559 (16.00), 7.573 (13.36), 7.754 (12.04), 7.767 (10.38), 8.188 (12.22), 8.593 (2.81), 8.603 (5.65), 8.614 (2.70), 9.373 (14.54), 11.087 (1.26).
Example 265
Rac-N-({2,5-Dioxo-4-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Imidazolidin-4-Yl}Methyl)-4-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3297) ##STR00663##
(3298) To a solution of rac-5-(aminomethyl)-5-[5-(trifluoromethyl)-1,3-thiazol-4-yl]imidazolidine-2,4-dione hydrochloride (100 mg, 316 mol) and 4-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (108 mg, 379 mol) in DMF (2.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (78.7 mg, 410 mol), 1-hydroxybenzotriazole hydrate (62.9 mg, 410 mol) and N,N-diisopropylethylamine (280 l, 1.6 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 85.6 mg (95% purity, 47% yield) of the desired product were obtained.
(3299) LC-MS (Method 7): R.sub.t=1.76 min; MS (ESIpos): m/z=547 [M+H].sup.+
(3300) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.057 (3.29), 2.073 (1.01), 2.425 (0.87), 2.654 (0.81), 3.290 (0.47), 3.299 (1.82), 3.361 (0.81), 3.368 (0.61), 4.016 (3.03), 4.027 (3.23), 4.039 (3.76), 4.049 (3.56), 4.236 (3.63), 4.246 (3.97), 4.259 (3.29), 4.269 (3.03), 7.231 (3.90), 7.236 (4.50), 7.246 (4.03), 7.251 (4.24), 7.405 (1.82), 7.410 (1.95), 7.419 (4.24), 7.424 (4.37), 7.434 (2.49), 7.438 (2.62), 7.494 (4.64), 7.503 (4.71), 7.508 (3.70), 7.517 (3.56), 7.542 (10.49), 7.556 (11.16), 7.759 (11.56), 7.773 (10.22), 7.790 (0.81), 7.803 (0.74), 8.312 (10.15), 8.790 (2.76), 8.800 (5.71), 8.811 (2.76), 9.381 (16.00), 11.091 (0.54), 11.153 (6.66).
Example 266
Ent-N-({2,5-Dioxo-4-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Imidazolidin-4-Yl}Methyl)-4-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3301) ##STR00664##
(3302) Enantiomeric separation of rac-N-({2,5-dioxo-4-[5-(trifluoromethyl)-1,3-thiazol-4-yl]imidazolidin-4-yl}methyl)-4-fluoro-4-(trifluoromethyl)[biphenyl]-2-carboxamide (85 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 70% n-heptan/30% isopropanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 210 nm] afforded 28.8 mg (94% purity) of the desired product.
(3303) Analytical chiral HPLC: R.sub.t=1.64 min, e.e. =99% [column: 504.6 mm filled with Daicel Chiralpak ID-3 3 m; eluent: 50% n-heptan/50% isopropanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3304) LC-MS (Method 7): R.sub.t=1.76 min; MS (ESIpos): m/z=547 [M+H].sup.+
(3305) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.157 (0.45), 2.073 (16.00), 4.008 (1.11), 4.024 (1.21), 4.043 (1.53), 4.058 (1.42), 4.224 (1.43), 4.240 (1.59), 4.258 (1.22), 4.274 (1.11), 7.226 (1.72), 7.233 (2.07), 7.248 (1.79), 7.255 (1.96), 7.395 (0.77), 7.402 (0.80), 7.417 (1.92), 7.423 (1.99), 7.438 (1.25), 7.444 (1.26), 7.488 (2.12), 7.502 (2.26), 7.509 (1.58), 7.523 (1.45), 7.538 (3.88), 7.558 (4.54), 7.754 (4.76), 7.775 (3.96), 8.303 (4.56), 8.776 (1.01), 8.791 (2.17), 8.807 (1.04), 9.381 (5.86), 11.144 (1.48).
Example 267
Rac-N-({2,5-Dioxo-4-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Imidazolidin-4-Yl}Methyl)-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3306) ##STR00665##
(3307) To a solution of rac-5-(aminomethyl)-5-[5-(trifluoromethyl)-1,3-thiazol-4-yl]imidazolidine-2,4-dione hydrochloride (100 mg, 316 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (108 mg, 379 mol) in DMF (2.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (78.7 mg, 410 mol), 1-hydroxybenzotriazole hydrate (62.9 mg, 410 mol) and N,N-diisopropylethylamine (280 l, 1.6 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 84.9 mg (91% purity, 45% yield) of the desired product were obtained.
(3308) LC-MS (Method 7): R.sub.t=1.78 min, MS (ESIpos): m/z=547 [M+H].sup.+
(3309) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.047 (2.35), 2.073 (16.00), 2.425 (0.50), 2.653 (0.50), 3.296 (0.46), 3.300 (1.18), 3.365 (1.09), 3.372 (0.46), 4.009 (2.52), 4.020 (2.65), 4.032 (3.11), 4.043 (2.90), 4.224 (2.98), 4.234 (3.28), 4.247 (2.69), 4.257 (2.44), 7.328 (2.56), 7.332 (4.45), 7.339 (2.48), 7.344 (3.65), 7.348 (4.75), 7.353 (4.54), 7.357 (2.98), 7.367 (2.44), 7.372 (2.18), 7.386 (0.50), 7.465 (3.44), 7.474 (3.57), 7.478 (3.19), 7.488 (2.77), 7.580 (8.44), 7.594 (9.28), 7.773 (9.57), 7.787 (8.36), 7.806 (0.63), 7.820 (0.55), 8.260 (8.57), 8.669 (2.31), 8.680 (4.75), 8.690 (2.27), 9.376 (13.14), 11.127 (5.67).
Example 268
Ent-N-({2,5-Dioxo-4-[5-(Trifluoromethyl)-1,3-Thiazol-4-Yl]Imidazolidin-4-Yl}Methyl)-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3310) ##STR00666##
(3311) Enantiomeric separation of rac-N-({2,5-dioxo-4-[5-(trifluoromethyl)-1,3-thiazol-4-yl]imidazolidin-4-yl}methyl)-5-fluoro-4-(trifluoromethyl)[biphenyl]-2-carboxamide (85 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 50% n-heptan/50% isopropanol; flow rate: 15 ml/min; temperature: 50 C.; UV detection: 220 nm] afforded 26.9 mg (100% purity) of the desired product.
(3312) Analytical chiral HPLC: R.sub.t=5.30 min, e.e. =99% [column: 2504.6 mm filled with Daicel Chiralpak ID 5 m; eluent: 50% n-heptan/50% isopropanol; flow rate: 1 ml/min; temperature: 50 C.; UV detection: 220 nm]
(3313) LC-MS (Method 7): R.sub.t=1.78 min; MS (ESIpos): m/z=547 [M+H].sup.+
(3314) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.81), 0.008 (1.73), 0.987 (0.51), 1.003 (0.53), 1.261 (0.51), 2.323 (0.70), 2.327 (0.98), 2.332 (0.72), 2.366 (0.75), 2.523 (3.92), 2.665 (0.79), 2.669 (1.07), 2.674 (0.79), 2.710 (0.79), 4.002 (3.26), 4.017 (3.47), 4.036 (4.43), 4.052 (4.11), 4.211 (4.11), 4.226 (4.56), 4.245 (3.52), 4.260 (3.13), 7.321 (3.26), 7.327 (7.63), 7.336 (1.75), 7.351 (13.85), 7.357 (4.39), 7.372 (4.09), 7.378 (2.88), 7.458 (4.99), 7.473 (4.73), 7.479 (4.47), 7.494 (3.45), 7.576 (10.97), 7.596 (12.87), 7.768 (13.38), 7.789 (11.10), 8.248 (12.02), 8.654 (2.88), 8.669 (6.33), 8.685 (2.96), 9.376 (16.00), 11.116 (5.52).
Example 269
Rac-N-{[4-(2,5-Dimethyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3315) ##STR00667##
(3316) To a solution of rac-5-(aminomethyl)-5-(2,5-dimethyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (60.0 mg, 217 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (61.6 mg, 217 mol) in DMF (1.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (54.0 mg, 282 mol), 1-hydroxybenzotriazole hydrate (43.2 mg, 282 mol) and N,N-diisopropylethylamine (260 l, 1.5 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 30.9 mg (96% purity, 27% yield) of the desired product were obtained.
(3317) LC-MS (Method 8): R.sub.t=0.88 min, MS (ESIpos): m/z=507 [M+H].sup.+
(3318) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.02), 0.008 (1.05), 2.347 (16.00), 2.524 (0.83), 3.828 (2.08), 3.843 (1.90), 3.847 (1.97), 7.319 (1.17), 7.325 (1.81), 7.336 (1.02), 7.343 (1.35), 7.350 (1.88), 7.357 (1.92), 7.363 (1.26), 7.378 (1.03), 7.385 (0.83), 7.456 (1.46), 7.471 (1.47), 7.477 (1.21), 7.491 (1.05), 7.517 (2.83), 7.537 (3.20), 7.758 (3.38), 7.779 (2.99), 8.503 (2.44), 8.506 (2.45), 8.755 (0.74), 8.770 (1.57), 8.785 (0.72), 11.157 (2.16).
Example 270
Rac-N-{[4-(5-Cyclopropyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3319) ##STR00668##
(3320) To a solution of rac-5-(aminomethyl)-5-(5-cyclopropyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (110 mg, 381 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (101 mg, 381 mol) in DMF (2.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (94.9 mg, 495 mol), 1-hydroxybenzotriazole hydrate (75.8 mg, 495 mol) and N,N-diisopropylethylamine (460 l, 2.7 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 110 mg (98% purity, 57% yield) of the desired product were obtained.
(3321) LC-MS (Method 8): R.sub.t=0.92 min, MS (ESIpos): m/z=501 [M+H].sup.+
(3322) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.96), 0.008 (0.97), 0.524 (0.76), 0.538 (1.56), 0.547 (1.80), 0.551 (2.00), 0.561 (2.22), 0.565 (2.00), 0.575 (1.41), 0.579 (1.13), 0.680 (1.03), 0.685 (1.39), 0.689 (1.56), 0.694 (2.08), 0.699 (2.17), 0.708 (1.87), 0.712 (1.82), 0.722 (1.75), 0.735 (0.87), 0.976 (0.62), 0.985 (0.55), 0.989 (0.50), 0.999 (1.78), 1.008 (2.29), 1.012 (2.25), 1.018 (4.69), 1.028 (3.04), 1.033 (2.64), 1.038 (5.04), 1.044 (2.37), 1.048 (2.20), 1.058 (1.63), 1.067 (0.55), 1.071 (0.50), 1.081 (0.52), 1.923 (0.92), 1.936 (1.88), 1.944 (2.00), 1.948 (1.26), 1.957 (3.58), 1.964 (1.24), 1.969 (1.88), 1.977 (1.75), 1.990 (0.79), 2.072 (9.88), 4.106 (8.05), 4.122 (8.07), 7.441 (5.80), 7.460 (16.00), 7.476 (5.48), 7.497 (1.63), 7.536 (3.28), 7.541 (3.01), 7.554 (3.70), 7.559 (3.23), 7.582 (7.71), 7.602 (8.87), 7.766 (9.26), 7.787 (7.56), 8.265 (7.04), 8.601 (2.05), 8.617 (4.39), 8.632 (2.00), 8.788 (12.35), 11.000 (5.93).
Example 271
Ent-N-{[4-(5-Cyclopropyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3323) ##STR00669##
(3324) Enantiomeric separation of rac-N-{[4-(5-cyclopropyl-1,3-thiazol-4-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (110 mg) by preparative chiral HPLC [column: Daicel Chiralpak IA 5 m, 25020 mm; eluent: 50% n-heptane/50% isopropanol; flow rate: 20 ml/min; temperature: 50 C.; UV detection: 220 nm] afforded 40.9 mg (100% purity) of the desired product.
(3325) Analytical chiral HPLC: R.sub.t=7.65 min, e.e. =>99% [column: 2504.6 mm filled with Daicel Chiralpak IA 5 m; eluent: 50% n-heptane/50% isopropanol; flow rate: 1 ml/min; temperature: 50 C.; UV detection: 220 nm]
(3326) LC-MS (Method 7): R.sub.t=1.74 min; MS (ESIpos): m/z=501 [M+H].sup.+
(3327) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.65), 0.008 (0.68), 0.523 (0.62), 0.537 (1.29), 0.547 (1.48), 0.551 (1.66), 0.561 (1.79), 0.564 (1.57), 0.574 (1.20), 0.579 (0.96), 0.680 (0.86), 0.685 (1.20), 0.689 (1.29), 0.694 (1.70), 0.698 (1.79), 0.708 (1.57), 0.712 (1.51), 0.722 (1.48), 0.735 (0.71), 0.975 (0.52), 0.985 (0.49), 0.998 (1.48), 1.008 (1.91), 1.012 (1.76), 1.017 (3.98), 1.022 (2.22), 1.029 (3.27), 1.038 (4.35), 1.045 (3.02), 1.058 (1.42), 1.066 (0.43), 1.081 (0.46), 1.922 (0.86), 1.935 (1.70), 1.943 (1.82), 1.948 (1.05), 1.956 (3.33), 1.964 (1.11), 1.969 (1.66), 1.977 (1.60), 1.990 (0.74), 2.327 (0.68), 2.332 (0.52), 2.366 (0.40), 2.523 (2.34), 2.665 (0.52), 2.670 (0.71), 2.710 (0.40), 4.105 (6.57), 4.121 (6.60), 7.440 (4.78), 7.459 (12.92), 7.475 (4.90), 7.493 (1.20), 7.497 (1.39), 7.536 (2.96), 7.541 (2.74), 7.554 (3.14), 7.559 (2.71), 7.581 (6.35), 7.601 (7.34), 7.766 (7.77), 7.787 (6.29), 8.263 (6.72), 8.600 (1.60), 8.616 (3.51), 8.631 (1.57), 8.788 (16.00), 10.999 (5.21).
Example 272
Rac-N-{[4-(5-Cyclopropyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3328) ##STR00670##
(3329) To a solution of rac-5-(aminomethyl)-5-(5-cyclopropyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (110 mg, 381 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (108 mg, 381 mol) in DMF (2.0 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (94.9 mg, 495 mol), 1-hydroxybenzotriazole hydrate (75.8 mg, 495 mol) and N,N-diisopropylethylamine (460 l, 2.7 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 78.1 mg (100% purity, 40% yield) of the desired product were obtained.
(3330) LC-MS (Method 8): R.sub.t=0.94 min, MS (ESIpos): m/z=519 [M+H].sup.+
(3331) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.90), 0.008 (0.90), 0.523 (0.70), 0.537 (1.37), 0.547 (1.57), 0.551 (1.75), 0.560 (1.92), 0.564 (1.70), 0.574 (1.26), 0.578 (0.99), 0.680 (0.93), 0.685 (1.23), 0.689 (1.35), 0.694 (1.78), 0.698 (1.86), 0.707 (1.65), 0.712 (1.58), 0.722 (1.56), 0.735 (0.77), 0.975 (0.57), 0.984 (0.51), 0.989 (0.44), 0.998 (1.58), 1.008 (2.02), 1.012 (1.90), 1.017 (4.18), 1.022 (2.35), 1.028 (2.67), 1.032 (2.25), 1.038 (4.45), 1.043 (2.03), 1.048 (1.86), 1.058 (1.45), 1.066 (0.48), 1.071 (0.43), 1.080 (0.45), 1.918 (0.90), 1.931 (1.78), 1.939 (1.92), 1.944 (1.15), 1.952 (3.47), 1.960 (1.18), 1.964 (1.80), 1.972 (1.67), 1.985 (0.77), 4.081 (0.51), 4.100 (4.64), 4.104 (4.65), 4.116 (4.56), 4.120 (4.76), 4.139 (0.53), 4.155 (0.40), 7.322 (6.84), 7.325 (3.33), 7.340 (3.15), 7.345 (6.92), 7.350 (3.39), 7.361 (2.61), 7.367 (1.44), 7.478 (2.19), 7.483 (1.45), 7.493 (2.99), 7.500 (2.65), 7.508 (0.84), 7.516 (2.17), 7.600 (6.56), 7.621 (7.85), 7.780 (8.26), 7.801 (6.75), 8.286 (8.85), 8.639 (1.73), 8.654 (3.81), 8.670 (1.76), 8.787 (16.00), 11.003 (3.31).
Example 273
Ent-N-{[4-(5-Cyclopropyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3332) ##STR00671##
(3333) To a solution of ent-5-(aminomethyl)-5-(5-cyclopropyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 346 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (98.4 mg, 346 mol) in DMF (2.2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (86.3 mg, 450 mol), 1-hydroxybenzotriazole hydrate (68.9 mg, 450 mol) and N,N-diisopropylethylamine (300 l, 1.7 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 73.8 mg (100% purity, 41% yield) of the desired product were obtained.
