Parvovirus antibodies for veterinary use
12398198 ยท 2025-08-26
Assignee
Inventors
- Hangjun Zhan (Foster City, CA, US)
- Lam Nguyen (Union City, CA, US)
- Ellen Ratcliff (Burlingame, CA, US)
- Richard Chin (San Francisco, CA, US)
- Shyr Jiann Li (Millbrae, CA, US)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/94
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
International classification
Abstract
Provided are various embodiments relating to parvovirus antibodies, including caninized, felinized, and chimeric antibodies, that bind to canine and/or feline parvovirus, for example, having improved expression characteristics. In various embodiments, the parvovirus antibodies have ADCC, ADCP, and/or CDC effector functions. In various embodiments, such monoclonal parvovirus antibodies can be used in methods to prevent and/or treat parvoviral infection in subjects, such as dogs and cats. For example, the parvovirus antibodies provided may be used to provide passive immunity against infection with a canine or feline parvovirus.
Claims
1. An antibody that binds to canine parvovirus and/or feline parvovirus, wherein the antibody comprises: (a) (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 4, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 5, (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 6, and (b) (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 13, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 14, (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 15, and wherein the heavy chain sequence is at least 95% identical to SEQ ID NO: 24 and the light chain sequence is at least 95% identical to SEQ ID NO: 25.
2. The antibody of claim 1, wherein the heavy chain sequence is at least 98% identical to SEQ ID NO: 24 and the light chain sequence is at least 98% identical to SEQ ID NO: 25.
3. The antibody of claim 1, wherein the heavy chain sequence is at least 99% identical to SEQ ID NO: 24 and the light chain sequence is at least 99% identical to SEQ ID NO: 25.
4. The antibody of claim 1, wherein said antibody is isolated.
5. The antibody of claim 1, wherein said antibody is a chimeric antibody.
6. The antibody of claim 1, wherein the antibody binds to an epitope comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, and/or SEQ ID NO: 3.
7. The antibody of claim 1, wherein the antibody binds to canine parvovirus or feline parvovirus as determined by immunoblot analysis and/or biolayer interferometry.
8. The antibody of claim 1, wherein the antibody at a concentration of 200 g/mL has an hemagglutination inhibition value of at least 8000, of at least 16000, or of at least 32000.
9. The antibody of claim 1, wherein the antibody is a monoclonal antibody.
10. An isolated nucleic acid encoding the antibody of claim 1.
11. A host cell comprising the nucleic acid of claim 10.
12. A method of producing an antibody comprising culturing the host cell of claim 11 and isolating the antibody.
13. A pharmaceutical composition comprising the antibody of claim 1 and a pharmaceutically acceptable carrier.
14. The pharmaceutical composition of claim 13, wherein the pharmaceutically acceptable carrier is phosphate buffered saline.
15. A method of providing passive immunity in a canine or a feline subject against infection with a canine or feline parvovirus comprising administering to the subject a therapeutically effective amount of the antibody of claim 1 that binds to the canine or feline parvovirus.
16. The method of claim 15, wherein the antibody is administered before or after exposure to the canine or feline parvovirus or after infection with the canine or feline parvovirus.
17. The method of claim 16, wherein the antibody is administered after the subject has exhibited at least one symptoms selected from the group consisting of fever, vomiting, diarrhea, lymphopenia, and septicemia.
18. An antibody that binds to canine parvovirus and/or feline parvovirus, wherein the antibody comprises: (a) (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 4, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 5, (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 6, and (b) (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 13, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 14, (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 15, and wherein the heavy chain sequence comprises SEQ ID NO: 24 with optionally 1, 2, 3, 4, or 5 amino acid substitutions and the light chain sequence comprises SEQ ID NO: 25 with optionally 1, 2, 3, 4, or 5 amino acid substitutions.
19. The antibody of claim 18, wherein said amino acid substitutions are conservative substitutions.
20. A method of treating a canine or feline parvoviral infection in a canine or a feline subject comprising administering to the subject a therapeutically effective amount of the antibody of claim 1 that binds to the canine or feline parvovirus.
21. A method for detecting a parvoviral infection in a sample from a canine or a feline subject comprising contacting the sample with the antibody of claim 1 under conditions permissive for the binding of the antibody to a parvovirus, and detecting whether a complex is formed between the antibody and the parvovirus in the sample.
22. A variant IgG Fc polypeptide comprising: a) an aspartic acid or a glutamic acid at a position corresponding to position 10 of SEQ ID NO: 91; b) an aspartic acid or a glutamic acid at position 10 of SEQ ID NO: 91; c) an aspartic acid or a glutamic acid at a position corresponding to position 103 of SEQ ID NO: 91; d) an aspartic acid or a glutamic acid at position 103 of SEQ ID NO: 91; e) an aspartic acid or a glutamic acid at a position corresponding to position 10 and/or position 103 of SEQ ID NO: 91; or f) an aspartic acid or a glutamic acid at position 10 and/or position 103 of SEQ ID NO: 91.
23. The antibody of claim 1, wherein the heavy chain comprises a variable heavy chain framework region (HC-FR1) comprising the amino acid sequence of SEQ ID NO: 8.
24. The antibody of claim 2, wherein the heavy chain comprises a HC-FR1 comprising the amino acid sequence of SEQ ID NO: 8.
25. The antibody of claim 19, wherein the heavy chain comprises a HC-FR1 comprising the amino acid sequence of SEQ ID NO: 8.
26. The antibody of claim 18, wherein the antibody comprises: (a) (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 4, (ii) a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 5, (iii) a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 6, and (b) (i) a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 13, (ii) a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 14, (iii) a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 15, and wherein the heavy chain sequence comprises SEQ ID NO: 24 and the light chain sequence comprises SEQ ID NO: 25.
27. The antibody of claim 1, wherein the antibody binds to canine parvovirus.
28. The antibody of claim 19, wherein the antibody binds to canine parvovirus.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
DESCRIPTION OF CERTAIN SEQUENCES
(9) Table 1 provides a listing of certain sequences referenced herein.
(10) TABLE-US-00001 TABLE1 DescriptionofCertainSequences SEQ IDNO: SEQUENCE DESCRIPTION 1 ESENYRRVVVNNMDKTAVNGNMALDDIHAEIVTPWSL Epitope1 V 2 TPWRYYFQWDRTLIPSHTGTSGTPTNIYHGTDPDDVQ Epitope2 FYTIENS 3 TPWRYYFQWDRTLIPSHTGTSGTP Minimalepitope2 4 GFSLSSYHVH Variableheavychain CDR-H1ofMabA 5 VMWNDGDTS Variableheavychain CDR-H2ofMabA 6 PELPGLTYGVWFPY Variableheavychain CDR-H3ofMabA 7 QVQLKESGPGLVQPSQTLSLTCTVS Variableheavychain frameworkregionHC-FR1 ofMabA 8 QVQLKESGPGLVAPSQTLSLTCTVS Variableheavychain frameworkregionHC-FR1 ofMabAvariant2(v2) Q13A 9 WVRQPPGKGLEWLG Variableregionheavychain frameworkregionHC-FR2 ofMabA 10 YNLALNSRLSISRDTSKSQVFFKMSSLQTEDTATYYC Variableheavychain AR frameworkregionHC-FR3 ofMabA 11 WGQGTLVTVSS Variableheavychain frameworkregionHC-FR4 ofMabA 12 WGQGTLVTVSA Variableheavychain frameworkregionHC-FR4 ofMabAvariant2(v2) S11A 13 KASQNVDSNVD Variablelightchain CDR-L1ofMabA 14 KASNRNT Variablelightchain CDR-L2ofMabA 15 MQSTSYPLTF Variablelightchain CDR-L3ofMabA 16 DIVMTQTPASMSISVGDRVTMNC Variablelightchain frameworkregionLC-FR1 ofMabA 17 WYQQKTGQSPNLLIY Variablelightchain frameworkregionLC-FR2 ofMabA 18 GVPDRFTGSGSGTDFTFTISNMQAEDLAVYYC Variablelightchain frameworkregionLC-FR3 ofMabA 19 GSGTKLEIK Variablelightchain frameworkregionLC-FR4 ofMabA 20 QVQLKESGPGLVQPSQTLSLTCTVSGFSLSSYHVHWV Variableheavychainof RQPPGKGLEWLGVMWNDGDTSYNLALNSRLSISRDTS MabA KSQVFFKMSSLQTEDTATYYCARPELPGLTYGVWFPY (MabAHC) WGQGTLVTVSS 21 QVQLKESGPGLVAPSQTLSLTCTVSGFSLSSYHVHWV Variableheavychainof RQPPGKGLEWLGVMWNDGDTSYNLALNSRLSISRDTS MabAvariant2 KSQVFFKMSSLQTEDTATYYCARPELPGLTYGVWFPY HC-FR1Q13A WGQGTLVTVSA HC-FR4S11A (MabAHCv2) 22 DIVMTQTPASMSISVGDRVTMNCKASQNVDSNVDWYQ VariablelightchainofMab QKTGQSPNLLIYKASNRNTGVPDRFTGSGSGTDFTFT A ISNMQAEDLAVYYCMQSTSYPLTFGSGTKLEIK (MabALC) 23 