(3334) LC-MS (Method 7): R.sub.t=1.78 min, MS (ESIpos): m/z=519 [M+H].sup.+
(3335) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.530 (0.64), 0.538 (0.90), 0.540 (1.05), 0.551 (1.57), 0.556 (1.10), 0.560 (1.87), 0.566 (1.46), 0.570 (0.96), 0.576 (0.75), 0.683 (0.76), 0.689 (1.04), 0.692 (1.36), 0.699 (1.83), 0.702 (1.12), 0.708 (1.66), 0.718 (1.25), 0.729 (0.69), 0.983 (0.49), 0.991 (0.50), 0.995 (0.44), 1.001 (1.26), 1.010 (1.58), 1.013 (1.35), 1.018 (2.83), 1.026 (2.59), 1.030 (2.29), 1.037 (2.53), 1.043 (1.44), 1.046 (1.37), 1.055 (1.22), 1.061 (0.45), 1.065 (0.43), 1.073 (0.42), 1.925 (0.77), 1.936 (1.53), 1.942 (1.64), 1.946 (0.91), 1.952 (2.94), 1.959 (0.95), 1.963 (1.47), 1.969 (1.41), 1.979 (0.65), 4.074 (0.41), 4.086 (0.55), 4.102 (3.44), 4.107 (3.42), 4.114 (3.28), 4.119 (3.33), 4.134 (0.50), 4.147 (0.42), 7.324 (5.67), 7.343 (5.91), 7.357 (1.87), 7.362 (1.08), 7.482 (1.66), 7.485 (1.42), 7.494 (1.97), 7.498 (1.86), 7.500 (1.82), 7.508 (0.80), 7.512 (1.56), 7.603 (5.17), 7.619 (5.91), 7.782 (6.33), 7.799 (5.21), 8.285 (7.08), 8.640 (1.42), 8.652 (2.93), 8.665 (1.35), 8.786 (16.00), 10.999 (1.18).
Example 274
Ent-N-{[4-(5-Cyclopropyl-1,3-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(3336) ##STR00672##
(3337) To a solution of ent-5-(aminomethyl)-5-(5-cyclopropyl-1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 346 mol) and 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (92.5 mg, 346 mol) in DMF (2.2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (86.3 mg, 450 mol), 1-hydroxybenzotriazole hydrate (68.9 mg, 450 mol) and N,N-diisopropylethylamine (300 l, 1.7 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 88.8 mg (96% purity, 49% yield) of the desired product were obtained.
(3338) LC-MS (Method 7): R.sub.t=1.50 min, MS (ESIpos): m/z=502 [M+H].sup.+
(3339) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 0.007 (0.44), 0.528 (0.64), 0.536 (0.87), 0.538 (0.98), 0.549 (1.48), 0.555 (1.02), 0.559 (1.88), 0.565 (1.44), 0.569 (0.87), 0.575 (0.70), 0.680 (0.75), 0.686 (0.98), 0.690 (1.38), 0.696 (1.88), 0.700 (1.04), 0.706 (1.53), 0.716 (1.13), 0.727 (0.66), 0.980 (0.47), 0.988 (0.50), 0.992 (0.44), 0.999 (1.21), 1.007 (1.48), 1.010 (1.25), 1.016 (2.33), 1.019 (1.65), 1.025 (2.03), 1.027 (1.82), 1.033 (1.70), 1.036 (2.03), 1.042 (1.30), 1.045 (1.25), 1.053 (1.16), 1.060 (0.41), 1.922 (0.75), 1.932 (1.45), 1.939 (1.54), 1.942 (0.84), 1.949 (2.78), 1.955 (0.87), 1.959 (1.38), 1.965 (1.30), 1.976 (0.61), 4.068 (0.67), 4.081 (0.80), 4.096 (2.77), 4.109 (4.80), 4.121 (2.68), 4.136 (0.73), 4.149 (0.63), 7.498 (1.70), 7.500 (1.50), 7.513 (3.93), 7.516 (2.77), 7.530 (4.48), 7.533 (2.11), 7.543 (5.71), 7.546 (7.08), 7.560 (1.84), 7.563 (1.19), 7.593 (2.74), 7.596 (2.54), 7.608 (2.16), 7.611 (2.88), 7.623 (1.12), 7.626 (1.02), 7.938 (2.97), 7.954 (4.89), 7.997 (2.68), 8.001 (2.54), 8.013 (1.51), 8.017 (1.50), 8.278 (5.43), 8.676 (1.32), 8.689 (2.75), 8.701 (1.42), 8.757 (3.90), 8.761 (3.75), 8.790 (16.00), 11.003 (2.92).
Example 275
Rac-N-{[4-(1,3-Dimethyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3340) ##STR00673##
(3341) To a solution of rac-5-(aminomethyl)-5-(1,3-dimethyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 193 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (56.4 mg, 212 mol) in DMF (2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.0 mg, 250 mol), 1-hydroxybenzotriazole hydrate (38.3 mg, 250 mol) and N,N-diisopropylethylamine (200 l, 1.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 27.4 mg (100% purity, 30% yield) of the desired product were obtained.
(3342) LC-MS (Method 7): R.sub.t=1.61 min, MS (ESIpos): m/z=472 [M+H].sup.+
(3343) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.097 (14.29), 3.702 (16.00), 3.823 (0.79), 3.833 (0.86), 3.845 (1.31), 3.856 (1.15), 3.905 (1.21), 3.916 (1.27), 3.927 (0.81), 3.939 (0.76), 6.235 (5.17), 7.429 (1.26), 7.432 (1.47), 7.436 (1.72), 7.442 (2.17), 7.444 (2.25), 7.448 (2.15), 7.469 (1.09), 7.471 (1.05), 7.482 (1.85), 7.484 (1.66), 7.494 (0.92), 7.496 (0.83), 7.519 (2.91), 7.532 (3.18), 7.548 (1.22), 7.550 (1.15), 7.561 (1.73), 7.563 (1.59), 7.573 (0.71), 7.575 (0.72), 7.747 (3.31), 7.761 (2.96), 8.339 (3.31), 8.700 (0.78), 8.711 (1.45), 8.721 (0.78), 11.197 (1.58).
Example 276
Rac-N-{[4-(1,3-Dimethyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3344) ##STR00674##
(3345) To a solution of rac-5-(aminomethyl)-5-(1,3-dimethyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 193 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (60.2 mg, 212 mol) in DMF (990) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.0 mg, 250 mol), 1-hydroxybenzotriazole hydrate (38.3 mg, 250 mol) and N,N-diisopropylethylamine (200 l, 1.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 33.2 mg (90% purity, 32% yield) of the desired product were obtained.
(3346) LC-MS (Method 7): R.sub.t=1.66 min; MS (ESIpos): m/z=490 [M+H].sup.+
(3347) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.096 (13.73), 3.698 (16.00), 3.813 (0.80), 3.823 (0.84), 3.836 (1.23), 3.846 (1.07), 3.899 (1.15), 3.911 (1.21), 3.922 (0.79), 3.934 (0.72), 6.233 (5.02), 7.316 (1.09), 7.320 (1.59), 7.332 (1.11), 7.337 (2.21), 7.342 (0.71), 7.351 (1.54), 7.356 (1.23), 7.365 (0.79), 7.370 (0.66), 7.473 (1.30), 7.483 (1.34), 7.487 (1.18), 7.497 (1.09), 7.541 (2.72), 7.554 (2.93), 7.638 (0.46), 7.760 (3.27), 7.774 (3.08), 8.360 (3.36), 8.736 (0.75), 8.746 (1.34), 8.757 (0.72).
Example 277
Ent-N-{[2,5-Dioxo-4-(1,3-Thiazol-4-Yl)Imidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(3348) ##STR00675##
(3349) To a solution of ent-5-(aminomethyl)-5-(1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 402 mol) and 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (107 mg, 402 mol) in DMF (2.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (100 mg, 523 mol), 1-hydroxybenzotriazole hydrate (80.1 mg, 523 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 78.6 mg (100% purity, 42% yield) of the desired product were obtained.
(3350) LC-MS (Method 7): R.sub.t=1.29 min; MS (ESIpos): m/z=462 [M+H].sup.+
(3351) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.56), 2.383 (0.54), 2.422 (0.59), 2.514 (1.10), 2.517 (1.00), 2.520 (0.91), 2.574 (1.01), 2.608 (0.46), 2.611 (0.54), 2.651 (0.52), 2.731 (0.49), 2.890 (0.63), 3.264 (0.49), 3.331 (0.96), 3.902 (2.62), 3.912 (2.79), 3.925 (5.59), 3.935 (5.14), 3.956 (5.22), 3.966 (5.74), 3.979 (2.79), 3.988 (2.45), 7.485 (4.43), 7.487 (4.54), 7.498 (7.54), 7.500 (7.03), 7.519 (5.76), 7.531 (10.63), 7.541 (7.99), 7.543 (5.90), 7.554 (3.85), 7.556 (2.96), 7.592 (5.15), 7.595 (5.03), 7.605 (6.83), 7.607 (6.45), 7.617 (2.64), 7.619 (2.43), 7.787 (16.00), 7.790 (15.93), 7.916 (6.27), 7.929 (10.24), 7.967 (5.63), 7.970 (5.46), 7.980 (3.24), 7.983 (3.19), 8.287 (14.26), 8.728 (9.11), 8.732 (9.66), 8.745 (2.77), 9.121 (14.61), 9.124 (14.70), 10.882 (0.78).
Example 278
Ent-N-{[2,5-Dioxo-4-(1,3-Thiazol-4-Yl)Imidazolidin-4-Yl]Methyl}-5,6-Difluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3352) ##STR00676##
(3353) To a solution of ent-5-(aminomethyl)-5-(1,3-thiazol-4-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 402 mol) and 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (122 mg, 402 mol) in DMF (2.5 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (100 mg, 523 mol), 1-hydroxybenzotriazole hydrate (80.1 mg, 523 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 96.0 mg (96% purity, 46% yield) of the desired product were obtained.
(3354) LC-MS (Method 7): R.sub.t=1.64 min, MS (ESIpos): m/z=497 [M+H].sup.+
(3355) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.82), 0.008 (0.93), 2.323 (0.51), 2.328 (0.68), 2.332 (0.54), 2.367 (0.56), 2.524 (2.59), 2.665 (0.54), 2.670 (0.70), 2.675 (0.54), 2.710 (0.51), 2.732 (0.54), 2.890 (0.70), 3.802 (2.62), 3.818 (2.85), 3.836 (4.73), 3.853 (4.37), 3.906 (4.39), 3.921 (4.87), 3.940 (2.87), 3.955 (2.51), 7.279 (2.51), 7.288 (2.76), 7.291 (2.70), 7.297 (3.21), 7.300 (3.04), 7.309 (3.07), 7.313 (2.76), 7.547 (9.24), 7.567 (10.85), 7.579 (2.73), 7.599 (3.61), 7.604 (3.44), 7.624 (3.61), 7.645 (2.11), 7.764 (15.63), 7.769 (16.00), 7.798 (12.82), 7.818 (11.15), 7.835 (0.68), 8.295 (13.41), 8.724 (2.76), 8.739 (5.86), 8.754 (2.73), 9.116 (10.48), 9.121 (10.48).
Example 279
Rac-N-{[4-(1-Chlorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3356) ##STR00677##
(3357) To a solution of rac-5-(aminomethyl)-5-(1-chlorocyclopropyl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 208 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (61.0 mg, 229 mol) in DMF (2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (51.9 mg, 271 mol), 1-hydroxybenzotriazole hydrate (41.5 mg, 271 mol) and N,N-diisopropylethylamine (220 l, 1.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 50.0 mg (92% purity, 49% yield) of the desired product were obtained.
(3358) LC-MS (Method 7): R.sub.t=1.74 min, MS (ESIpos): m/z=452 [M+H].sup.+
(3359) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.90), 1.004 (1.36), 1.013 (2.00), 1.024 (2.91), 1.032 (5.41), 1.037 (3.73), 1.050 (3.66), 1.055 (6.40), 1.062 (3.30), 1.073 (2.34), 1.082 (1.86), 1.182 (1.59), 1.190 (2.08), 1.202 (3.15), 1.209 (6.37), 1.215 (7.80), 1.220 (5.82), 1.228 (2.92), 1.239 (1.67), 1.248 (1.15), 2.053 (0.42), 2.511 (2.23), 2.517 (0.79), 2.520 (0.77), 2.783 (1.55), 3.326 (0.42), 3.471 (3.74), 3.481 (3.96), 3.494 (5.06), 3.504 (4.80), 3.597 (4.93), 3.608 (5.35), 3.620 (3.95), 3.630 (3.59), 7.386 (5.75), 7.388 (6.01), 7.399 (8.51), 7.401 (8.14), 7.410 (0.67), 7.429 (6.26), 7.430 (6.91), 7.443 (8.44), 7.454 (4.43), 7.456 (4.32), 7.466 (8.32), 7.469 (7.36), 7.479 (4.34), 7.481 (3.82), 7.505 (0.42), 7.516 (0.65), 7.538 (15.35), 7.548 (11.06), 7.550 (16.00), 7.552 (14.93), 7.560 (3.77), 7.563 (3.46), 7.601 (0.47), 7.613 (0.41), 7.752 (14.58), 7.766 (12.90), 7.803 (0.48), 8.031 (14.40), 8.603 (3.14), 8.614 (6.57), 8.624 (3.15), 10.877 (3.55).
Example 280
Ent-N-{[4-(1-Chlorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3360) ##STR00678##
(3361) Enantiomeric separation of rac-N-{[4-(1-chlorocyclopropyl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (50 mg) by preparative chiral HPLC [column: Daicel Chiralpak IF 5 m, 25020 mm; eluent: 70% n-heptane/30% ethanol; flow rate: 20 ml/min; temperature: 50 C.; UV detection: 220 nm] afforded 23.9 mg (97% purity) of the desired product.
(3362) Analytical chiral HPLC: R.sub.t=1.97 min, e.e. =>99% [Daicel Chiralpak IF-3 3 m, 504.6 mm; eluent: 70% n-heptane/30% ethanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3363) LC-MS (Method 7): R.sub.t=1.71 min; MS (ESIpos): m/z=452 [M+H].sup.+
(3364) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (1.28), 0.847 (0.97), 0.858 (0.89), 0.874 (0.53), 1.004 (1.31), 1.013 (1.93), 1.024 (2.84), 1.032 (5.33), 1.036 (3.59), 1.050 (3.52), 1.054 (6.15), 1.062 (3.10), 1.073 (2.28), 1.082 (1.83), 1.090 (0.52), 1.100 (0.45), 1.114 (0.46), 1.125 (0.42), 1.181 (1.55), 1.189 (2.04), 1.201 (3.04), 1.208 (6.25), 1.214 (7.61), 1.219 (5.66), 1.228 (2.91), 1.238 (2.31), 1.248 (1.41), 2.383 (0.46), 2.422 (0.49), 2.514 (0.97), 2.517 (0.94), 2.520 (0.80), 2.573 (0.46), 2.611 (0.45), 2.651 (0.46), 3.328 (0.59), 3.470 (3.52), 3.480 (3.72), 3.493 (4.78), 3.503 (4.56), 3.596 (4.63), 3.607 (5.08), 3.619 (3.76), 3.629 (3.38), 3.733 (1.41), 3.895 (0.77), 7.385 (5.42), 7.387 (5.76), 7.398 (7.73), 7.400 (7.67), 7.430 (6.63), 7.443 (8.12), 7.454 (4.07), 7.456 (3.95), 7.466 (7.89), 7.468 (7.02), 7.479 (3.98), 7.481 (3.50), 7.538 (15.25), 7.548 (11.09), 7.550 (16.00), 7.560 (3.32), 7.562 (3.04), 7.752 (13.28), 7.766 (11.71), 8.029 (13.13), 8.602 (3.04), 8.612 (6.26), 8.622 (3.01), 10.877 (7.01).
Example 281
Rac-N-{[4-(1-Chlorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(3365) ##STR00679##
(3366) To a solution of rac-5-(aminomethyl)-5-(1-chlorocyclopropyl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 208 mol) and 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (61.2 mg, 229 mol) in DMF (1.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (51.9 mg, 271 mol), 1-hydroxybenzotriazole hydrate (41.5 mg, 271 mol) and N,N-diisopropylethylamine (220 l, 1.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 52.9 mg (99% purity, 56% yield) of the desired product were obtained.
(3367) LC-MS (Method 7): R.sub.t=1.47 min, MS (ESIpos): m/z=453 [M+H].sup.+
(3368) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.95), 1.004 (1.57), 1.013 (2.23), 1.026 (3.21), 1.032 (5.48), 1.035 (4.86), 1.053 (4.89), 1.056 (6.60), 1.062 (3.34), 1.074 (2.60), 1.083 (1.85), 1.183 (1.82), 1.191 (1.79), 1.202 (3.67), 1.210 (7.75), 1.214 (9.92), 1.218 (6.87), 1.227 (3.18), 1.236 (1.38), 1.247 (1.09), 2.383 (0.52), 2.422 (0.60), 2.467 (0.90), 2.470 (1.12), 2.473 (1.06), 2.514 (0.79), 2.517 (0.71), 2.520 (0.62), 2.572 (1.08), 2.605 (0.62), 2.611 (0.54), 2.651 (0.55), 2.816 (0.46), 3.261 (1.39), 3.264 (0.87), 3.328 (1.12), 3.477 (3.86), 3.488 (4.04), 3.500 (5.74), 3.510 (5.40), 3.572 (5.60), 3.582 (6.03), 3.594 (3.94), 3.605 (3.61), 7.446 (6.36), 7.448 (6.36), 7.458 (8.56), 7.460 (8.20), 7.515 (7.14), 7.526 (11.41), 7.528 (13.75), 7.538 (9.57), 7.540 (7.26), 7.551 (5.02), 7.553 (3.94), 7.590 (6.33), 7.592 (6.17), 7.603 (8.09), 7.605 (7.88), 7.615 (3.12), 7.617 (2.96), 7.926 (3.81), 7.939 (15.84), 7.940 (15.81), 7.945 (10.54), 7.948 (9.54), 7.959 (2.06), 7.962 (2.23), 8.059 (16.00), 8.668 (3.45), 8.679 (7.06), 8.689 (3.32), 8.727 (10.11), 10.874 (5.44).