QVQLKESGPGLVQPSQTLSLTCTVSGFSLSSYHVHWV Chimericvariableheavy RQPPGKGLEWLGVMWNDGDTSYNLALNSRLSISRDTS chainofMabAandcanine KSQVFFKMSSLQTEDTATYYCARPELPGLTYGVWFPY IgG-B WGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALA (ChimericAHCIgG-B) CLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLY SLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPK RENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKPKDTL LIARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAK TQPREEQFNGTYRVVSVLPIGHQDWLKGKQFTCKVNN KALPSPIERTISKARGQAHQPSVYVLPPSREELSKNT VSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHN HYTQESLSHSPGK 24 QVQLKESGPGLVAPSQTLSLTCTVSGFSLSSYHVHWV Chimericvariableheavy RQPPGKGLEWLGVMWNDGDTSYNLALNSRLSISRDTS chainofMabAv2and KSQVFFKMSSLQTEDTATYYCARPELPGLTYGVWFPY canineIgG-B WGQGTLVTVSAASTTAPSVFPLAPSCGSTSGSTVALA HC-FR1Q13A CLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLY HC-FR4S11A SLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPK (ChimericAHCv2IgG-B) RENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKPKDTL LIARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAK TQPREEQFNGTYRVVSVLPIGHQDWLKGKQFTCKVNN KALPSPIERTISKARGQAHQPSVYVLPPSREELSKNT VSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHN HYTQESLSHSPGK 25 DIVMTQTPASMSISVGDRVTMNCKASQNVDSNVDWYQ Chimericvariablelight QKTGQSPNLLIYKASNRNTGVPDRFTGSGSGTDFTFT chainofMabAandcanine ISNMQAEDLAVYYCMQSTSYPLTFGSGTKLEIKRNDA lightconstantregion QPAVYLFQPSPDQLHTGSASVVCLLNSFYPKDINVKW (ChimericALC) KVDGVIQDTGIQESVTEQDKDSTYSLSSTLTMSSTEY LSHELYSCEITHKSLPSTLIKSFQRSECQRVD 26 MAVLGLLLCLVTFPSCVLS Heavychainleader 27 METDTLLLWVLLLWVPGSTG Lightchainleader 28 MAVLGLLLCLVTFPSCVLSQVQLKESGPGLVQPSQTL Chimericvariableheavy SLTCTVSGFSLSSYHVHWVRQPPGKGLEWLGVMWNDG chainofMabAandcanine DTSYNLALNSRLSISRDTSKSQVFFKMSSLQTEDTAT IgG-Bwithleadersequence YYCARPELPGLTYGVWFPYWGQGTLVTVSSASTTAPS (ChimericAHCIgG-Bwith VFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSG leader) SLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETF TCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAP EMLGGPSVFIFPPKPKDILLIARTPEVICVVVDLDPE DPEVQISWFVDGKQMQTAKTQPREEQFNGTYRVVSVL PIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQA HQPSVYVLPPSREELSKNIVSLICLIKDFFPPDIDVE WQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKS RWQRGDTFICAVMHEALHNHYTQESLSHSPGK 29 MAVLGLLLCLVTFPSCVLSQVQLKESGPGLVAPSQTL Chimericvariableheavy SLTCTVSGFSLSSYHVHWVRQPPGKGLEWLGVMWNDG chainofMabAv2and DTSYNLALNSRLSISRDTSKSQVFFKMSSLQTEDTAT canineIgG-Bwithleader YYCARPELPGLTYGVWFPYWGQGTLVTVSAASTTAPS sequence VFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSG HC-FR1Q13A SLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETF HC-FR4S11A TCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAP (ChimericAHCv2IgG-B EMLGGPSVFIFPPKPKDILLIARTPEVICVVVDLDPE withleader) DPEVQISWFVDGKQMQTAKTQPREEQFNGTYRVVSVL PIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQA HQPSVYVLPPSREELSKNIVSLICLIKDFFPPDIDVE WQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKS RWQRGDTFICAVMHEALHNHYTQESLSHSPGK 30 METDTLLLWVLLLWVPGSTGDIVMTQTPASMSISVGD Chimericvariablelight