Example 282
Rac-N-{[4-(1-Chlorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3369) ##STR00680##
(3370) To a solution of rac-5-(aminomethyl)-5-(1-chlorocyclopropyl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 208 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (65.1 mg, 229 mol) in DMF (1.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (51.9 mg, 271 mol), 1-hydroxybenzotriazole hydrate (41.5 mg, 271 mol) and N,N-diisopropylethylamine (220 l, 1.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 52.4 mg (99% purity, 53% yield) of the desired product were obtained.
(3371) LC-MS (Method 7): R.sub.t=1.79 min, MS (ESIpos): m/z=470 [M+H].sup.+
(3372) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (2.10), 1.005 (1.58), 1.014 (2.26), 1.025 (3.23), 1.033 (6.19), 1.037 (4.08), 1.051 (4.05), 1.055 (7.13), 1.063 (3.66), 1.074 (2.62), 1.083 (2.10), 1.179 (1.80), 1.187 (2.44), 1.199 (3.54), 1.206 (7.16), 1.212 (8.59), 1.217 (6.37), 1.225 (3.11), 1.236 (1.80), 1.245 (1.34), 2.383 (0.98), 2.422 (1.10), 2.513 (1.55), 2.517 (1.58), 2.520 (1.37), 2.569 (1.13), 2.571 (1.40), 2.611 (0.85), 2.650 (0.88), 3.326 (1.98), 3.469 (4.02), 3.480 (4.27), 3.492 (5.82), 3.503 (5.39), 3.580 (5.58), 3.590 (6.00), 3.603 (4.27), 3.613 (3.84), 7.309 (4.57), 7.313 (8.11), 7.320 (4.42), 7.325 (5.55), 7.329 (8.38), 7.334 (8.47), 7.338 (5.09), 7.348 (4.24), 7.352 (3.26), 7.426 (6.34), 7.436 (6.37), 7.440 (5.49), 7.450 (4.91), 7.555 (13.41), 7.569 (14.63), 7.767 (15.54), 7.780 (13.53), 8.056 (16.00), 8.635 (3.60), 8.645 (7.44), 8.655 (3.44), 10.871 (2.35).
Example 283
Rac-N-{[4-(1-Methyl-1H-Imidazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3373) ##STR00681##
(3374) To a solution of rac-5-(aminomethyl)-5-(1-methyl-1H-imidazol-5-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 204 mol) and 4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (59.6 mg, 224 mol) in DMF (2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (50.7 mg, 265 mol), 1-hydroxybenzotriazole hydrate (40.5 mg, 265 mol) and N,N-diisopropylethylamine (210 l, 1.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 32.2 mg (96% purity, 33% yield) of the desired product were obtained.
(3375) LC-MS (Method 7): R.sub.t=1.14 min, MS (ESIpos): m/z=458 [M+H].sup.+
(3376) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (1.18), 0.007 (0.93), 0.008 (1.31), 2.523 (1.28), 2.526 (0.95), 2.557 (0.47), 3.574 (16.00), 3.838 (0.68), 3.852 (0.77), 3.872 (1.45), 3.887 (1.31), 3.921 (1.31), 3.938 (1.38), 3.955 (0.71), 3.972 (0.67), 7.090 (3.61), 7.426 (1.14), 7.430 (2.40), 7.445 (2.67), 7.449 (4.07), 7.462 (1.46), 7.464 (1.48), 7.480 (2.14), 7.483 (1.78), 7.498 (0.93), 7.502 (0.85), 7.535 (3.26), 7.543 (2.07), 7.547 (2.17), 7.555 (3.93), 7.561 (2.63), 7.566 (1.94), 7.580 (0.74), 7.584 (0.77), 7.665 (3.36), 7.750 (3.93), 7.770 (3.23), 8.286 (2.79), 8.289 (2.84), 8.726 (0.82), 8.742 (1.67), 8.758 (0.84), 11.175 (2.42).
Example 284
Rac-5-Fluoro-N-{[4-(1-Methyl-1H-Imidazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3377) ##STR00682##
(3378) To a solution of rac-5-(aminomethyl)-5-(1-methyl-1H-imidazol-5-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 204 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (63.6 mg, 224 mol) in DMF (1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (50.7 mg, 265 mol), 1-hydroxybenzotriazole hydrate (40.5 mg, 265 mol) and N,N-diisopropylethylamine (210 l, 1.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 28.1 mg (99% purity, 29% yield) of the desired product were obtained.
(3379) LC-MS (Method 7): R.sub.t=1.19 min; MS (ESIpos): m/z=476 [M+H].sup.+
(3380) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.48), 2.514 (0.44), 2.517 (0.43), 3.569 (16.00), 3.834 (0.84), 3.844 (0.94), 3.857 (1.40), 3.867 (1.26), 3.921 (1.29), 3.933 (1.36), 3.944 (0.87), 3.955 (0.81), 7.071 (3.75), 7.314 (1.15), 7.318 (1.73), 7.330 (1.31), 7.334 (2.01), 7.346 (1.65), 7.351 (1.30), 7.360 (0.87), 7.365 (0.74), 7.475 (1.41), 7.485 (1.48), 7.489 (1.32), 7.499 (1.20), 7.558 (3.13), 7.571 (3.43), 7.638 (3.71), 7.762 (3.62), 7.776 (3.18), 8.134 (0.74), 8.283 (3.56), 8.733 (0.86), 8.744 (1.58), 8.754 (0.83), 11.152 (1.31).
Example 285
Rac-N-{[4-(1-Methyl-1H-Imidazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(3381) ##STR00683##
(3382) To a solution of rac-5-(aminomethyl)-5-(1-methyl-1H-imidazol-5-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 204 mol) and 2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (59.8 mg, 224 mol) in DMF (1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (50.7 mg, 265 mol), 1-hydroxybenzotriazole hydrate (40.5 mg, 265 mol) and N,N-diisopropylethylamine (210 l, 1.2 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 6f). After lyophilization, 25.6 mg (99% purity, 27% yield) of the desired product were obtained.
(3383) LC-MS (Method 7): R.sub.t=0.92 min; MS (ESIpos): m/z=459 [M+H].sup.+
(3384) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.514 (0.49), 2.517 (0.45), 2.572 (0.68), 2.731 (0.88), 2.890 (1.10), 3.330 (0.60), 3.566 (16.00), 3.843 (0.83), 3.853 (0.92), 3.866 (1.40), 3.876 (1.24), 3.924 (1.29), 3.936 (1.35), 3.947 (0.87), 3.958 (0.80), 7.079 (3.90), 7.080 (3.85), 7.491 (1.29), 7.493 (1.33), 7.503 (2.14), 7.505 (2.04), 7.517 (1.66), 7.530 (2.19), 7.535 (1.18), 7.537 (1.10), 7.547 (2.11), 7.550 (1.71), 7.560 (1.03), 7.562 (0.84), 7.601 (1.38), 7.603 (1.33), 7.613 (1.91), 7.615 (1.77), 7.626 (0.80), 7.628 (0.80), 7.636 (3.66), 7.912 (1.56), 7.925 (3.14), 7.949 (1.81), 7.952 (1.80), 7.962 (0.83), 7.966 (0.81), 8.134 (1.19), 8.277 (3.46), 8.718 (2.28), 8.721 (2.21), 8.770 (0.83), 8.781 (1.52), 8.791 (0.76), 11.150 (1.05).
Example 286
Rac-N-{[4-(1,4-Dimethyl-1H-Imidazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3385) ##STR00684##
(3386) To a solution of rac-5-(aminomethyl)-5-(1,4-dimethyl-1H-imidazol-5-yl)imidazolidine-2,4-dione hydrochloride (60.0 mg, 93% purity, 214 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (67.0 mg, 236 mol) in DMF (1.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (53.4 mg, 278 mol), 1-hydroxybenzotriazole hydrate (42.6 mg, 278 mol) and N,N-diisopropylethylamine (220 l, 1.3 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 8.51 mg (100% purity, 8% yield) of the desired product were obtained.
(3387) LC-MS (Method 7): R.sub.t=1.19 min, MS (ESIpos): m/z=490 [M+H].sup.+
(3388) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 2.223 (16.00), 3.593 (14.59), 3.909 (0.76), 3.921 (0.85), 3.936 (1.25), 3.948 (1.08), 4.009 (1.14), 4.023 (1.21), 4.036 (0.80), 4.049 (0.73), 7.318 (1.13), 7.323 (1.86), 7.334 (1.11), 7.338 (1.40), 7.342 (1.92), 7.350 (1.87), 7.356 (1.28), 7.367 (0.96), 7.372 (0.77), 7.469 (1.56), 7.481 (6.09), 7.486 (1.71), 7.498 (1.19), 7.547 (3.03), 7.563 (3.34), 7.765 (3.56), 7.781 (3.05), 8.140 (1.38), 8.277 (3.55), 8.717 (0.78), 8.730 (1.51), 8.742 (0.75), 11.109 (0.76).
Example 287
Ent-5,6-Dimethyl-N-{[4-(1-Methyl-1H-Imidazol-2-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3389) ##STR00685##
(3390) 5,6-dimethyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (30.0 mg, 102 mol) dissolved in DMF (840 l) was treated with N,N-diisopropylethylamine (36 l, 200 mol), and HATU (77.5 mg, 204 mol). After stirring at room temperature for 5 min ent-5-(aminomethyl)-5-(1-methyl-1H-imidazol-2-yl)imidazolidine-2,4-dione hydrochloride (50.1 mg, 204 mol) was added and the mixture was stirred over night at room temperature. The reaction was concentrated and the crude mixture was purified by preparative HPLC. Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 23.8 mg (98% purity, 47% yield) of the title compound were obtained.
(3391) LC-MS (Method 8): R.sub.t=0.79 min; MS (ESIpos): m/z=486 [M+H].sup.+
(3392) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.68), 0.008 (0.72), 1.928 (16.00), 2.317 (15.82), 2.366 (0.41), 2.670 (0.72), 3.497 (13.17), 3.803 (0.82), 3.819 (0.92), 3.838 (1.91), 3.853 (1.69), 3.878 (1.80), 3.895 (1.92), 3.913 (1.00), 3.929 (0.82), 6.858 (2.23), 7.141 (2.69), 7.160 (3.70), 7.208 (3.49), 7.249 (3.49), 7.269 (2.53), 7.359 (4.06), 7.380 (4.48), 7.722 (3.87), 7.743 (3.53), 8.187 (3.69), 8.209 (1.86), 8.224 (0.92), 11.199 (2.53).
Example 288
Rac-5-Fluoro-N-{[4-(2-Methyl-2H-Indazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3393) ##STR00686##
(3394) To a solution of rac-5-(aminomethyl)-5-(2-methyl-2H-indazol-3-yl)imidazolidine-2,4-dione hydrochloride (67.0 mg, 97% purity, 220 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (68.7 mg, 242 mol) in DMF (1.1 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (54.7 mg, 286 mol), 1-hydroxybenzotriazole hydrate (43.7 mg, 286 mol) and N,N-diisopropylethylamine (230 l, 1.3 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilization, 30.1 mg (90% purity, 23% yield) of the desired product were obtained.
(3395) LC-MS (Method 7): R.sub.t=1.77 min, MS (ESIpos): m/z=526 [M+H].sup.+
(3396) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 2.047 (0.91), 4.256 (0.66), 4.268 (1.11), 4.276 (16.00), 4.283 (1.62), 4.295 (1.08), 4.320 (1.09), 4.333 (1.15), 4.347 (0.59), 4.360 (0.54), 7.066 (0.89), 7.067 (0.89), 7.079 (1.12), 7.081 (1.13), 7.083 (1.05), 7.085 (0.97), 7.096 (1.04), 7.098 (0.99), 7.233 (1.08), 7.234 (1.06), 7.246 (1.01), 7.248 (1.03), 7.250 (1.23), 7.252 (1.19), 7.263 (0.99), 7.265 (0.94), 7.319 (1.04), 7.324 (1.68), 7.336 (1.10), 7.339 (1.25), 7.344 (1.74), 7.353 (1.64), 7.358 (1.15), 7.369 (0.93), 7.375 (0.70), 7.472 (1.34), 7.484 (1.77), 7.489 (3.68), 7.501 (1.92), 7.506 (2.98), 7.593 (2.23), 7.611 (1.98), 7.734 (3.15), 7.750 (2.74), 7.832 (1.91), 7.850 (1.75), 8.712 (3.18), 8.868 (0.71), 8.881 (1.35), 8.893 (0.68), 11.357 (0.43).
Example 289
Ent-4-Chloro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(3397) ##STR00687##
(3398) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (80.0 mg, 326 mol) and 4-chloro-2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (118 mg, 391 mol) in DMF (2.4 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (81.2 mg, 423 mol), 1-hydroxybenzotriazole hydrate (64.8 mg, 423 mol) and N,N-diisopropylethylamine (280 l, 1.6 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 112.2 mg (95.8% purity, 67% yield) of the desired product were obtained.
(3399) LC-MS (Method 12): R.sub.t=2.28 min, MS (ESIpos): m/z=493 [M+H].sup.+
(3400) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.008 (0.57), 0.008 (0.62), 2.073 (6.00), 3.773 (16.00), 3.836 (0.60), 3.851 (0.68), 3.871 (1.30), 3.886 (1.15), 3.918 (1.18), 3.935 (1.24), 3.952 (0.63), 3.969 (0.58), 6.478 (3.55), 6.483 (3.62), 7.375 (3.39), 7.380 (3.41), 7.483 (2.57), 7.491 (0.55), 7.497 (0.59), 7.505 (3.19), 7.648 (0.96), 7.655 (4.82), 7.661 (3.13), 7.669 (2.11), 7.675 (1.07), 7.922 (0.97), 7.942 (3.49), 7.953 (2.18), 7.958 (2.05), 7.974 (0.56), 7.978 (0.60), 8.434 (2.55), 8.437 (2.57), 8.753 (2.22), 8.885 (0.75), 8.901 (1.49), 8.917 (0.74), 11.267 (2.28).
Example 290
N-{[(4R)-4-Cyclopropyl-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-Fluoro-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(3401) ##STR00688##
(3402) To a solution of (5R)-5-(aminomethyl)-5-cyclopropylimidazolidine-2,4-dione hydrochloride (70.0 mg, 340 mol) and 4-fluoro-2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (194 mg, 681 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (84.8 mg, 443 mol), 1-hydroxybenzotriazole hydrate (67.8 mg, 443 mol) and N,N-diisopropylethylamine (300 l, 1.7 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 129 mg (100% purity, 87% yield) of the desired product were obtained.
(3403) LC-MS (Method 7): R.sub.t=1.43 min, MS (ESIpos): m/z=437 [M+H].sup.+
(3404) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.119 (1.18), 0.128 (2.86), 0.136 (4.75), 0.144 (4.80), 0.152 (3.46), 0.161 (1.54), 0.302 (1.03), 0.317 (3.15), 0.325 (3.91), 0.332 (3.44), 0.340 (2.48), 0.347 (1.72), 0.378 (1.54), 0.385 (2.83), 0.393 (3.12), 0.400 (4.37), 0.409 (3.32), 0.415 (2.03), 0.424 (1.21), 0.439 (1.65), 0.447 (3.68), 0.455 (4.75), 0.464 (4.49), 0.472 (3.01), 0.481 (1.09), 1.059 (1.52), 1.068 (3.10), 1.073 (3.39), 1.082 (5.67), 1.091 (3.12), 1.096 (2.83), 1.105 (1.25), 2.069 (3.93), 2.422 (0.65), 2.612 (0.47), 2.651 (0.69), 3.458 (3.32), 3.467 (3.66), 3.480 (7.23), 3.490 (6.63), 3.514 (6.85), 3.524 (7.10), 3.536 (3.48), 3.547 (3.30), 7.397 (2.77), 7.401 (3.50), 7.411 (5.91), 7.415 (7.50), 7.426 (3.32), 7.430 (4.08), 7.444 (6.85), 7.448 (6.16), 7.460 (6.94), 7.464 (5.89), 7.544 (16.00), 7.556 (6.69), 7.565 (6.85), 7.570 (6.03), 7.580 (5.42), 7.938 (7.63), 7.952 (15.55), 7.976 (8.79), 7.979 (8.30), 7.989 (4.20), 7.992 (4.08), 8.145 (0.69), 8.618 (4.02), 8.629 (7.68), 8.639 (3.84), 8.756 (12.05), 10.633 (7.56).
Example 291
Ent-4-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(3405) ##STR00689##
(3406) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (90.0 mg, 366 mol) and 4-fluoro-2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (125 mg, 440 mol) in DMF (2.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (91.3 mg, 476 mol), 1-hydroxybenzotriazole hydrate (72.9 mg, 476 mol) and N,N-diisopropylethylamine (320 l, 1.8 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 106 mg (100% purity, 61% yield) of the desired product were obtained.
(3407) LC-MS (Method 7): R.sub.t=1.35 min, MS (ESIpos): m/z=477 [M+H].sup.+
(3408) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.780 (16.00), 3.848 (0.76), 3.858 (0.84), 3.871 (1.26), 3.881 (1.14), 3.934 (1.19), 3.945 (1.24), 3.957 (0.79), 3.968 (0.74), 6.475 (3.41), 6.479 (3.39), 7.375 (3.46), 7.378 (3.34), 7.414 (0.51), 7.418 (0.71), 7.428 (1.10), 7.432 (1.55), 7.442 (0.66), 7.446 (1.00), 7.450 (1.46), 7.455 (1.19), 7.467 (1.40), 7.471 (1.11), 7.533 (1.26), 7.543 (1.35), 7.547 (1.14), 7.557 (1.02), 7.923 (1.09), 7.936 (3.19), 7.948 (1.95), 7.951 (1.84), 7.962 (0.64), 7.965 (0.65), 8.404 (2.91), 8.748 (2.31), 8.827 (0.78), 8.838 (1.47), 8.848 (0.76).
Example 292
Ent-5-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-2-[6-(Trifluoromethyl)Pyridin-3-Yl]Benzamide
(3409) ##STR00690##
(3410) To a solution of ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (90.0 mg, 366 mol) and 5-fluoro-2-[6-(trifluoromethyl)pyridin-3-yl]benzoic acid (125 mg, 440 mol) in DMF (2.7 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (91.3 mg, 476 mol), 1-hydroxybenzotriazole hydrate (72.9 mg, 476 mol) and N,N-diisopropylethylamine (320 l, 1.8 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 99.2 mg (100% purity, 57% yield) of the desired product were obtained.
(3411) LC-MS (Method 7): R.sub.t=1.33 min, MS (ESIpos): m/z=477 [M+H].sup.+
(3412) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.005 (0.56), 3.782 (16.00), 3.856 (0.77), 3.866 (0.85), 3.879 (1.32), 3.888 (1.18), 3.937 (1.23), 3.948 (1.28), 3.959 (0.81), 3.971 (0.74), 6.483 (3.38), 6.487 (3.25), 7.293 (1.22), 7.298 (1.37), 7.308 (1.23), 7.313 (1.27), 7.379 (3.42), 7.382 (3.20), 7.473 (0.59), 7.478 (0.61), 7.488 (1.29), 7.492 (1.32), 7.502 (0.76), 7.506 (0.76), 7.583 (1.33), 7.592 (1.38), 7.597 (1.15), 7.606 (1.06), 7.908 (0.51), 7.922 (4.94), 7.926 (2.46), 8.438 (2.98), 8.714 (2.52), 8.936 (0.79), 8.946 (1.50), 8.957 (0.77).
Example 293
Rac-5-Fluoro-N-{[4-(3-Fluorobicyclo[1.1.1]Pentan-1-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3413) ##STR00691##
(3414) To a solution of rac-5-(aminomethyl)-5-(3-fluorobicyclo[1.1.1]pentan-1-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 401 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (137 mg, 481 mol) in DMF (3 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (99.8 mg, 521 mol), 1-hydroxybenzotriazole hydrate (79.7 mg, 521 mol) and N,N-diisopropylethylamine (350 l, 2.0 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilization, 111 mg (90% purity, 52% yield) of the desired product were obtained.
(3415) LC-MS (Method 7): R.sub.t=1.76 min; MS (ESIpos): m/z=480 [M+H].sup.+
(3416) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.030 (15.12), 2.036 (16.00), 3.449 (3.32), 3.464 (3.33), 7.315 (3.04), 7.337 (3.71), 7.355 (1.23), 7.362 (0.82), 7.433 (1.26), 7.445 (1.26), 7.452 (1.34), 7.468 (0.86), 7.555 (3.76), 7.575 (4.43), 7.771 (4.27), 7.792 (3.56), 8.022 (3.18), 8.657 (0.86), 8.672 (1.81), 8.688 (0.86), 10.798 (2.64).
Example 294
Ent-5-Fluoro-N-{[4-(3-Fluorobicyclo[1.1.1]Pentan-1-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3417) ##STR00692##
(3418) Enantiomeric separation of rac-5-fluoro-N-{[4-(3-fluorobicyclo[1.1.1]pentan-1-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (109.4 mg) by preparative chiral HPLC [column: Daicel Chiralpak AD-H 5 m, 25020 mm; eluent: 80% n-heptane/20% ethanol; flow rate: 30 ml/min; temperature: 30 C.; UV detection: 220 nm] afforded 42.0 mg (100% purity) of the desired product.
(3419) Analytical chiral HPLC: R.sub.t=4.23 min, e.e. =93.3% [column: Daicel Chiralpak AD-3 3 m, 504.6 mm; eluent: 80% n-heptane/20% ethanol; flow rate: 1 ml/min; temperature: 30 C.; UV detection: 220 nm]
(3420) LC-MS (Method 7): R.sub.t=1.76 min; MS (ESIpos): m/z=480 [M+H].sup.+
(3421) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.029 (16.00), 2.033 (15.59), 3.448 (3.48), 3.459 (3.26), 7.308 (1.02), 7.312 (1.93), 7.316 (1.15), 7.324 (1.14), 7.329 (2.33), 7.330 (2.34), 7.335 (1.15), 7.344 (0.99), 7.349 (0.72), 7.437 (1.40), 7.447 (1.42), 7.451 (1.29), 7.461 (1.10), 7.558 (3.22), 7.571 (3.54), 7.769 (3.71), 7.783 (3.27), 7.991 (2.76), 7.993 (2.69), 8.629 (0.88), 8.640 (1.82), 8.650 (0.87), 10.776 (2.38).
Example 295
Rac-5,6-Difluoro-N-{[4-(3-Fluorobicyclo[1.1.1]Pentan-1-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3422) ##STR00693##
(3423) To a solution of rac-5-(aminomethyl)-5-(3-fluorobicyclo[1.1.1]pentan-1-yl)imidazolidine-2,4-dione hydrochloride (120 mg, 479 mol) and 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (174 mg, 575 mol) in DMF (2.4 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (119 mg, 623 mol), 1-hydroxybenzotriazole hydrate (95.4 mg, 623 mol) and N,N-diisopropylethylamine (420 l, 2.4 mmol). The reaction mixture was stirred overnight at room temperature, diluted with ethyl acetate and washed with water. The organic layer was dried and concentrated in vacuo. The crude product was purified by column chromatography (25 g Ultra Snap Cartridge Biotage; eluent ethyl acetate/cyclohexane, elution gradient 16%.fwdarw.100%). Samples containing the desired product were united, the solvents were evaporated and the residue was dried in vacuum. 143 mg (100% purity, 60% yield) of the title compound was obtained.
(3424) LC-MS (Method 7): R.sub.t=1.78 min; MS (ESIpos): m/z=498 [M+H].sup.+
(3425) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.014 (16.00), 2.017 (15.42), 2.069 (1.69), 3.386 (2.31), 3.389 (2.34), 3.396 (2.50), 3.399 (2.48), 7.249 (0.86), 7.256 (0.93), 7.263 (1.01), 7.270 (0.94), 7.536 (3.07), 7.549 (3.32), 7.580 (0.52), 7.593 (1.03), 7.609 (1.00), 7.623 (0.47), 7.805 (3.76), 7.819 (3.39), 7.978 (3.04), 8.627 (0.90), 8.637 (1.80), 8.648 (0.88), 10.776 (2.61).
Example 296
Ent-N-({4-[1-(Difluoromethyl)-1H-Pyrazol-5-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3426) ##STR00694##
(3427) Enantiomeric separation of rac-N-({4-[1-(difluoromethyl)-1H-pyrazol-5-yl]-2,5-dioxoimidazolidin-4-yl}methyl)-5-fluoro-4-(trifluoromethyl)[biphenyl]-2-carboxamide (38.1 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 60% n-heptan/40% isopropanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 210 nm] afforded 14.3 mg (98% purity) of the desired product.
(3428) Analytical chiral HPLC: R.sub.t=1.92 min, e.e. =>99% [column: 504.6 mm filled with Daicel Chiralpak ID-3 3 m; eluent: 70% n-heptan/30% isopropanol; flow rate: 1 ml/min; temperature: 30 C.; UV detection: 220 nm]
(3429) LC-MS (Method 7): R.sub.t=1.69 min; MS (ESIpos): m/z=512 [M+H].sup.+
(3430) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.858 (1.26), 1.032 (3.78), 1.042 (3.78), 1.107 (0.90), 1.235 (0.90), 2.386 (2.34), 2.426 (2.88), 2.615 (2.16), 2.655 (2.34), 3.803 (3.42), 3.814 (3.60), 3.826 (5.57), 3.837 (5.21), 3.888 (5.21), 3.898 (5.75), 3.911 (3.60), 3.921 (3.24), 4.353 (0.72), 6.725 (14.02), 6.727 (13.48), 7.334 (5.03), 7.338 (6.83), 7.354 (7.37), 7.372 (6.47), 7.376 (5.57), 7.386 (3.78), 7.474 (5.75), 7.484 (6.47), 7.488 (5.39), 7.498 (4.67), 7.545 (13.84), 7.558 (15.46), 7.760 (16.00), 7.774 (14.38), 7.785 (14.02), 7.819 (3.78), 7.912 (3.78), 7.919 (3.60), 8.011 (3.06), 8.554 (8.45), 8.895 (3.78), 8.905 (7.55), 8.916 (3.96), 11.289 (0.90).
Example 297
Ent-N-{[4-(1-Methyl-1H-Imidazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3431) ##STR00695##
(3432) Enantiomeric separation of rac-N-{[4-(1-methyl-1H-imidazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (32.2 mg) by preparative chiral HPLC [column: Daicel Chiralpak OX-H 5 m, 25020 mm; eluent: 65% n-heptane/35% ethanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 5.20 mg (98% purity) of the desired product.
(3433) Analytical chiral HPLC: R.sub.t=7.82 min, e.e. =>99% [column: Daicel OX-H 5 m, 2504.6 mm; eluent: 65% n-heptane/35% ethanol; flow rate: 1 ml/min; temperature: 40 C.; UV detection: 220 nm]
(3434) LC-MS (Method 7): R.sub.t=1.06 min; MS (ESIpos): m/z=458 [M+H].sup.+
(3435) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 1.158 (0.63), 1.236 (0.42), 3.574 (16.00), 3.847 (0.89), 3.857 (0.97), 3.869 (1.57), 3.880 (1.41), 3.925 (1.46), 3.936 (1.52), 3.948 (0.94), 3.959 (0.86), 7.073 (3.16), 7.433 (3.82), 7.445 (5.54), 7.466 (1.59), 7.478 (2.51), 7.491 (1.07), 7.538 (4.08), 7.551 (5.07), 7.560 (2.46), 7.573 (0.94), 7.640 (3.29), 7.749 (4.68), 7.763 (4.10), 8.261 (4.34), 8.699 (1.07), 8.709 (1.96), 8.720 (1.02), 11.151 (0.47).
Example 298
Ent-5,6-Difluoro-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3436) ##STR00696##
(3437) Enantiomeric separation of rac-5,6-difluoro-N-{[4-(1-fluorocyclopropyl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (28.1 mg) by preparative chiral HPLC [Daicel Chiralpak IA 5 m, 25020 mm; eluent: 90% n-heptane/9% ethanol+1% water; flow rate: 15 ml/min; temperature: 22.5 C.; UV detection: 220 nm] afforded 9.40 mg (98% purity) of the desired product.
(3438) Analytical chiral HPLC: R.sub.t=22.04 min, e.e. =95% [column: 2504.6 mm filled with Daicel Chiralpak IA 5 m; eluent: 90% n-heptane/10% ethanol; flow rate: 1 ml/min; temperature: 20 C.; UV detection: 220 nm]
(3439) LC-MS (Method 7): R.sub.t=1.72 min; MS (ESIpos): m/z=472 [M+H].sup.+
(3440) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.39), 0.008 (4.48), 0.147 (0.43), 0.806 (1.26), 0.832 (4.04), 0.858 (3.83), 0.894 (3.35), 0.923 (3.96), 0.945 (2.83), 0.955 (2.17), 0.977 (7.57), 0.991 (3.87), 1.018 (3.09), 1.028 (7.61), 1.088 (0.43), 1.103 (0.43), 1.236 (1.26), 2.328 (0.70), 2.366 (0.78), 2.670 (0.78), 2.710 (0.83), 3.425 (3.00), 3.441 (3.22), 3.460 (5.61), 3.476 (5.35), 3.523 (5.04), 3.538 (5.43), 3.557 (2.91), 3.573 (2.70), 3.733 (0.43), 7.263 (3.30), 7.276 (3.65), 7.282 (4.22), 7.294 (3.87), 7.536 (11.96), 7.555 (13.83), 7.585 (2.43), 7.606 (4.35), 7.630 (4.52), 7.651 (2.30), 7.804 (16.00), 7.824 (13.87), 8.116 (14.52), 8.692 (3.39), 8.707 (7.09), 8.723 (3.39), 10.865 (3.17).
Example 299
Rac-6-Fluoro-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3441) ##STR00697##
(3442) To a solution of rac-5-(aminomethyl)-5-(1-fluorocyclopropyl)imidazolidine-2,4-dione hydrochloride (70.0 mg, 313 mol) and 6-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (89.0 mg, 313 mol) in DMF (2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (78.0 mg, 407 mol), 1-hydroxybenzotriazole hydrate (62.3 mg, 407 mol) and N,N-diisopropylethylamine (270 l, 1.6 mmol). The reaction mixture was stirred overnight at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 4f). After lyophilisation, 78.5 mg (98% purity, 54% yield) of the desired product were obtained.
(3443) LC-MS (Method 8): R.sub.t=0.86 min; MS (ESIpos): m/z=454 [M+H].sup.+
(3444) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.829 (1.43), 0.848 (4.11), 0.865 (3.17), 0.930 (3.17), 0.946 (4.07), 0.965 (1.70), 0.996 (2.37), 1.004 (7.11), 1.016 (2.37), 1.029 (2.55), 1.037 (7.28), 1.049 (1.65), 2.386 (0.76), 2.426 (1.34), 2.577 (0.76), 2.615 (0.80), 2.655 (1.21), 2.730 (1.21), 2.891 (1.52), 3.305 (0.67), 3.320 (1.65), 3.381 (1.30), 3.510 (3.26), 3.521 (3.49), 3.532 (5.36), 3.544 (5.09), 3.591 (4.83), 3.601 (5.05), 3.613 (3.08), 3.623 (2.86), 7.336 (8.94), 7.352 (15.20), 7.366 (3.98), 7.370 (2.77), 7.453 (5.32), 7.463 (5.23), 7.467 (5.01), 7.477 (3.93), 7.561 (13.27), 7.575 (14.53), 7.777 (15.20), 7.791 (13.45), 8.173 (16.00), 8.749 (3.58), 8.759 (7.33), 8.770 (3.44), 10.922 (3.98).
Example 300
Ent-6-Fluoro-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3445) ##STR00698##
(3446) Enantiomeric separation of rac-6-fluoro-N-{[4-(1-fluorocyclopropyl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (68.8 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID 5 m, 25020 mm; eluent: 50% n-heptane/50% isopropanol; flow rate: 20 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 22.9 mg (99% purity) of the desired product.
(3447) Analytical chiral HPLC: R.sub.t=1.39 min, e.e. =99% [column: Daicel chiralcel ID-3 3 m, 504.6 mm; eluent: 50% n-heptane/50% isopropanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3448) LC-MS (Method 7): R.sub.t=1.69 min; MS (ESIpos): m/z=454 [M+H].sup.+
(3449) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 0.063 (3.75), 0.828 (1.43), 0.838 (1.98), 0.848 (4.24), 0.856 (1.56), 0.865 (3.38), 0.889 (0.50), 0.930 (3.08), 0.947 (4.08), 0.965 (1.52), 0.977 (1.40), 0.996 (2.30), 1.004 (7.16), 1.016 (2.37), 1.029 (2.51), 1.037 (7.32), 1.049 (1.59), 2.387 (0.48), 2.426 (0.80), 2.655 (0.62), 3.318 (0.65), 3.511 (3.22), 3.521 (3.41), 3.533 (5.39), 3.544 (4.97), 3.591 (4.74), 3.601 (5.14), 3.614 (3.06), 3.624 (2.79), 7.337 (8.91), 7.352 (14.97), 7.366 (3.91), 7.371 (2.74), 7.454 (5.25), 7.464 (5.20), 7.467 (4.93), 7.477 (3.85), 7.562 (13.33), 7.575 (14.48), 7.777 (15.13), 7.791 (13.42), 8.173 (16.00), 8.749 (3.68), 8.759 (7.30), 8.770 (3.57), 10.923 (4.70).
Example 301
Ent-4-Chloro-5-Fluoro-N-{[4-(1-Fluorocyclopropyl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(3450) ##STR00699##
(3451) Enantiomeric separation of rac-4-chloro-5-fluoro-N-{[4-(1-fluorocyclopropyl)-2,5-dioxoimidazolidin-4-yl]methyl}[biphenyl]-2-carboxamide (136.4 mg) by preparative chiral HPLC [column: Daicel Chiralpak ID-3 3 m, 504.6 mm; eluent: 50% n-heptane/50% isopropanol; flow rate: 10 ml/min; temperature: 30 C.; UV detection: 220 nm] afforded 58.0 mg (95% purity) of the desired product.
(3452) Analytical chiral HPLC: R.sub.t=3.00 min, e.e. =>99% [column: Daicel chiralcel AD-3 3 m, 504.6 mm; eluent: 70% n-heptane/30% ethanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3453) LC-MS (Method 7): R.sub.t=1.59 min; MS (ESIpos): m/z=420 [M+H].sup.+
(3454) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 0.149 (0.72), 0.008 (5.15), 0.008 (6.42), 0.146 (0.68), 0.822 (0.77), 0.847 (2.36), 0.874 (2.11), 0.914 (1.59), 0.944 (2.01), 0.962 (1.59), 0.993 (4.00), 1.007 (2.34), 1.030 (13.29), 1.045 (16.00), 1.086 (0.74), 1.102 (0.58), 1.157 (0.56), 1.261 (0.62), 2.328 (0.60), 2.366 (0.81), 2.670 (0.70), 2.710 (0.77), 3.491 (1.53), 3.507 (1.61), 3.526 (3.11), 3.541 (3.02), 3.576 (2.79), 3.590 (3.04), 3.610 (1.39), 3.625 (1.35), 3.752 (0.41), 3.762 (0.46), 3.766 (0.54), 3.777 (0.56), 3.782 (0.43), 3.793 (0.41), 4.323 (1.90), 4.333 (1.88), 7.251 (2.73), 7.257 (4.64), 7.269 (2.44), 7.275 (3.79), 7.282 (4.80), 7.290 (4.76), 7.296 (3.10), 7.311 (2.55), 7.318 (2.01), 7.363 (9.63), 7.368 (3.50), 7.380 (4.24), 7.385 (15.15), 7.395 (4.30), 7.410 (4.00), 7.416 (3.27), 7.431 (2.88), 7.462 (14.97), 7.467 (4.18), 7.478 (3.41), 7.483 (9.75), 8.106 (7.84), 8.612 (1.78), 8.628 (3.87), 8.643 (1.86), 10.875 (3.95).