RVTMNCKASQNVDSNVDWYQQKTGQSPNLLIYKASNR chainofMabAandcanine NTGVPDRFTGSGSGTDFTFTISNMQAEDLAVYYCMQS lightconstantregionwith TSYPLTFGSGTKLEIKRNDAQPAVYLFQPSPDQLHTG leadersequence SASVVCLLNSFYPKDINVKWKVDGVIQDTGIQESVTE (ChimericALCwith QDKDSTYSLSSTLTMSSTEYLSHELYSCEITHKSLPS leader) TLIKSFQRSECQRVD 31 QVQLKESGPGLVQPSQTLSLTCTVSGFSLSSYHVHWV Chimericvariableheavy RQPPGKGLEWLGVMWNDGDTSYNLALNSRLSISRDTS chainofMabAandfeline KSQVFFKMSSLQTEDTATYYCARPELPGLTYGVWFPY IgG-1 WGQGTLVTVSSASTTAPSVFPLAPSCGTTSGATVALA (ChimericAHCIgG-1) CLVLGYFPEPVTVSWNSGALTSGVHTFPAVLQASGLY SLSSMVTVPSSRWLSDTFTCNVAHPPSNTKVDKTVRK TDHPPGPKPCDCPKCPPPEMLGGPSIFIFPPKPKDTL SISRIPEVTCLVVDLGPDDSDVQITWFVDNTQVYTAK TSPREEQFNSTYRVVSVLPILHQDWLKGKEFKCKVNS KSLPSPIERTISKAKGQPHEPQVYVLPPAQEELSRNK VSVTCLIKSFHPPDIAVEWEITGQPEPENNYRTTPPQ LDSDGTYFVYSKLSVDRSHWQRGNTYTCSVSHEALHS HHTQKSLTQSPGK 32 DIVMTQTPASMSISVGDRVTMNCKASQNVDSNVDWYQ Chimericvariablelight QKTGQSPNLLIYKASNRNTGVPDRFTGSGSGTDFTFT chainofMabAandfeline ISNMQAEDLAVYYCMQSTSYPLTFGSGTKLEIKRSDA lightconstantregion QPSVFLFQPSLDELHTGSASIVCILNDFYPKEVNVKW (ChimericALC) KVDGVVQNKGIQESTTEQNSKDSTYSLSSTLTMSSTE YQSHEKFSCEVTHKSLASTLVKSFNRSECQRE 33 DIVMTQTPASMSISVGDRVTMNCKASQNVDSNVDWYQ Chimericvariablelight QKTGQSPNLLIYKASNRNTGVPDRFTGSGSGTDFTFT chainofMabAandfeline ISNMQAEDLAVYYCMQSTSYPLTFGSGTKLEIKRSDA lightconstantregionwithno QPSVFLFQPSLDELHTGSASIVCILNDFYPKEVNVKW N-linkedglycosylationsite KVDGVVQNKGIQESTTEQNSKDSTYSLSSTLTMSSTE (ChimericALCaglycos) YQSHEKFSCEVTHKSLASTLVKSFQRSECQRE 34 MAVLGLLLCLVTFPSCVLSQVQLVESGGDLVKPGGTL Caninizedvariableheavy RLSCTVSGFSLSSYHVHWVRQPPGKGLEWVAVMWNDG chainofMabAv3and DTSYNLAVKGRFTISRDNAKNTLYLQMNSLRAEDTAV canineIgG-Bwithleader YYCARPELPGLTYGVWFPYWGQGTLVTVSSASTTAPS sequence VFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSG (ChimericAHCv3IgG-B SLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETF withleader) TCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAP EMLGGPSVFIFPPKPKDILLIARTPEVICVVVDLDPE DPEVQISWFVDGKQMQTAKTQPREEQFNGTYRVVSVL PIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQA HQPSVYVLPPSREELSKNIVSLICLIKDFFPPDIDVE WQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKS RWQRGDTFICAVMHEALHNHYTQESLSHSPGK 85 QVQLVESGGDLVKPGGTLRLSCTVSGFSLSSYHVHWV Caninizedvariableheavy RQPPGKGLEWVAVMWNDGDTSYNLAVKGRFTISRDNA chainofMabAv3 KNTLYLQMNSLRAEDTAVYYCARPELPGLTYGVWFPY WGQGTLVTVSS 35 MAVLGLLLCLVTFPSCVLSEVQLVESGGDLVKPGGTL Caninizedvariableheavy RLSCTVSGFSLSSYHVHWVRQPPGKGLEWLGVMWNDG chainofMabAv4and DTSYNLAVKGRFTISRDNAKNTLYFQMNSLRAEDTAT canineIgG-Bwithleader YYCARPELPGLTYGVWFPYWGQGTLVTVSSASTTAPS sequence VFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSG (CaninizedAHCv4IgG-B SLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETF withleader) TCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAP EMLGGPSVFIFPPKPKDILLIARTPEVICVVVDLDPE DPEVQISWFVDGKQMQTAKTQPREEQFNGTYRVVSVL PIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQA HQPSVYVLPPSREELSKNIVSLICLIKDFFPPDIDVE WQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKS RWQRGDTFICAVMHEALHNHYTQESLSHSPGK 86 EVQLVESGGDLVKPGGTLRLSCTVSGFSLSSYHVHWV Caninizedvariableheavy