Example 302
Ent-N-{[4-(1,3-Dimethyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3455) ##STR00700##
(3456) Enantiomeric separation of rac-N-{[4-(1,3-dimethyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4 yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide (27.4 mg) by preparative chiral HPLC [column: Daicel Chiralpak IC-3 3 m, 504.6 mm; eluent: 50% n-heptane/50% isopropanol; flow rate: 25 ml/min; temperature: 40 C.; UV detection: 220 nm] afforded 11.4 mg (100% purity) of the desired product.
(3457) Analytical chiral HPLC: R.sub.t=0.84 min, e.e. =>99% [column: 504.6 mm filled with Daicel Chiralpak IC-3 3 m; eluent: 50% n-heptane/50% ethanol; flow rate: 1 ml/min; UV detection: 220 nm]
(3458) LC-MS (Method 7): R.sub.t=1.57 min; MS (ESIpos): m/z=472 [M+H].sup.+
(3459) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 1.283 (0.67), 2.097 (13.86), 2.523 (1.66), 3.699 (16.00), 3.814 (0.67), 3.829 (0.73), 3.848 (1.37), 3.863 (1.24), 3.899 (1.24), 3.916 (1.31), 3.933 (0.70), 3.950 (0.64), 6.240 (5.51), 7.424 (1.05), 7.428 (1.27), 7.436 (1.82), 7.443 (2.39), 7.446 (2.45), 7.455 (2.42), 7.466 (1.21), 7.468 (1.24), 7.484 (1.98), 7.487 (1.72), 7.502 (0.99), 7.506 (0.99), 7.515 (3.06), 7.536 (3.54), 7.545 (1.75), 7.549 (1.53), 7.563 (1.75), 7.567 (1.66), 7.582 (0.67), 7.586 (0.67), 7.747 (3.63), 7.768 (3.06), 8.365 (3.76), 8.726 (0.76), 8.742 (1.53), 8.758 (0.76), 11.216 (0.64).
Example 303
Rac-5-Fluoro-N-({4-[5-Methyl-2-(Trifluoromethyl)-1,3-Thiazol-4-Yl]-2,5-Dioxoimidazolidin-4-Yl}Methyl)-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3460) ##STR00701##
(3461) To a solution of rac-5-(aminomethyl)-5-[5-methyl-2-(trifluoromethyl)-1,3-thiazol-4 yl]imidazolidine-2,4-dione hydrochloride (70.0 mg, 212 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (72.2 mg, 254 mol) in DMF (1.9 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (52.7 mg, 275 mol), 1-hydroxybenzotriazole hydrate (42.1 mg, 275 mol) and N,N-diisopropylethylamine (180 l, 1.1 mmol). The reaction mixture was stirred for 3 days at room temperature and then concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 8f). After lyophilisation, 23.3 mg (98% purity, 19% yield) of the desired product were obtained.
(3462) LC-MS (Method 7): R.sub.t=2.00 min, MS (ESIpos): m/z=561 [M+H].sup.+
(3463) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.478 (16.00), 4.069 (4.24), 4.085 (4.56), 7.329 (4.21), 7.352 (4.87), 7.370 (1.58), 7.376 (1.02), 7.455 (1.60), 7.467 (1.77), 7.473 (1.77), 7.490 (1.18), 7.586 (4.63), 7.606 (5.45), 7.777 (5.58), 7.798 (4.65), 8.380 (4.83), 8.788 (1.24), 8.803 (2.63), 8.819 (1.23).
Example 304
Rac-N-{[4-(1,5-Dimethyl-1H-Imidazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5-Fluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3464) ##STR00702##
(3465) To a solution of rac-5-(aminomethyl)-5-(1,5-dimethyl-1H-imidazol-4-yl)imidazolidine-2,4-dione hydrochloride (50.0 mg, 193 mol) and 5-fluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (54.7 mg, 193 mol) in DMF (1.2 ml) was added 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (48.0 mg, 250 mol), 1-hydroxybenzotriazole hydrate (38.3 mg, 250 mol) and N,N-diisopropylethylamine (170 l, 960 mol). The reaction mixture was first stirred overnight at room temperature, then for 2 h at 40 C. and finally concentrated under reduced pressure. The crude product was purified by preparative HPLC (Method 3f). After lyophilisation, 40.6 mg (99% purity, 43% yield) of the desired product were obtained.
(3466) LC-MS (Method 8): R.sub.t=0.68 min; MS (ESIpos): m/z=490 [M+H].sup.+
(3467) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.062 (16.00), 3.504 (13.56), 3.904 (0.50), 3.914 (0.55), 3.927 (1.37), 3.937 (1.26), 3.947 (1.32), 3.957 (1.44), 3.970 (0.55), 3.980 (0.49), 7.324 (1.71), 7.328 (1.43), 7.333 (1.36), 7.337 (1.46), 7.341 (1.44), 7.344 (1.59), 7.348 (1.18), 7.469 (1.05), 7.478 (1.32), 7.484 (1.11), 7.498 (5.10), 7.600 (2.83), 7.613 (3.14), 7.779 (3.35), 7.793 (2.86), 8.112 (2.56), 8.538 (0.80), 8.549 (1.67), 8.559 (0.78), 10.844 (2.22).
Example 305
Rac-N-{[4-(1,5-Dimethyl-1H-Pyrazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5,6-Difluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3468) ##STR00703##
(3469) N-[2-(1,5-dimethyl-1H-pyrazol-3-yl)-2-oxoethyl]-5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxamide (140 mg, 320 mol) was dissolved in 2 ml of ethanol. Ammonium carbonate (308 mg, 3.20 mmol) and potassium cyanide (83.4 mg, 1.28 mmol), dissolved in 4 ml of water, were added. The vial was sealed and the mixture was stirred at 80 C. over night. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: XBridge C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% ammonia in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 35.0 mg (100% purity, 22% yield) of the title compound were obtained.
(3470) LC-MS (Method 7): R.sub.t=1.65 min; MS (ESIpos): m/z=508 [M+H].sup.+
(3471) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.207 (11.78), 3.625 (0.85), 3.635 (0.91), 3.648 (1.10), 3.658 (1.03), 3.679 (16.00), 3.812 (1.00), 3.822 (1.08), 3.834 (0.89), 3.845 (0.79), 5.980 (3.69), 7.256 (0.60), 7.264 (0.63), 7.270 (0.70), 7.278 (0.66), 7.550 (2.21), 7.563 (2.44), 7.581 (0.68), 7.597 (0.70), 7.797 (2.84), 7.811 (2.52), 8.084 (3.14), 8.540 (0.68), 8.550 (1.40), 8.561 (0.64), 10.694 (0.43).
Example 306
Rac-5,6-Difluoro-N-{[4-(3-Methyl-1,2-Thiazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3472) ##STR00704##
(3473) 5,6-difluoro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (115 mg, 381 mol) dissolved in 2 ml of DMF was treated with N-ethyl-N-isopropylpropan-2-amine (200 l, 1.1 mmol), 3-{[(ethylimino)methylene]amino}-N,N-dimethylpropan-1-amine hydrochloride (94.9 mg, 495 mol), 1H-benzotriazol-1-ol hydrate (75.8 mg, 495 mol) and rac-5-(aminomethyl)-5-(3-methyl-1,2-thiazol-4-yl)imidazolidine-2,4-dione-hydrochloride (100 mg, 381 mol). The mixture was stirred at room temperature for 3 h. The product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System, Column: XBridge C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol. %); flow: 80 ml/min, room temperature, UV-detection: 200-400 nm, At-Column Injektion; gradient: eluent A 0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow 5 ml/min over the whole runtime). After lyophilization, 77.0 mg (100% purity, 40% yield) of the title compound were obtained.
(3474) LC-MS (Method 7): R.sub.t=1.69 min; MS (ESIpos): m/z=511 [M+H].sup.+
(3475) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.068 (0.57), 2.396 (16.00), 3.842 (0.57), 3.852 (0.65), 3.865 (1.60), 3.874 (1.43), 3.884 (1.51), 3.896 (1.56), 3.907 (0.61), 3.918 (0.58), 7.285 (0.73), 7.291 (0.77), 7.298 (0.85), 7.306 (0.80), 7.535 (2.72), 7.549 (2.93), 7.600 (0.47), 7.614 (0.84), 7.630 (0.86), 7.644 (0.45), 7.793 (3.45), 7.807 (3.11), 8.251 (2.64), 8.771 (0.82), 8.781 (1.58), 8.792 (0.78), 9.069 (5.25).
Example 307
Rac-5,6-Difluoro-N-{[4-(1-Methyl-1H-Pyrazol-3-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3476) ##STR00705##
(3477) 5,6-difluoro-N-[2-(1-methyl-1H-pyrazol-3-yl)-2-oxoethyl]-4-(trifluoromethyl)[biphenyl]-2-carboxamide (382 mg, 902 mol) was dissolved in 5.5 ml of ethanol. Ammonium carbonate (867 mg, 9.02 mmol) and potassium cyanide (235 mg, 3.61 mmol), dissolved in 11 ml of water, were added. The vial was sealed and the mixture was stirred at 80 C. over night. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by column chromatography (Machine: Biotage Isolera One; column: Biotage SNAP Ultra 25 g; gradient: DCM/MeOH-gradient, 2% MeOH-20% MeOH; flow: 75 ml/min). Product containing samples were united, the solvents were removed on a rotary evaporator and the residue was dried in vacuo. 347 mg (100% purity, 78% yield) of the title compound were obtained.
(3478) LC-MS (Method 7): R.sub.t=1.59 min; MS (ESIpos): m/z=494 [M+H].sup.+
(3479) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 3.661 (0.70), 3.677 (0.75), 3.696 (1.01), 3.711 (0.94), 3.811 (16.00), 3.835 (1.01), 3.850 (1.07), 3.869 (0.77), 3.884 (0.69), 5.753 (0.46), 6.182 (3.47), 6.188 (3.42), 7.254 (0.61), 7.263 (0.68), 7.266 (0.66), 7.272 (0.79), 7.285 (0.75), 7.545 (2.28), 7.566 (2.74), 7.590 (0.85), 7.614 (0.86), 7.636 (0.47), 7.653 (2.89), 7.659 (2.80), 7.802 (3.09), 7.823 (2.66), 8.183 (2.89), 8.610 (0.67), 8.625 (1.42), 8.640 (0.65), 10.785 (2.18).
Example 308
Ent-5-Methyl-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3480) ##STR00706##
(3481) 5-methyl-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (114 mg, 407 mol) dissolved in 2.5 ml DMF was treated with N,N-diisopropylethylamine (350 l, 2.0 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol) and 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) was added. The mixture was stirred at room temperature for 4 h. Purification was done by preparative HPLC (Column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B, 4.5 min 50% B, 11.5 min 70% B, 12 min 100% B, 14.75 min 30% B; flow: 50 ml/min). Further purification was needed and done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm, At-Column Injektion. Gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 45.0 mg (100% purity, 23% yield) of the title compound were obtained.
(3482) LC-MS (Method 7): R.sub.t=1.63 min; MS (ESIpos): m/z=472 [M+H].sup.+
(3483) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 2.388 (11.07), 3.790 (16.00), 3.835 (0.75), 3.846 (0.85), 3.862 (1.19), 3.874 (1.05), 3.952 (1.08), 3.966 (1.15), 3.979 (0.79), 3.993 (0.73), 6.464 (3.55), 6.468 (3.56), 7.252 (2.86), 7.276 (1.19), 7.292 (1.82), 7.344 (3.12), 7.360 (1.97), 7.380 (3.73), 7.384 (3.65), 7.488 (2.95), 7.504 (3.26), 7.734 (3.43), 7.751 (3.04), 8.372 (3.53), 8.644 (0.79), 8.657 (1.41), 8.669 (0.78), 11.247 (1.32).
Example 309
Ent-5-(Difluoromethyl)-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3484) ##STR00707##
(3485) 5-(difluoromethyl)-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylic acid (53.0 mg, 168 mol) dissolved in 1.5 ml DMF was treated with N,N-diisopropylethylamine (150 l, 840 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (41.8 mg, 218 mol) and 1-hydroxybenzotriazole hydrate (33.4 mg, 218 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (41.2 mg, 168 mol) was added. The mixture was stirred at room temperature for 4 h. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B, 4.5 min 50% B, 11.5 min 70% B, 12 min 100% B, 14.75 min 30% B; flow: 50 ml/min). Further purification was needed and done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm, At-Column Injektion. Gradient: eluent A 0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 38.0 mg (100% purity, 45% yield) of the title compound were obtained.
(3486) LC-MS (Method 7): R.sub.t=1.62 min; MS (ESIpos): m/z=508 [M+H].sup.+
(3487) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.072 (0.60), 3.791 (16.00), 3.870 (0.50), 3.885 (0.58), 3.905 (1.41), 3.920 (1.30), 3.934 (1.31), 3.951 (1.35), 3.968 (0.53), 3.985 (0.50), 6.475 (3.44), 6.480 (3.43), 6.986 (1.20), 7.125 (2.52), 7.264 (1.05), 7.384 (3.55), 7.388 (3.44), 7.543 (1.96), 7.563 (5.40), 7.583 (3.58), 7.630 (2.88), 7.690 (1.62), 7.710 (1.27), 7.783 (3.73), 7.803 (3.10), 8.446 (2.67), 8.884 (0.77), 8.900 (1.56), 8.915 (0.75), 11.272 (2.43).
Example 310
Ent-6-Chloro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3488) ##STR00708##
(3489) 6-chloro-4-(trifluoromethyl)[1,1-biphenyl]-2-carboxylicacid (51.0 mg, 170 mol) dissolved in 1.5 ml DMF was treated with N,N-diisopropylethylamine (150 l, 850 mol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (42.3 mg, 221 mol) and 1-hydroxybenzotriazole hydrate (33.8 mg, 221 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (41.7 mg, 170 mol) was added. The mixture was stirred at room temperature for 4 h. Purification was done by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B, 4.5 min 50% B, 11.5 min 70% B, 12 min 100% B, 14.75 min 30% B; flow: 50 ml/min). Further purification was needed and done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm, At-Column Injektion. Gradient: eluent A 0 to 2 min 55 ml, eluent B 0 to 2 min 15 ml, eluent A 2 to 10 min from 55 ml to 31 ml and eluent B from 15 ml to 39 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 33.0 mg (100% purity, 40% yield) of the title compound were obtained.
(3490) LC-MS (Method 7): R.sub.t=1.62 min; MS (ESIpos): m/z=492 [M+H].sup.+
(3491) .sup.1H-NMR (400 MHz, DMSO-d6) [ppm]: 2.072 (0.52), 3.746 (16.00), 3.764 (2.58), 3.781 (2.34), 3.814 (1.30), 6.433 (3.50), 6.438 (3.51), 7.338 (1.73), 7.340 (1.77), 7.356 (5.01), 7.360 (5.03), 7.433 (1.45), 7.451 (1.61), 7.503 (1.72), 7.523 (2.97), 7.542 (1.71), 7.681 (2.09), 7.684 (2.12), 7.701 (1.73), 7.704 (1.63), 7.761 (2.80), 7.781 (2.51), 8.367 (2.62), 8.714 (0.73), 8.730 (1.59), 8.745 (0.74), 11.251 (2.28).
Example 311
Ent-3,4-Dichloro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(3492) ##STR00709##
(3493) 3,4-dichloro[1,1-biphenyl]-2-carboxylic acid (109 mg, 407 mol) dissolved in 2.5 ml DMF was treated with N,N-diisopropylethylamine (350 l, 2.0 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol) and 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) was added. The mixture was stirred at room temperature for 4 h. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm, At-Column Injektion. Gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 83.0 mg (99% purity, 44% yield) of the title compound were obtained.
(3494) LC-MS (Method 7): R.sub.t=1.56 min; MS (ESIpos): m/z=458 [M+H].sup.+
(3495) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.791 (16.00), 3.844 (0.74), 3.854 (0.80), 3.866 (1.36), 3.876 (1.24), 3.914 (1.26), 3.925 (1.33), 3.936 (0.74), 3.948 (0.71), 6.460 (3.21), 6.464 (3.22), 7.239 (1.56), 7.242 (1.59), 7.253 (1.63), 7.256 (1.68), 7.374 (3.26), 7.378 (3.33), 7.382 (1.66), 7.395 (2.06), 7.423 (1.74), 7.435 (2.17), 7.456 (0.97), 7.468 (1.91), 7.480 (1.02), 7.526 (1.20), 7.538 (1.71), 7.551 (0.68), 7.604 (3.08), 7.607 (3.04), 7.627 (3.11), 7.641 (2.89), 8.355 (2.62), 8.664 (0.81), 8.674 (1.55), 8.685 (0.80), 11.221 (2.25).
Example 312
Ent-4-Chloro-3-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(3496) ##STR00710##
(3497) 4-chloro-3-fluoro[1,1-biphenyl]-2-carboxylic acid (102 mg, 407 mol) dissolved in 2.5 ml DMF was treated with N,N-diisopropylethylamine (350 l, 2.0 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol) and 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) was added. The mixture was stirred at room temperature for 4 h. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm, At-Column Injektion. Gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 75.0 mg (100% purity, 41% yield) of the title compound were obtained.
(3498) LC-MS (Method 7): R.sub.t=1.39 min; MS (ESIpos): m/z=442 [M+H].sup.+
(3499) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.788 (16.00), 3.826 (0.83), 3.837 (0.87), 3.849 (1.16), 3.860 (1.08), 3.944 (1.13), 3.954 (1.21), 3.967 (0.87), 3.977 (0.79), 6.421 (3.23), 6.424 (3.21), 7.215 (1.99), 7.228 (2.15), 7.269 (0.90), 7.284 (1.76), 7.298 (1.01), 7.359 (3.20), 7.363 (3.13), 7.392 (3.65), 7.395 (1.26), 7.403 (1.53), 7.406 (5.12), 7.410 (0.64), 7.468 (0.69), 7.471 (5.19), 7.475 (1.43), 7.486 (3.80), 7.500 (0.69), 7.510 (0.79), 7.514 (1.15), 7.524 (1.13), 7.527 (0.70), 7.537 (0.59), 8.309 (3.40), 8.897 (0.75), 8.907 (1.55), 8.917 (0.74), 11.153 (0.68).
Example 313
Ent-4-Chloro-2-Fluoro-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(3500) ##STR00711##
(3501) 4-chloro-2-fluoro[1,1-biphenyl]-2-carboxylic acid (102 mg, 407 mol) dissolved in 2.5 ml DMF was treated with N,N-diisopropylethylamine (350 l, 2.0 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol) and 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) was added. The mixture was stirred at room temperature for 4 h. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm, At-Column Injektion. Gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 88.0 mg (99% purity, 48% yield) of the title compound were obtained.
(3502) LC-MS (Method 7): R.sub.t=1.43 min; MS (ESIpos): m/z=442 [M+H].sup.+
(3503) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 3.780 (16.00), 3.829 (0.79), 3.839 (0.88), 3.852 (1.30), 3.861 (1.19), 3.914 (1.20), 3.926 (1.27), 3.937 (0.79), 3.948 (0.75), 6.462 (3.18), 6.466 (3.29), 7.273 (0.72), 7.287 (1.97), 7.299 (2.24), 7.302 (2.86), 7.305 (2.73), 7.316 (0.64), 7.319 (0.80), 7.360 (1.88), 7.371 (4.08), 7.374 (5.22), 7.402 (1.42), 7.405 (1.40), 7.419 (1.43), 7.476 (0.51), 7.485 (4.19), 7.489 (2.64), 7.494 (2.08), 7.507 (0.50), 7.545 (1.05), 7.549 (0.95), 7.558 (1.09), 7.562 (0.93), 7.568 (0.67), 7.572 (0.60), 8.274 (3.31), 8.599 (0.81), 8.610 (1.54), 8.620 (0.80), 11.190 (1.37).
Example 314
Ent-4-Chloro-2-Methoxy-N-{[4-(1-Methyl-1H-Pyrazol-5-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}[Biphenyl]-2-Carboxamide
(3504) ##STR00712##
(3505) 4-chloro-2-methoxy[1,1-biphenyl]-2-carboxylic acid (107 mg, 407 mol) dissolved in 2.5 ml DMF was treated with N,N-diisopropylethylamine (350 l, 2.0 mmol), 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (101 mg, 529 mol) and 1-hydroxybenzotriazole hydrate (81.0 mg, 529 mol) and stirred for 5 min at room temperature before ent-5-(aminomethyl)-5-(1-methyl-1H-pyrazol-5-yl)imidazolidine-2,4-dione hydrochloride (100 mg, 407 mol) was added. The mixture was stirred at room temperature for 4 h. Purification was done by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic add in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm, At-Column Injektion. Gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 mi n 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 93.0 mg (98% purity, 49% yield) of the title compound were obtained.
(3506) LC-MS (Method 7): R.sub.t=1.44 min; MS (ESIpos): m/z=454 [M+H].sup.+
(3507) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 2.071 (0.47), 3.680 (15.36), 3.776 (16.00), 3.822 (0.44), 3.840 (0.59), 3.851 (0.54), 3.907 (0.52), 6.469 (3.38), 6.472 (3.35), 7.016 (1.37), 7.020 (1.62), 7.032 (1.72), 7.036 (2.26), 7.053 (3.52), 7.057 (2.73), 7.124 (3.58), 7.140 (2.65), 7.265 (1.86), 7.280 (2.08), 7.361 (1.04), 7.372 (4.59), 7.375 (5.59), 7.385 (1.51), 7.399 (1.88), 7.414 (0.74), 7.473 (1.11), 7.476 (1.06), 7.488 (1.62), 7.491 (1.56), 7.503 (0.72), 7.506 (0.69), 8.258 (3.62), 8.338 (0.80), 8.351 (1.61), 8.363 (0.79), 11.219 (1.09).
Example 315
Rac-N-{[2,5-Dioxo-4-(1-Phenyl-1H-Pyrazol-5-Yl)Imidazolidin-4-Yl]Methyl}-5,6-Difluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3508) ##STR00713##
(3509) 5,6-difluoro-N-[2-oxo-2-(1-phenyl-1H-pyrazol-5-yl)ethyl]-4-(trifluoromethyl)[biphenyl]-2-carboxamide (444 mg, 66% purity, 604 mol) was dissolved in 3.8 ml of ethanol. Ammonium carbonate (580 mg, 6.04 mmol) and potassium cyanide (157 mg, 2.41 mmol), dissolved in 7.5 ml of water, were added. The vial was sealed and the mixture was stirred at 80 C. over night. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by preparative HPLC (Instrument: Waters Prep LC/MS System; column: Phenomenex Kinetex C18 5 m 10030 mm; eluent A: water, eluent B: acetonitrile, eluent C: 2% formic acid in water, eluent D: acetonitrile/water (80 Vol. %/20 Vol %); flow: 80 ml/min; room temperature; UV 200-400 nm, At-Column Injektion. Gradient: eluent A 0 to 2 min 63 ml, eluent B 0 to 2 min 7 ml, eluent A 2 to 10 min from 63 ml to 39 ml and eluent B from 7 ml to 31 ml, 10 to 12 min 0 ml eluent A and 70 ml eluent B. Eluent C and eluent D constant flow each 5 ml/min over the whole time). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 26.0 mg (97% purity, 8% yield) of the title compound were obtained.
(3510) LC-MS (Method 7): R.sub.t=1.70 min; MS (ESIpos): m/z=556 [M+H].sup.+
(3511) .sup.1H-NMR (600 MHz, DMSO-d6) [ppm]: 2.157 (0.49), 2.382 (0.93), 2.421 (1.22), 2.610 (0.82), 2.649 (0.94), 3.248 (1.32), 3.259 (1.46), 3.757 (3.38), 3.767 (3.61), 3.780 (4.82), 3.789 (4.42), 3.907 (4.45), 3.918 (4.71), 3.929 (3.67), 3.941 (3.28), 6.695 (12.80), 6.698 (11.80), 7.214 (3.22), 7.227 (15.38), 7.239 (16.00), 7.391 (1.27), 7.432 (6.32), 7.443 (14.55), 7.456 (10.31), 7.476 (6.41), 7.488 (7.06), 7.501 (2.31), 7.527 (12.00), 7.540 (12.97), 7.563 (4.05), 7.578 (4.14), 7.593 (2.43), 7.605 (13.80), 7.608 (12.11), 7.759 (0.74), 7.786 (13.75), 7.800 (12.66), 7.811 (2.42), 7.825 (1.72), 8.075 (14.38), 8.689 (3.23), 8.700 (6.37), 8.711 (3.38), 10.496 (2.30).
Example 316
Rac-N-{[4-(1,5-Dimethyl-1H-Pyrazol-4-Yl)-2,5-Dioxoimidazolidin-4-Yl]Methyl}-5,6-Difluoro-4-(Trifluoromethyl)[Biphenyl]-2-Carboxamide
(3512) ##STR00714##
(3513) N-[2-(1,5-dimethyl-1H-pyrazol-4-yl)-2-oxoethyl]-5,6-difluoro-4-(trifluoromethyl)[biphenyl]-2-carboxamide (253 mg, 578 mol) was dissolved in 4 ml of ethanol. Ammonium carbonate (556 mg, 5.78 mmol) and potassium cyanide (151 mg, 2.31 mmol), dissolved in 8 ml of water, were added. The vial was sealed and the mixture was stirred at 80 C. for 4 d. The reaction was concentrated in vacuo and extracted between water and ethyl acetate. The combined organic layers were dried over sodium sulfate, filtered and concentrated. The crude product was purified by preparative HPLC (column: Chromatorex C18 10 m, 25030 mm; eluent A=water with 0.1% formic acid, B=acetonitrile; gradient: 0.0 min 30% B, 4.5 min 50% B, 11.5 min 70% B, 12 min 100% B, 14.75 min 30% B; flow: 50 ml/min). Product containing samples were united, the solvents were evaporated and the residue was lyophylized. 4.00 mg (100% purity, 1% yield) of the title compound were obtained.
(3514) LC-MS (Method 7): R.sub.t=1.57 min; MS (ESIpos): m/z=508 [M+H].sup.+
(3515) .sup.1H-NMR (500 MHz, DMSO-d6) [ppm]: 2.228 (15.25), 3.658 (0.56), 3.671 (0.66), 3.685 (1.90), 3.693 (16.00), 3.711 (1.39), 3.723 (1.46), 3.739 (0.61), 3.751 (0.52), 7.255 (0.68), 7.263 (0.75), 7.271 (0.82), 7.280 (0.78), 7.351 (5.34), 7.537 (2.57), 7.553 (2.81), 7.587 (0.49), 7.604 (0.88), 7.623 (0.91), 7.640 (0.49), 7.798 (3.37), 7.814 (2.95), 8.172 (2.40), 8.175 (2.35), 8.667 (0.77), 8.680 (1.52), 8.692 (0.75), 10.879 (2.11).
Experimental SectionEvaluation of Pharmacological Activity
Example B1: Production of Human ADAMTS-7
(3516) To study the activity of human ADAMTS-7 (hADAMTS-7), the inventors generated multiple constructs for the production of active ADAMTS-7 in E coli cells. These constructs contain the catalytic domain alone or catalytic domain with the Prodomain (Pro), Disintegrin domain (Dis), or TSR1 (
Example B2: Hybrid Molecules to Improve the Production of Soluble hADAMTS-7
(3517) To improve the production of hADAMTS-7 protein, we also explored various other options. For example, we compared and analyzed the sequences of rat and human ADAMTS-7 in the Pro and CD domains (
Example B3: Engineering Furin Cleavage Site to Manipulate the Production Ratio of the Processed and Unprocessed ADAMTS-7
(3518) We hypothesized multiple furin cleavage sites in rat Pro (
Example B4: Expression Constructs for Production of Recombinant Hybrid ADAMTS-7 Enzymes
(3519) The human ADAMTS-7 catalytic domain with the endogenous human prodomain did not yield well folded secreted protein with enzymatic activity. Exchange of the human prodomain with the rat prodomain dramatically increased production of the human catalytic domain from hybrid rat-human constructs. Rat/human ADAMTS-7 chimera sequence (rPro-hCD (Rat 1-217/Human 237-537)-TEV-2Strep-6His, SEQ ID No. 01) encoding rat pro-domain of ADAMTS-7 (amino acids 1-217 of rat sequence UniProt Q1EHB3, which also includes the signal peptide) and catalytic domain of human ADAMTS-7 (amino acids 237-537 of human sequence UniProt Q9UKP4, which also includes a disintegrin domain) followed by TEV cleavage sequence, 2Strep tag and a His Tag was cloned into the mammalian pcDNA6mycHis (ThermoFischer Scientific) expression vector (or into pcDNA3.4 vector in some embodiments).
(3520) Rat/human ADAMTS-7 chimera sequence (rPro-hCD-FM2 (Rat 1-217/Human 237-537 FM2 (Q216K))-TEV-2Strep-6His, SEQ ID No. 02) encoding rat pro-domain of ADAMTS-7 (amino acids 1-217 of rat sequence UniProt Q1EHB3, which also includes the signal peptide) and catalytic domain of human ADAMTS-7 (amino acids 237-537 of human sequence UniProt Q9UKP4, which also includes a disintegrin domain) followed by TEV cleavage sequence, 2Strep tag and a His Tag was cloned into the mammalian pcDNA6mycHis (ThermoFischer Scientific) expression vector (or into pcDNA3.4 vector in some embodiments). SEQ ID No. 02 contains an additional mutation Glutamine 216 to Lysine within the rat pro-domain sequence (RQQR2171S to RQKR2171S), which improved cleavage by Furin for zymogen processing.
(3521) These expression constructs allow production of recombinant ADAMTS-7 enzymeeither containing at least parts of both domains (e.g., prodomain plus catalytic domain as encoded, in which the prodomain can optionally be preceded by a signal peptide and/or the catalytic domain can optionally be followed by a disintegrin domain) or containing primarily the catalytic domain (e.g., catalytic domain as encoded, for example as generated after furin cleavage between the prodomain and the catalytic domain, which catalytic domain can optionally be followed by a disintegrin domain).
Example B5 Recombinant Production of Active ADAMTS-7 Enzyme
(3522) Expi293 cells (A14635, ThermoFischer Scientific) were grown and transfected in accordance to the manufacturer instruction. In brief, at the final cell density of 2.510.sup.6 cells/mL with >95% viability Expi 293 cells were transfected with 1 mg/liter of vector plasmid DNA as generated according to example 4 using Expifectamine transfection reagent (Thermo Fischer Scientific).
(3523) Approximately 96 hours post transfection, Expi293 cell culture was centrifuged at 4000 rpm (3700 rcf) for 10 mins, and supernatant was collected. Supernatant was neutralized with 50 mM Tris pH8.0, 5 mM CaCl.sub.2, 10 uM ZnCl.sub.2 and 5 mM imidazole pH 8.0 and filtered through 0.22 m filter.
(3524) The filtered supernatant was loaded on Ni-NTA column (GE healthcare #17-3712-06), equilibrated with buffer A (50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM CaCl.sub.2, 10 M ZnCl2 and 5 mM Imidazole (pH 8.0)) on Acta FPLC system. The column was washed with 20 volumes of buffer A and the bound proteins were eluted by linear gradient of 20 column volumes up to 100% buffer B (50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM CaCl2, 10 M ZnCl2 and 500 mM Imidazole (pH 8.0)). The collected fractions were analyzed on the SDS gel and the fractions containing ADAMTS-7 protein were combined and concentrated 10 times.
(3525) The concentrated material from the Ni-NTA purification was loaded onto superdex S200 (SEC) column equilibrated in column buffer: 50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM CaCl2 and 10 M ZnCl2. The collected fractions were analyzed on the SDS gel and the fractions containing ADAMTS-7 protein were combined and concentrated 10 times.
(3526) The concentrated material from the Ni-NTA purification was loaded onto superdex S200 (SEC) column equilibrated in column buffer: 50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM CaCl.sub.2 and 10 M ZnCl.sub.2. The collected fractions were analyzed on the SDS gel and the fractions containing ADAMTS-7 protein were combined.
(3527) Combined S200 fractions were loaded to strep-tactin column (Qiagen #1057981) equilibrated in Buffer A (50 mM Tris 8.0, 300 mM NaCl, 10% glycerol, 5 mM CaCl.sub.2, 10 M ZnCl.sub.2). The column was washed with 20 column volumes of the buffer A and the bound proteins were eluted by linear gradient of 20 column volumes up to 100% buffer B (50 mM Tris 8.0, 300 mM NaCl, 10% glycerol, 5 mM CaCl.sub.2, 10 uM ZnCl.sub.2 and 2.5 mM D-desthiobiotin). The collected fractions were analyzed on the SDS gel and the fractions containing ADAMTS-7 protein were combined. Combined fractions were dialysed overnight at +4 C. against the storage buffer (20 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM CaCl2 and 10 M ZnCl.sub.2).
(3528) Dialyzed protein was concentrated to 1 mg/ml, aliquoted, flash frozen in dry ice/ethanol and stored at 80 C. The final yield of purified ADAMTS-7 was 0.5-1 mg per liter of Expi293 cell culture.
(3529) In some embodiments, the produced polypeptide is further processed (e.g., by TEV protease) to remove some of the parts C-terminal to the catalytic domain.
Example B6: Identification of ADAMTS-7 Substrates and Cleavage Assay Development
(3530) Based on the interaction mapping data and the apparent fragment size in reducing and non-reducing conditions, the results were consistent with a ADAMTS-7 cleavage site near the second EGF repeat of COMP, however the substrate cleavage site has not been defined.