RQPPGKGLEWLGVMWNDGDTSYNLAVKGRFTISRDNA chainofMabAv4 KNTLYFQMNSLRAEDTATYYCARPELPGLTYGVWFPY WGQGTLVTVSS 36 METDTLLLWVLLLWVPGSTGEIVMTQSPASLSLSQEE Caninizedvariablelight KVTITCKASQNVDSNVDWYQQKPGQAPKLLIYKASNR chainofMabAandcanine NTGVPSRFSGSGSGTDFSFTISSLEPEDVAVYYCMQS lightconstantregionwith TSYPLTFGQGTKLEIKRNDAQPAVYLFQPSPDQLHTG leadersequence SASVVCLLNSFYPKDINVKWKVDGVIQDTGIQESVTE (CaninizedALCwith QDKDSTYSLSSTLTMSSTEYLSHELYSCEITHKSLPS leader) TLIKSFQRSECQRVD 87 EIVMTQSPASLSLSQEEKVTITCKASQNVDSNVDWYQ Caninizedvariablelight QKPGQAPKLLIYKASNRNTGVPSRFSGSGSGTDFSFT chainofMabA ISSLEPEDVAVYYCMQSTSYPLTFGQGTKLEIK 37 QVQLVESGGDLVKPGGTLRLSCTVSGFSLSSYHVHWV Caninizedvariableheavy RQPPGKGLEWVAVMWNDGDTSYNLAVKGRFTISRDNA chainofMabAv3and KNTLYLQMNSLRAEDTAVYYCARPELPGLTYGVWFPY canineIgG-B WGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALA (CaninizedAHCv3IgG-B) CLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLY SLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPK RENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKPKDTL LIARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAK TQPREEQFNGTYRVVSVLPIGHQDWLKGKQFTCKVNN KALPSPIERTISKARGQAHQPSVYVLPPSREELSKNT VSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHN HYTQESLSHSPGK 38 EVQLVESGGDLVKPGGTLRLSCTVSGFSLSSYHVHWV Caninizedvariableheavy RQPPGKGLEWLGVMWNDGDTSYNLAVKGRFTISRDNA chainofMabAv4and KNTLYFQMNSLRAEDTATYYCARPELPGLTYGVWFPY canineIgG-B WGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALA (CaninizedAHCv4IgG-B) CLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLY SLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPK RENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKPKDTL LIARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAK TQPREEQFNGTYRVVSVLPIGHQDWLKGKQFTCKVNN KALPSPIERTISKARGQAHQPSVYVLPPSREELSKNT VSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHN HYTQESLSHSPGK 39 EIVMTQSPASLSLSQEEKVTITCKASQNVDSNVDWYQ Caninizedvariablelight QKPGQAPKLLIYKASNRNTGVPSRFSGSGSGTDFSFT chainofMabAandcanine ISSLEPEDVAVYYCMQSTSYPLTFGQGTKLEIKRNDA lightconstantregion QPAVYLFQPSPDQLHTGSASVVCLLNSFYPKDINVKW (CaninizedALC) KVDGVIQDTGIQESVTEQDKDSTYSLSSTLTMSSTEY LSHELYSCEITHKSLPSTLIKSFQRSECQRVD 40 QLTLRESGPGLVKPSQSLSLTCTVSGFSLSSYHVHWI Felinizedvariableheavy RQRPGRGLEWLGVMWNDGDTSYAFQGRISITADTAQN chainofMabA QFSLQLSSMTTDDTAVYYCARPELPGLTYGVWFPYWG (FelinizedAHC) QGALVTVS 41 AITMTQSPGSLAGSPGQQVTMNCKASQNVDSNVD Felinizedvariablelight WYQQKPGQHPKLLIYKASNRNTGVPDRFSGSGSG chainofMabA TDFTLTISNLQAEDVASYYCMQSTSYPLTFGQGT (FelinizedALC) KLEIK 42 GFSLTSYGVS Variableheavychain CDR-H1ofMabB 43 TMWNDGDTD Variableheavychain CDR-H2ofMabB 44 SQLPGYNLRGWFVY Variableheavychain CDR-H3ofMabB 45 QVQLKESGPGLVQPSQTLSLTCTVS Variableheavychain frameworkregionHC-FR1 ofMabB 46 QVQLKESGPGLVQPSETLSLTCTVS Variableheavychain frameworkregionHC-FR1 ofMabBvariant2(v2) Q16E 47 WVRQPPGKGLEWIG Variableregionheavychain frameworkregionHC-FR2 ofMabB 48 WVRQPPGKGLEWMG Variableregionheavychain frameworkregionHC-FR2 ofMabBvariant2(v2) I13M 49 YHSALRSRLSISRDSSKSQVLLKMNSLQTEDTAMYFC Variableheavychain AR frameworkregionHC-FR3 ofMabB 50 