(3531) In an attempt to identify ADAMTS-7 substrate cleavage sites, we scanned the potential regions of COMP and TSP1 to identify ADAMTS consensus sites and generated a series of internally-quenched fluorescently-labeled peptides for use with our purified ADAMTS-7 enzyme (
(3532) ADAMTS-7 human catalytic domain constructs rPro-hCD hybrid (SEQ ID No. 01) and optimized furin site construct FM2 (SEQ ID No. 02) demonstrated the greatest specificity for the TSP1 S1 (amino acids 275-289: DELSSMVLELRGLRT, SEQ ID No. 04). ADAMTS-7 human catalytic domain constructs also cleaved the overlapping TSP1 S2 substrate (amino acids 278-292: SSMVLELRGLRTIVT, SEQ ID No. 05). Substrates S1 and S2 are overlapping at candidate site to E289L290 (
(3533) Activity data from the rat ADAMTS-7 construct identified TSP1 S1 (SEQ ID No. 04) as the preferred substrate, along with S2 and S5 peptides containing the E2891L290 cleavage site (
Example B7 Assay for ADAMTS-7 Enzymatic Activity and Testing of Inhibitory Compounds
(3534) Purified recombinant ADAMTS-7 (as of SEQ ID No. 01 or SEQ ID No. 02) was diluted in reaction buffer (20 mM HEPES pH 8.0, 150 mM NaCl, 5 mM CaCl.sub.2, 0.004% Brij, 10 M ZnCl2) fora concentration of approximately 20 nM. 25 l of the solution were transferred into each well of a 384-well white microtiter plate (Greiner Bio-One 781075) and 1 l test compound solution (modulator/inhibitor dissolved in DMSO, at the corresponding concentration) or pure DMSO as a control were added per well. The enzymatic reaction was initiated by addition of 25 l of a 1 M solution of the FRET substrate, HiLyteFluor-488 DELSSMVLELRGLRT-K(QXL520)-E-NH2; (SEQ ID No. 11, custom synthesis by Anaspec) in the reaction buffer. Amino acids DELSSMVLELRGLRT are derived from Thrombospondin-1 sequence (275-289). An additional carboxyl glutamic acid was added after the QXL520 quencher to increase substrate solubility. The microtiter plate was incubated for 120 min at the temperature of 32 C. The increase of fluorescence intensity was measured in appropriate fluorescence plate reader (e.g. TECAN Ultra) using excitation wavelength of 485 nm and emission wavelength of 520 nm. IC50 values were calculated from percentage of inhibition of ADAMTS-7 activity as a function of test compound concentration. IC50 values derived using functional ADAMTS-7 according to SEQ ID No. 01 or SEQ ID No. 02, respectively, were not distinguishable, both laying within the experimental error.
Example B8: Expression Constructs for Production of Recombinant ADAMTS-12 Enzymes
(3535) Rat/human ADAMTS-12 chimera sequence (rPro-hCD (Rat 1-244/Human 241-543)-3FLAG, SEQ ID 15) encoding rat pro-domain of ADAMTS-12 (amino acids 1-244 of rat sequence UniProt D3ZTJ3, which also includes the signal peptide) and catalytic domain of human ADAMTS-12 (amino acids 241-543 of human sequence UniProt P58397, which also includes a disintegrin domain) followed by 3FLAG Tag was cloned into the mammalian pcDNA3.4 expression vector.
(3536) Rat/human ADAMTS-12 WT demonstrated a better expression profile compared to human ADAMTS-12 (1-543) WT with a human prodomain (
(3537) This expression construct allows production of recombinant ADAMTS-12 enzymeseither containing at least parts of both domains (e.g., prodomain plus catalytic domain as encoded, in which the prodomain can optionally be preceded by a signal peptide and/or the catalytic domain can optionally be followed by a disintegrin domain) or containing primarily the catalytic domain (e.g., catalytic domain as encoded, which can optionally be followed by a disintegrin domain).
Example B9: Recombinant Production of Active ADAMTS-12 Enzyme
(3538) Expi293 cells (Life technologies, A14635) were grown and transfected in accordance to the manufacturer instruction. Briefly, the Expi 293 cells at the final cell density of 2.510.sup.6 cells/mL with >95% viability were transfected by the 1 mg/liter of vector plasmid DNA using Expifectamine transfection reagent (Life technologies, A14525). The overall purification scheme was similar to that used for rat ADAMTS-7 (SEQ ID NO: 03).
(3539) Approximately 72 hours post transfection, Expi293 cell culture was centrifuged at 4000 rpm (3700 rcf) for 10 mins. Supernatant was collected and neutralized with 50 mM Tris pH 8.0, 5 mM CaCl.sub.2, 10 M ZnCl.sub.2 before centrifuged again at 4000 rpm (3700 rcf) for 10 min. Final supernatant was filtered through 0.22 m filter.
(3540) The filtered supernatant was incubated overnight at 4 C. with anti-FLAG M2 affinity gel (Sigma-Aldrich A2220) equilibrated with buffer A (50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM CaCl2, 10 M ZnCl2). The gel was collected and washed with 10 bed volumes of buffer A. The bound proteins were eluted by 100% buffer B (50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM CaCl.sub.2, 10 M ZnCl2, 150 ng/l FLAG peptide (Sigma-Aldrich F4799)). The collected fractions were analyzed on the SDS gel. The fractions containing ADAMTS-12 protein were combined and concentrated 10 times.
(3541) The concentrated material from the FLAG affinity purification was loaded onto superdex S200 (SEC) column equilibrated in column buffer 20 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM CaCl.sub.2 and 10 M ZnCl.sub.2. The collected fractions were analyzed on the SDS gel. Fractions containing ADAMTS-12 protein were combined and concentrated to 0.5 mg/ml. Aliquoted proteins were flash frozen in liquid nitrogen and stored at 80 C.
Example B10: Assay for ADAMTS-12 Enzymatic Activity and Testing of Inhibitory Compounds
(3542) Purified recombinant ADAMTS-12 was diluted in the reaction buffer (20 mM HEPES pH 8.0; 10 mM NaCl; 7.5 mM CaCl2; 0.004% Brij; 7.5 M ZnCl2; 0.1% SmartBlock (Candor Bioscience 113125)) to the concentration of approximately 20 nM and 25 l were transferred into each single well of 384-well white microtiter plate (Greiner Bio One 781075). 1 l of the inhibitor compound solution (dissolved in DMSO, at the corresponding concentration) or pure DMSO as a control was added to the same wells. The enzymatic reaction was initiated by addition of 25 l of 2 M solution of the FRET substrate HiLyte Fluor488-DELSSMVLELRGLRT-K(QXL520)E-NH2; (cf. SEQ ID No. 11) in the reaction buffer. It was surprisingly found that the same substrate could be used for the paralogs ADAMTS-7 and ADAMTS-12. The microtiter plate was incubated for 120 min at the temperature of 32 C. The increase of fluorescence intensity was measured in appropriate fluorescence plate reader (e.g. TECAN Ultra) using excitation wavelength of 485 nm and emission wavelength of 520 nm. IC50 values were calculated from percentage of inhibition of ADAMTS-12 activity as a function of test compound concentration.
Example B11: Selectivity Assay for ADAMTS-7 and/or ADAMTS-12 Modulators
(3543) The respective enzyme (see table 2 below) was diluted in reaction buffer (50 mM Tris, 2.5 M ZnCl.sub.2, 0.05% BSA, 0.001% Brij, pH 7.5 for ADAM17; 50 mM Tris 7.5, 150 mM NaCl, 10 mM CaCl.sub.2, 0.05% Brij for all other enzymes) to the respective concentration and 25 l were transferred into each well of a 384-well white microtiter plate (Greiner Bio One 781075). 1 l test compound solution (dissolved in DMSO, at the corresponding concentration) or pure DMSO as a control was added per well. The enzymatic reaction was initiated by addition of 25 l of the respective concentration of the respective FRET substrate (see table 2 below) in reaction buffer.
(3544) The microtiter plate was incubated for 120 min at the temperature of 32 C. The increase of fluorescence intensity was measured in appropriate fluorescence plate reader (e.g. TECAN Ultra) using the respective wavelengths for excitation and emission. IC50 values were calculated from percentage of inhibition of enzyme activity as a function of test compound concentration.
(3545) TABLE-US-00004 TABLE 2 Assay conditions for the evaluation of the selectivity of ADAMTS-7 modulators. Conc. Conc. Source Excitation Emission Enzyme Source Enzyme Enzyme FRET substrate Substrate Substrate Wavelength Wavelength ADAMTS4 R&D 4307-AD 50 nM Dabcyl-EEVKAKVQPY- 1 M Jerini Peptide 340 nm 480 nm Glu(Edans)-NH2 Technologies (cf. SEQ ID No. 14) ADAMTS5 R&D 2198-AD 100 nM Dabcyl-EEVKAKVQPY- 25 M Jerini Peptide 340 nm 480 nm Glu(Edans)-NH2 Technologies (cf. SEQ ID No. 14) MMP12 R&D 917-MPB, 1 nM Mca-PLGLEEA-Dap(Dnp)- 10 M Bachem M- 325 nm 393 nm activated NH2 2670 according to (cf. SEQ ID No. 17) manufacturers instruction MMP15 R&D 916-MP, 6 nM Mca-KPLGL-Dpa-AR-NH2 20 M R&D ES010 320 nm 405 nm activated (cf. SEQ ID No. 18) according to (Neumann, U. et al., 2004, manufacturers Anal. Biochem. 328: 166- instruction 173) MMP2 R&D 902-MP, 0.06 nM Mca-PLGL -Dpa-AR-NH2 20 M R&D ES001 320 nm 405 nm activated (cf. SEQ ID No. 19) according to manufacturers instruction ADAM17 R&D 930-ADB 20 nM Mca-PLAQAV-Dap(Dnp)- 20 M Bachem M- 320 nm 405 nm RSSSR-NH2 2255 (cf. SEQ ID No. 20) Abbreviations: Dabcyl: e.g. Dabcyl quencher in 3-DAB form N-[4-(4-dimethylamino)phenylazo]benzoic acid; Glu(Edans): e.g. EDANS fluor (5-((2-Aminoethyl)amino)naphthalene-1-sulfonic acid) at modified Glutamic acid; Mca: (7-Methoxycoumarin-4-yl)acetyl; Dap(Dnp): e.g. N-beta-(2,4-dinitrophenyl)-L-2,3-diaminopropionic acid; Dpa: N-3-(2, 4-Dinitrophenyl)-L-2,3-diaminopropionyl.
(3546) TABLE-US-00005 TABLE 3 Example Number ADAMTS7-IC50 [mol/l] ADAMTS4-IC50 [mol/l] 1 1.10E8 6.50E6 2 8.70E7 >5.00E5 3 4.30E9 4.80E6 4 7.35E8 1.90E5 5 7.80E8 1.20E5 6 5.40E8 6.20E6 7 1.50E8 3.70E6 8 1.85E8 3.80E6 9 4.30E8 4.80E6 10 5.70E8 8.90E6 11 9.10E8 5.90E6 12 2.50E7 >5.00E5 13 1.90E7 >5.00E5 14 6.60E8 1.70E5 15 1.80E7 7.75E6 16 4.15E9 3.50E6 17 9.35E9 7.10E6 18 6.30E7 4.10E5 19 9.80E7 >5.00E5 20 2.90E7 2.80E5 21 8.70E8 >5.00E5 22 4.50E8 3.90E6 23 3.20E8 1.25E5 24 3.90E7 >5.00E5 25 4.60E8 >5.00E5 26 3.90E8 >5.00E5 27 2.20E8 9.10E6 28 6.00E8 1.10E5 29 3.80E7 >5.00E5 30 1.60E7 4.50E5 31 4.55E8 6.50E6 32 1.30E7 3.50E5 33 1.70E8 5.20E6 34 3.60E7 8.90E6 35 1.40E7 1.00E5 36 1.20E7 >5.00E5 37 8.90E8 8.70E6 38 7.10E8 2.10E5 39 8.50E8 1.00E5 40 7.20E8 2.10E5 41 2.30E7 3.00E5 42 2.30E7 >5.00E5 43 2.50E7 2.80E5 44 5.80E8 1.10E5 46 1.63E8 4.80E6 47 5.65E8 4.15E6 48 1.50E7 >5.00E5 49 2.10E7 2.20E5 50 2.50E7 4.30E5 51 2.90E7 2.50E5 52 3.40E7 1.90E5 53 3.70E7 4.10E5 54 4.40E7 3.20E5 55 6.80E7 3.00E5 56 8.50E7 3.10E5 57 9.50E7 >5.00E5 58 8.50E7 >5.00E5 59 2.70E7 2.30E5 60 2.10E7 1.50E5 61 1.20E7 7.40E6 62 8.70E8 2.60E5 63 3.50E8 1.30E5 64 1.40E7 1.20E5 65 1.80E7 2.00E5 66 2.27E8 8.20E6 68 9.10E8 1.10E5 69 8.80E9 4.90E6 70 3.40E8 4.50E6 71 2.43E8 1.63E5 72 5.40E8 6.90E6 73 1.10E7 2.00E5 74 3.50E7 5.20E6 75 1.30E7 1.00E5 76 2.15E7 1.40E5 77 1.20E6 4.00E5 78 3.60E7 1.40E5 79 6.60E9 2.10E6 80 1.75E8 5.73E6 81 2.10E7 >5.00E5 82 3.60E7 >5.00E5 83 6.00E7 3.60E5 84 8.70E7 5.00E5 85 2.80E8 1.30E5 86 3.20E8 7.60E6 87 7.60E8 6.90E6 88 1.30E7 9.10E6 89 9.10E8 7.60E6 90 7.10E7 5.00E5 91 2.30E7 3.00E5 92 4.50E8 1.90E5 93 1.30E8 3.40E6 94 5.20E8 5.40E6 95 1.10E6 >5.00E5 96 3.20E7 4.60E5 97 6.60E8 7.20E6 98 6.00E8 2.10E5 99 4.40E8 4.50E6 100 4.50E8 8.10E6 101 5.50E8 3.20E6 102 5.50E8 6.60E6 103 5.90E8 7.10E6 104 6.30E8 8.70E6 105 6.60E8 4.90E6 106 6.60E8 5.40E6 107 6.60E8 6.20E6 108 6.60E8 1.90E5 109 7.10E8 8.70E6 110 7.20E8 7.90E6 111 7.40E8 7.90E6 112 8.10E8 2.20E6 113 8.30E8 1.20E5 114 9.85E8 1.02E5 115 8.90E8 7.80E6 116 9.10E8 1.20E5 117 9.30E8 6.10E5 118 1.00E7 7.60E6 119 1.00E7 9.10E6 120 1.00E7 3.50E5 121 1.20E7 5.90E6 122 1.20E7 7.90E6 123 1.20E7 1.90E5 124 1.20E7 4.20E5 125 1.30E7 8.70E6 126 1.30E7 1.10E5 127 1.90E7 1.30E5 128 2.10E7 1.30E5 129 2.40E7 8.70E6 130 2.85E7 1.73E5 131 3.30E7 8.70E6 132 9.30E7 3.60E5 133 6.95E9 1.60E6 134 9.15E9 1.40E6 135 2.70E9 1.30E6 136 5.60E8 7.10E6 137 1.10E8 1.30E5 138 5.20E8 4.90E6 139 5.85E9 2.10E6 140 1.60E7 1.10E5 141 5.65E9 3.60E6 142 1.20E7 1.80E5 143 5.60E9 4.60E6 144 1.90E7 2.50E5 145 4.90E8 2.80E6 146 5.90E9 1.90E6 147 4.20E9 1.70E6 148 3.28E9 1.84E06 149 4.25E9 1.15E06 150 4.55E9 1.85E06 151 1.70E9 1.02E6 152 2.80E9 7.05E7 153 2.40E9 5.10E7 154 3.70E9 3.95E6 155 1.90E8 5.90E6 156 2.50E7 2.50E5 157 3.10E9 3.00E6 158 5.93E9 3.05E6 159 7.13E9 3.75E6 160 3.10E9 8.30E7 161 3.23E9 7.28E07 162 2.75E9 4.63E7 163 2.50E9 1.30E6 164 7.20E8 1.40E5 165 9.30E9 6.60E6 166 7.77E9 3.25E6 167 3.50E9 4.40E6 168 4.60E9 1.90E6 169 9.30E9 8.50E6 170 4.95E9 4.90E6 171 1.10E8 6.90E6 172 5.95E9 3.10E6 173 1.37E8 7.90E6 174 5.55E9 2.60E6 175 4.05E9 4.90E6 176 6.60E9 4.13E6 177 1.80E8 1.20E5 178 1.85E8 5.37E6 179 9.10E9 1.20E5 180 1.07E8 1.78E05 181 1.20E8 1.20E5 182 9.78E9 4.03E6 183 2.50E8 1.90E5 184 1.94E8 9.37E6 185 1.15E8 1.65E5 186 7.90E8 2.40E5 187 9.70E9 3.55E6 188 5.27E9 2.73E6 189 1.46E8 3.65E6 190 6.30E8 1.20E5 191 5.78E9 6.48E6 192 1.72E8 7.13E6 193 3.90E9 1.57E6 194 1.13E8 8.90E6 195 4.45E9 4.63E6 196 3.90E8 3.00E5 197 1.35E8 1.30E5 198 3.20E8 3.90E5 199 1.13E8 1.60E5 200 1.10E7 2.80E5 201 2.70E8 8.10E6 202 7.40E8 3.80E5 203 1.40E8 4.60E5 204 8.70E8 2.20E5 205 4.50E8 1.20E5 206 8.90E8 >5.00E5 207 6.05E8 >5.00E5 208 1.40E7 >5.00E5 209 7.37E8 3.65E05 210 1.30E8 2.30E5 211 1.10E7 2.80E5 212 5.60E8 1.30E5 213 4.30E8 3.00E5 214 8.97E9 3.75E05 215 1.70E8 3.50E6 216 7.60E8 9.10E6 217 8.70E8 1.60E5 218 2.40E8 4.00E6 219 6.50E8 2.80E6 220 6.55E8 7.80E6 221 1.10E7 8.10E6 222 1.70E7 3.00E6 223 2.10E7 2.60E5 224 2.20E7 1.90E5 225 2.50E7 2.10E5 226 3.30E7 >5.00E5 227 3.40E7 4.10E5 228 9.30E7 2.00E5 229 8.70E7 2.00E5 230 7.60E7 3.30E5 231 1.50E7 5.20E6 232 2.55E8 3.70E6 233 1.70E7 6.50E6 234 2.30E7 1.60E5 235 2.97E8 7.83E6 236 8.50E8 1.50E5 237 7.40E8 >5.00E5 238 5.40E8 2.00E6 239 5.10E8 >5.00E5 240 1.00E7 >5.00E5 241 2.10E7 4.10E5 242 3.30E7 2.90E5 243 1.10E7 4.50E5 244 9.80E8 1.00E5 245 8.70E7 >5.00E5 246 1.00E6 >5.00E5 247 3.80E7 >5.00E5 248 2.60E7 >5.00E5 249 1.90E7 3.50E5 250 1.60E7 3.10E5 251 6.50E8 1.10E5 252 2.00E7 4.10E5 253 4.30E8 1.10E5 254 1.80E7 2.60E5 255 4.30E8 1.00E5 256 3.90E8 2.80E5 257 2.50E7 1.10E5 258 3.20E7 1.20E5 259 6.90E8 5.80E6 260 1.60E7 1.70E5 261 8.90E7 >5.00E5 262 1.60E7 1.90E5 263 3.00E7 3.20E5 264 7.20E8 1.10E5 265 1.60E7 9.10E6 266 1.00E7 1.00E5 267 1.20E7 1.90E5 268 6.10E8 2.70E5 269 1.30E7 9.50E6 270 2.00E8 6.90E6 271 6.65E9 2.70E6 272 1.40E8 7.80E6 273 6.03E7 2.68E05 274 2.20E8 3.80E6 275 1.80E7 9.10E6 276 8.10E8 1.50E5 277 1.60E8 1.60E5 278 3.65E9 8.60E6 279 8.50E8 1.30E5 280 2.50E8 7.10E6 281 2.15E7 2.60E5 282 8.90E8 1.60E5 283 5.40E8 6.30E6 284 6.30E8 8.50E6 285 1.48E7 6.60E6 286 2.30E7 9.80E6 287 1.50E9 1.60E7 288 4.10E7 2.10E5 289 3.80E8 6.30E6 290 3.30E7 2.10E5 291 5.60E8 1.40E5 292 3.00E8 9.50E6 293 3.70E7 >5.00E5 294 1.30E7 3.70E5 295 5.00E8 >5.00E5 296 1.30E7 9.50E6 297 4.80E8 4.10E6 298 7.90E9 9.30E6 299 9.80E8 1.90E5 300 3.10E8 2.30E5 301 1.00E7 1.50E5 302 4.00E8 7.60E6 303 6.50E7 3.80E5 304 4.80E9 3.30E6 305 1.10E8 2.80E5 306 1.20E8 1.60E5 307 1.10E8 2.30E5 308 6.30E9 4.20E6 309 1.10E8 2.70E6 310 1.60E8 1.90E6 311 4.20E8 1.10E5 312 5.40E8 2.00E5 313 6.50E8 2.30E5 314 9.50E7 >5.00E5 315 1.30E8 1.30E6 316 4.10E8 1.20E5
Example B12 Rat Carotid Artery Balloon Injury Model
(3547) The balloon injury model is an important method to study the molecular and cellular mechanisms involved in vascular smooth muscle dedifferentiation, neointima formation and vascular remodeling.
(3548) The left carotid is injured using a balloon catheter with the right carotid serving as a negative control; the inflated balloon denudes the endothelium and distends the vessel wall. Following injury, potential therapeutic strategies such as the use of pharmacological compounds can be evaluated.
(3549) Following sedation to a surgical plane, male Sprague-Dawley rats are laid supine on a sterile surface, the neck area is shaved, cleansed and the surgical area aseptically draped to prevent contamination at the surgical site. A straight incision is made centrally in the neck region from below the chin to the top of the sternum. With continued blunt dissection, the left common carotid artery and the distal aspect of the carotid artery cephalic to the internal and external bifurcation are isolated and made free of overlying fascia and adjacent nerves. Sterile sutures and an arterial clamp are used to control blood flow in order to perform the injury. Isolating a section on the internal carotid artery and using sterile small microscissors, a transverse arteriotomy on the branch is performed. The uninflated 2 French arterial balloon catheter (Edwards Life Sciences, Germany) is inserted through the arteriotomy, inflated and moved down the entire length of the common carotid artery to the aortic arch. The balloon is inflated to a predetermined volume, deflated and withdrawn through the arteriotomy. Following adequate hemostasis, all remaining sutures are removed and the operational field is closed up. Neointimal thickening representing proliferative vascular smooth muscle cells usually peaks at 2 weeks after injury. Vessels are harvested at this time point for histological assessment of neointimal development, vascular growth, molecular analysis as well as gene and protein expression.
CLAUSES
(3550) The following clauses refer to further embodiments disclosed herein: 1. A compound of general formula (I):
(3551) ##STR00715## in which R.sup.1 represents a group selected from hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl, and phenyl wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, and 6- to 10-membered heteroaryl, phenyl are optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms R.sup.2 represents a group independently selected from hydrogen, cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-04)-alkoxy each is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms R.sup.3, R.sup.4, R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent a group independently selected from hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy each is optionally independently substituted with up to five fluorine atoms, with the provisio that at least one of R.sup.2, R.sup.3, R.sup.4 represents H, X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6, represent N or C with the provisio that in each ring system maximal one X stands for N and R.sup.5, R.sup.6, R.sup.7 and Ra are present provided that the designated atom's normal valency under the existing circumstances is not exceeded,
and pharmaceutically acceptable salts thereof, solvates thereof and the solvates of the salts thereof. 2. A compound of general formula (I) according to Clause 1, in which R.sup.1 represents a group selected from hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl and phenyl wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, and 5- to 10-membered heteroaryl, phenyl are optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms R.sup.2 represents a group independently selected from hydrogen cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl(C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-C.sub.4)-alkoxy each is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms R.sup.3 and R.sup.4 represent hydrogen and R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent a group independently selected from hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy each is optionally independently substituted with up to five fluorine atoms, X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6, represent N or C with the provisio that in each ring system maximal one X stands for N and R.sup.5, R.sup.6, R.sup.7 and Ra are present provided that the designated atom's normal valency under the existing circumstances is not exceeded, and pharmaceutically acceptable salts thereof, solvates thereof and the solvates of the salts thereof. 3. A compound of general formula (I) according to Clause 1 or 2, in which R.sup.1 represents a group selected from hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl and phenyl wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, and 5- to 10-membered heteroaryl, phenyl are optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms R.sup.2 represents a group independently selected from hydrogen cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl(C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-04)-alkoxy each is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms. R.sup.3, R.sup.4, R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent a group independently selected from hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy each is optionally independently substituted with up to five fluorine atoms, with the provision that at least two from R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent hydrogen, X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, X.sup.6, represent N or C with the provisio that in each ring system maximal one X stands for N and R.sup.5, R.sup.6, R.sup.7 and Ra are present provided that the designated atom's normal valency under the existing circumstances is not exceeded,
and pharmaceutically acceptable salts thereof, solvates thereof and the solvates of the salts thereof. 4. Compound of the formula (I) according to Clause 1, 2 or 3 represented by the formula (Ia), (Ib), (Ic), (Id) and (Ie)
(3552) ##STR00716##
In which R.sup.1 represents a group selected from hydrogen, (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, 5- to 10-membered heteroaryl and phenyl wherein said (C.sub.1-C.sub.6)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, 5- to 6-membered heterocycloalkyl, and 5- to 10-membered heteroaryl, phenyl are optionally substituted with one or two groups independently selected from cyano, halogen, amino, hydroxy, oxo, C.sub.1-C.sub.3-alkyl, (C.sub.1-C.sub.4)-alkoxy, (C.sub.1-C.sub.4)-alkylcarbonyl, mono-(C.sub.1-C.sub.4)-alkylamino, di-(C.sub.1-C.sub.4)-alkylamino, phenyl, (C.sub.1-C.sub.4)-alkylsulfonyl, and (C.sub.3-C.sub.6)-cycloalkyl, wherein each said C.sub.1-C.sub.3-alkyl, (C.sub.3-C.sub.6)-cycloalkyl, and (C.sub.1-C.sub.4)-alkoxy is optionally substituted with up to 5 fluorine atoms R.sup.2 represents a group independently selected from hydrogen cyano, halogen, (C.sub.1-C.sub.4)-alkylsulfonyl, (C.sub.1-C.sub.4)-alkyl, (C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl(C.sub.3-C.sub.6)-cycloalkyl and (C.sub.1-04)-alkoxy each is optionally independently substituted with up to five fluorine atoms, cyano, or (C.sub.1-C.sub.2)alkyl, wherein said (C.sub.1-C.sub.2)alkyl is optionally substituted with up to five fluorine atoms. R.sup.3, R.sup.4, R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent a group independently selected from hydrogen, halogen, (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy wherein said (C.sub.1-C.sub.4)-alkyl and (C.sub.1-C.sub.4)-alkoxy each is optionally independently substituted with up to five fluorine atoms, with the provision that at least two from R.sup.5, R.sup.6, R.sup.7 and R.sup.8 represent hydrogen,
and pharmaceutically acceptable salts thereof, solvates thereof and the solvates of the salts thereof. 5. The compound of any one of clauses 1-4, wherein said R.sup.2 is (C.sub.3-C.sub.6)-cycloalkyl substituted with a trifluoromethyl group. 6. Compound of the formula (I) according to Clause 1 to 5 selected from the group consisting of ent-6-fluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(3553) ##STR00717## ent-5,6-difluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(3554) ##STR00718## ent-4-chloro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}[biphenyl]-2-carboxamide
(3555) ##STR00719## ent-4-chloro-5-fluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}[biphenyl]-2-carboxamide
(3556) ##STR00720## ent-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(3557) ##STR00721## ent-4,5-difluoro-N-{[4-(1-methyl-1H-pyrazol-5-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(3558) ##STR00722## ent-N-{[4-(4-methyl-1,2-oxazol-3-yl)-2,5-dioxoimidazolidin-4-yl]methyl}-4-(trifluoromethyl)[biphenyl]-2-carboxamide
(3559) ##STR00723## 7. Compound of formula (I) for the treatment and/or prevention of diseases. 8. Compound of formula (I) for use in a method for the treatment and/or prevention of heart diseases, vascular diseases, and/or cardiovascular diseases, lung diseases, inflammatory diseases, fibrotic diseases, metabolic diseases, cardiometabolic diseases. 9. Compound of formula (I) for use in a method for the treatment and/or prevention of atherosclerosis, athersclerosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplasty. 10. Use of a compound according to formula (I) for the manufacture of a pharmaceutical composition for the treatment and/or prevention of atherosclerosis, athersclerosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplasty 11. Use of a compound as defined in any of Clauses 1 to 6 for the manufacture of a pharmaceutical composition for the treatment and/or prevention of atherosclerosis, athersclerosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplasty 12. Pharmaceutical composition comprising a compound as defined in any of Clauses 1 to 6 and one or more pharmaceutically acceptable excipients. 13. Pharmaceutical composition of Clause 10 comprising one or more first active ingredients, in particular compounds of general formula (I) according to any one of clauses 1 to 6, and one or more further active ingredients, in particular one or more additional therapeutic agents selected from the group consisting of angiotensin-converting enzyme inhibitors, angiotensin-receptor blockers, mineralocorticoid-receptor antagonists, endothelin antagonists, renin inhibitors, calcium blockers, beta-receptor blockers, vasopeptidase inhibitors, Sodium-Glucose-Transport-Antagonists, Metformin, Pioglitazones and Dipeptidyl-peptidase-IV inhibitors. 14. The pharmaceutical composition as defined in Clause 12 or 13 for the treatment and/or prevention of atherosclerosis, athersclerosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplasty 15. Method for the treatment and/or prevention atherosclerosis, athersclerosis-related diseases such as coronary artery disease or peripheral vascular disease/arterial occlusive disease as well as post-surgery complications of these diseases such as restenosis after angioplastyin a human or other mammal, comprising administering to a human or other mammal in need thereof a therapeutically effective amount of one or more compounds as defined in any of Clauses 1 to 6, or of a pharmaceutical composition as defined in any of clauses 12 to 13. 16. A recombinant nucleic acid for expression of an ADAMTS-7 polypeptide that comprises a rodent prodomain of ADAMTS-7 as a first portion and a functional human ADAMTS-7 as a second portion 17. A recombinant nucleic acid for expression of an ADAMTS-7 polypeptide, wherein the polypeptide comprises a first portion having a sequence identity of >80% with the sequence of residues 1-217 of SEQ ID NO: 1 or with the sequence of residues 1-217 of SEQ ID NO: 2; and a second portion having a sequence identity of >80% with the sequence of residues 218-518 of SEQ ID NO: 1. 18. The recombinant nucleic acid of any one of clauses 16 or 17, wherein the first portion of the polypeptide comprises residues 1-217 of SEQ ID NO: 1 or residues 1-217 of SEQ ID NO: 2, and/or wherein the second portion amino acid sequence comprises residues 218-518 of SEQ ID NO: 1. 19. A recombinant nucleic acid for expression of an ADAMTS-7 polypeptide, wherein the recombinant nucleic acid encodes for a recombinant polypeptide that comprises a first portion having an amino acid sequence that aligns with a segment of an ADAMTS-7 prodomain amino acid sequence from a first species with a Needleman-Wunsch score greater than 700 when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used; and a second portion having an amino acid sequence that aligns with a segment of an ADAMTS-7 catalytic domain amino acid sequence from a second species with a Needleman-Wunsch score greater than 1000 when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used, wherein optionally the first species is rat and the second species is human. 20. The recombinant nucleic acid of any one of clauses 16 to 19, wherein the motif RQQR within the first portion of the polypeptide is altered, preferably into RQKR. 21. A recombinant nucleic acid for expression of an ADAMTS-12 polypeptide that comprises a rodent prodomain of ADAMTS-12 as a first portion and afunctional human ADAMTS-12 as a second portion. 22. A recombinant nucleic acid for expression of an ADAMTS-12 polypeptide that comprises a first portion having a sequence identity of >80% with the sequence of residues 1-244 of SEQ ID NO: 15, and a second portion having a sequence identity of >80% with the sequence of residues 245-547 of SEQ ID NO: 15. 23. The recombinant nucleic acid of any one of clauses 21 or 22, wherein the first portion comprises residues 1-244 of SEQ ID NO: 15, and/or wherein the second portion amino acid sequence comprises residues 245-547 of SEQ ID NO: 15. 24. A recombinant nucleic acid for expression of an ADAMTS-12 polypeptide, wherein the recombinant nucleic acid encodes for a recombinant polypeptide that comprises a first portion having an amino acid sequence that aligns with a segment of an ADAMTS-12 prodomain amino acid sequence from a first species with a Needleman-Wunsch score greater than 800 when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used; and a second portion having an amino acid sequence that aligns with a segment of an ADAMTS12 catalytic domain amino acid sequence from a second species with a Needleman-Wunsch score greater than 1000 when BLOSUM62 matrix, a gap opening penalty of 11, and a gap extension penalty of 1 are used wherein optionally the first species is rat and the second species is human. 25. The recombinant nucleic acid of any one of clauses 21 to 24, wherein the second portion comprises an E393Q mutation. 26. The recombinant nucleic acid of any of clauses 16 to 25, wherein the encoded polypeptide or the second portion thereof is suited to cleave a peptide comprising standard residues 1-15 of the amino acid sequence of SEQ ID NO: 4, preferably with a kcat/KM of at least 20% of a corresponding kcat/KM of human ADAMTS-7 or human ADAMTS-12. 27. A recombinant polypeptide encoded by the recombinant nucleic acid according to any of clauses 16 to 26, or a fragment of that recombinant polypeptide, wherein said recombinant polypeptide or fragment thereof is suited to cleave a peptide substrate comprising standard residues 1-15 of SEQ ID NO: 4. 28. A peptide substrate for ADAMTS-7 and/or ADAMTS-12, the peptide substrate comprising residues 1-15 of the amino acid sequence of SEQ ID NO: 4, or residues 1-15 of the amino acid sequence of SEQ ID NO: 5, or residues 1-13 of the amino acid sequence of SEQ ID NO: 8, or a fragment of any of the sequences according to a), b) or c), the fragment comprising the amino acid sequence EL. 29. The peptide substrate of clause 28, wherein the peptide substrate comprises a first moiety conjugated to a residue that is N-terminal to sequence fragment EL comprised within SEQ ID No. 4, 5, or 8 or the fragment thereof, and a second moiety conjugated to a residue that is C-terminal to said sequence fragment EL. 30. The peptide substrate of clause 29, wherein the first moiety comprises a fluorophore and the second moiety comprises a quencher, or wherein the first moiety comprises a quencher and the second moiety comprises a fluorophore. 31. A method for the identification or characterization of an ADAMTS-7 and/or ADAMTS-12 modulator comprising the steps of contacting a recombinant polypeptide or a fragment thereof according to clause 27 with at least one test compound; contacting said recombinant polypeptide or fragment thereof with a peptide substrate according to any one of clauses 28 to 30, wherein the peptide substrate comprises a fluorophore and a quencher; and detecting fluorescence as a measure for the activity of said recombinant polypeptide or a fragment thereof. 32. A modulator of ADAMTS-7 and/or ADAMTS-12 identified by a method according to clause 31 for use in the treatment of coronary artery disease (CAD), peripheral vascular disease (PAD) and myocardial infarction (MI). 33. A method of producing a recombinant polypeptide according to clause 27, the method comprising cultivating a recombinant host cell comprising a recombinant nucleic acid according to any of clauses 16 to 26 recovering the recombinant polypeptide of a fragment thereof according to clause 27. 34. Kit of parts comprising at least one recombinant nucleic acid according to any of clauses 16 to 26 or at least one polypeptide according to clause 27 and a peptide substrate according to any of clauses 28 to 30.