YNSALRSKLSISRDTSKSQVFLKMNSLQTEDTAIYYC Variableregionheavychain AR frameworkregionHC-FR3 ofMabBvariant2(v2) H2N R8K S15T L21F M34I F36Y 51 WGQGTLVIVS Variableheavychain frameworkregionHC-FR4 ofMabB 52 KASHNINKNLE Variablelightchain CDR-L1ofMabB 53 YANNLQT Variablelightchain CDR-L2ofMabB 54 YQYNSGHTF Variablelightchain CDR-L3ofMabB 55 DIVMTQTPSLLSASVGDRVTLNC Variablelightchain frameworkregionLC-FR1 ofMabB 56 DIQMTQSPPVLSASVGDRVTLSC Variablelightchain frameworkregionLC-FR1 ofMabBvariant2(v2) V3Q T7S S9P L10V N22S 57 WYQQKLGEAPKLLIY Variablelightchain frameworkregionLC-FR2 ofMabB 58 GISSRFSGSGSGTDYTLTISSLQPEDVATYYC Variablelightchain frameworkregionLC-FR3 ofMabB 59 GIPSRFSGSGSGTDYTLTISSLQPEDVATYYC Variablelightchain frameworkregionLC-FR3 ofMabBvariant2(v2) S3P 60 GAGTKLELK Variablelightchain frameworkregionLC-FR4 ofMabB 61 GAGTKLEIK Variablelightchain frameworkregionLC-FR4 ofMabBvariant2(v2) L8I 62 QVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVSWV Variableheavychainof RQPPGKGLEWIGTMWNDGDTDYHSALRSRLSISRDSS MabB KSQVLLKMNSLQTEDTAMYFCARSQLPGYNLRGWFVY (MabBHC) WGQGTLVIVS 63 QVQLKESGPGLVQPSETLSLTCTVSGFSLTSYGVSWV Variableheavychainof RQPPGKGLEWMGTMWNDGDTDYNSALRSKLSISRDTS MabBvariant2 KSQVFLKMNSLQTEDTAIYYCARSQLPGYNLRGWFVY HC-FR1Q16E WGQGTLVIVS HC-FR2I13M HC-FR3H2N HC-FR3R8K HC-FR3S15T HC-FR3L21F HC-FR3M34I HC-FR3F36Y (MabBHCv2) 64 DIVMTQTPSLLSASVGDRVILNCKASHNINKNLEWYQ VariablelightchainofMab QKLGEAPKLLIYYANNLQTGISSRFSGSGSGTDYTLT B ISSLQPEDVATYYCYQYNSGHTFGAGTKLELK (MabBLC) 65 DIQMTQSPPVLSASVGDRVTLSCKASHNINKNLEWYQ VariablelightchainofMab QKLGEAPKLLIYYANNLQTGIPSRFSGSGSGTDYTLT Bvariant2 ISSLQPEDVATYYCYQYNSGHTFGAGTKLEIK LC-FR1V3Q LC-FR1T7S LC-FR1S9P LC-FR1L10V LC-FR1N22S LC-FR3S3P LC-FR4L8I (MabBLCv2) 66 QVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVSWV Chimericvariableheavy RQPPGKGLEWIGTMWNDGDTDYHSALRSRLSISRDSS chainofMabBandcanine KSQVLLKMNSLQTEDTAMYFCARSQLPGYNLRGWFVY IgG-B WGQGTLVIVSASTTAPSVFPLAPSCGSTSGSTVALAC (ChimericBHCIgG-B) LVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYS LSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPKR ENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKPKDTLL IARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAKT QPREEQFNGTYRVVSVLPIGHQDWLKGKQFTCKVNNK ALPSPIERTISKARGQAHQPSVYVLPPSREELSKNTV SLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQL DEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNH YTQESLSHSPGK 67 QVQLKESGPGLVQPSETLSLTCTVSGFSLTSYGVSWV Chimericvariableheavy RQPPGKGLEWMGTMWNDGDTDYNSALRSKLSISRDTS chainofMabBv2and KSQVFLKMNSLQTEDTAIYYCARSQLPGYNLRGWFVY canineIgG-B WGQGTLVIVSAASTTAPSVFPLAPSCGSTSGSTVALA HC-FR1Q16E CLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLY HC-FR2I13M SLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPK HC-FR3H2N RENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKPKDTL HC-FR3R8K LIARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAK HC-FR3S15T TQPREEQFNGTYRVVSVLPIGHQDWLKGKQFTCKVNN HC-FR3L21F KALPSPIERTISKARGQAHQPSVYVLPPSREELSKNT HC-FR3M34I VSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ HC-FR3F36Y LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHN (ChimericBHCv2IgG-B) HYTQESLSHSPGK 68 DIVMTQTPSLLSASVGDRVILNCKASHNINKNLEWYQ Chimericvariablelight QKLGEAPKLLIYYANNLQTGISSRFSGSGSGTDYTLT chainofMabBandcanine ISSLQPEDVATYYCYQYNSGHTFGAGTKLELKRNDAQ lightconstantregion PAVYLFQPSPDQLHTGSASVVCLLNSFYPKDINVKWK (ChimericBLC) VDGVIQDTGIQESVTEQDKDSTYSLSSTLTMSSTEYL SHELYSCEITHKSLPSTLIKSFQRSECQRVD 69 DIQMTQSPPVLSASVGDRVTLSCKASHNINKNLEWYQ Chimericvariablelight QKLGEAPKLLIYYANNLQTGIPSRFSGSGSGTDYTLT chainofMabBv2and ISSLQPEDVATYYCYQYNSGHTFGAGTKLEIKRNDAQ caninelightconstant PAVYLFQPSPDQLHTGSASVVCLLNSFYPKDINVKWK region VDGVIQDTGIQESVTEQDKDSTYSLSSTLTMSSTEYL LC-FR1V3Q SHELYSCEITHKSLPSTLIKSFQRSECQRVD LC-FR1T7S LC-FR1S9P LC-FR1L10V LC-FR1N22S LC-FR3S3P LC-FR4L8I (ChimericBLCv2) 70 MAVLGLLLCLVTFPSCVLSQVQLKESGPGLVQPSQTL Chimericvariableheavy SLTCTVSGFSLTSYGVSWVRQPPGKGLEWIGTMWNDG chainofMabBandcanine DTDYHSALRSRLSISRDSSKSQVLLKMNSLQTEDTAM IgG-Bwithleadersequence YFCARSQLPGYNLRGWFVYWGQGTLVIVSASTTAPSV (CaninechimericBHCwith FPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSGS leader) LTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFT CNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPE MLGGPSVFIFPPKPKDTLLIARTPEVTCVVVDLDPED PEVQISWFVDGKQMQTAKTQPREEQFNGTYRVVSVLP IGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAH QPSVYVLPPSREELSKNIVSLICLIKDFFPPDIDVEW QSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKSR WQRGDTFICAVMHEALHNHYTQESLSHSPGK 71 MAVLGLLLCLVTFPSCVLSQVQLKESGPGLVQPSETL Chimericvariableheavy SLTCTVSGFSLTSYGVSWVRQPPGKGLEWMGTMWNDG chainofMabBv2and DTDYNSALRSKLSISRDTSKSQVFLKMNSLQTEDTAI canineIgG-Bwithleader YYCARSQLPGYNLRGWFVYWGQGTLVIVSAASTTAPS sequence VFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSG HC-FR1Q16E SLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETF HC-FR2I13M TCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAP HC-FR3H2N EMLGGPSVFIFPPKPKDTLLIARTPEVTCVVVDLDPE HC-FR3R8K DPEVQISWFVDGKQMQTAKTQPREEQFNGTYRVVSVL HC-FR3S15T PIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQA HC-FR3L21F HQPSVYVLPPSREELSKNIVSLICLIKDFFPPDIDVE HC-FR3M34I WQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKS HC-FR3F36Y RWQRGDTFICAVMHEALHNHYTQESLSHSPGK (CaninechimericBHCv2 IgG-Bwithleader) 72 METDTLLLWVLLLWVPGSTGDIVMTQTPSLLSASVGD Chimericvariablelight RVTLNCKASHNINKNLEWYQQKLGEAPKLLIYYANNL chainofMabBandcanine QTGISSRFSGSGSGTDYTLTISSLQPEDVATYYCYQY lightconstantregionwith NSGHTFGAGTKLELKRNDAQPAVYLFQPSPDQLHIGS leadersequence ASVVCLLNSFYPKDINVKWKVDGVIQDTGIQESVTEQ (CaninechimericBLC DKDSTYSLSSTLTMSSTEYLSHELYSCEITHKSLPST withleader) LIKSFQRSECQRVD 73 METDTLLLWVLLLWVPGSTGDIQMTQSPPVLSASVGD Chimericvariablelight RVTLSCKASHNINKNLEWYQQKLGEAPKLLIYYANNL chainofMabBv2and QTGIPSRFSGSGSGTDYTLTISSLQPEDVATYYCYQY caninelightconstant NSGHTFGAGTKLEIKRNDAQPAVYLFQPSPDQLHIGS regionwithleadersequence ASVVCLLNSFYPKDINVKWKVDGVIQDTGIQESVTEQ LC-FR1V3Q DKDSTYSLSSTLTMSSTEYLSHELYSCEITHKSLPST LC-FR1T7S LIKSFQRSECQRVD LC-FR1S9P LC-FR1L10V LC-FR1N22S LC-FR3S3P LC-FR4L8I (CaninechimericBLCv2 withleader) 74 QVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVSWV Chimericvariableheavy RQPPGKGLEWIGTMWNDGDTDYHSALRSRLSISRDSS chainofMabBandfeline KSQVLLKMNSLQTEDTAMYFCARSQLPGYNLRGWFVY IgG-1 WGQGTLVIVSASTTAPSVFPLAPSCGTTSGATVALAC (FelinechimericBHCIgG- LVLGYFPEPVTVSWNSGALTSGVHTFPAVLQASGLYS 1) LSSMVTVPSSRWLSDTFTCNVAHPPSNTKVDKTVRKT DHPPGPKPCDCPKCPPPEMLGGPSIFIFPPKPKDTLS ISRTPEVTCLVVDLGPDDSDVQITWFVDNTQVYTAKT SPREEQFNSTYRVVSVLPILHQDWLKGKEFKCKVNSK SLPSPIERTISKAKGQPHEPQVYVLPPAQEELSRNKV SVTCLIKSFHPPDIAVEWEITGQPEPENNYRTTPPQL DSDGTYFVYSKLSVDRSHWQRGNTYTCSVSHEALHSH HTQKSLIQSPGK 75 DIVMTQTPSLLSASVGDRVILNCKASHNINKNLEWYQ Chimericvariablelight QKLGEAPKLLIYYANNLQTGISSRFSGSGSGTDYTLT chainofMabBandfeline ISSLQPEDVATYYCYQYNSGHTFGAGTKLELKRSDAQ lightconstantregion PSVFLFQPSLDELHTGSASIVCILNDFYPKEVNVKWK (FelinechimericBLCK) VDGVVQNKGIQESTTEQNSKDSTYSLSSTLTMSSTEY QSHEKFSCEVTHKSLASTLVKSFNRSECQRE 76 DIVMTQTPSLLSASVGDRVILNCKASHNINKNLEWYQ Chimericvariablelight QKLGEAPKLLIYYANNLQTGISSRFSGSGSGTDYTLT chainofMabBandfeline ISSLQPEDVATYYCYQYNSGHTFGAGTKLELKRSDAQ lightconstantregionwithno PSVFLFQPSLDELHTGSASIVCILNDFYPKEVNVKWK N-linkedglycosylationsite VDGVVQNKGIQESTTEQNSKDSTYSLSSTLTMSSTEY (FelinechimericBLC QSHEKFSCEVTHKSLASTLVKSFQRSECQRE aglycos) 88 EVQLVESGGDLVKPGGTLRLSCTVSGFSLTSYGVSWV Caninizedvariableheavy RQSPGKGLEWIGTMWNDGDTDYHSAVKGQLSISRDTS chainofMabBv3 KSQVFLQMNSLRAEDTAMYYCARSQLPGYNLRGWFVY WGQGTLVTVSS 77 MAVLGLLLCLVTFPSCVLSEVQLVESGGDLVKPGGTL Caninizedvariableheavy RLSCTVSGFSLTSYGVSWVRQSPGKGLEWIGTMWNDG chainofMabBv3and DTDYHSAVKGQLSISRDTSKSQVFLQMNSLRAEDTAM canineIgG-Bwithleader YYCARSQLPGYNLRGWFVYWGQGTLVTVSSASTTAPS sequence VFPLAPSCGSTSGSTVALACLVSGYFPEPVTVSWNSG (CaninizedBHCv3IgG-B SLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETF withleader) TCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAP EMLGGPSVFIFPPKPKDILLIARTPEVICVVVDLDPE DPEVQISWFVDGKQMQTAKTQPREEQFNGTYRVVSVL PIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQA HQPSVYVLPPSREELSKNIVSLICLIKDFFPPDIDVE WQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKS RWQRGDTFICAVMHEALHNHYTQESLSHSPGK 78 METDTLLLWVLLLWVPGSTGEIVLTQSPASLAVSLGQ Caninizedvariablelight RATISCKASHNINKNLEWYQQKPGQPPKLLIYYANNL chainofMabBv3and QTGVPARFSGSGSGTDYSLNIHPMEEDDTAMYYCYQY caninelightconstant NSGHTFGGGTKLEIKRNDAQPAVYLFQPSPDQLHTGS regionwithleadersequence ASVVCLLNSFYPKDINVKWKVDGVIQDTGIQESVTEQ (CaninizedBLCwith DKDSTYSLSSTLTMSSTEYLSHELYSCEITHKSLPST leader) LIKSFQRSECQRVD 79 EVQLVESGGDLVKPGGTLRLSCTVSGFSLTSYGVSWV Caninizedvariableheavy RQSPGKGLEWIGTMWNDGDTDYHSAVKGQLSISRDTS chainofMabBv3and KSQVFLQMNSLRAEDTAMYYCARSQLPGYNLRGWFVY canineIgG-B WGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALA (CaninizedBHCv3IgG-B) CLVSGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLY SLSSMVTVPSSRWPSETFTCNVAHPASKTKVDKPVPK RENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKPKDTL LIARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAK TQPREEQFNGTYRVVSVLPIGHQDWLKGKQFTCKVNN KALPSPIERTISKARGQAHQPSVYVLPPSREELSKNT VSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHN HYTQESLSHSPGK 89 EIVLTQSPASLAVSLGQRATISCKASHNINKNLEWYQ Caninizedvariablelight QKPGQPPKLLIYYANNLQTGVPARFSGSGSGTDYSLN chainofMabBv3 IHPMEEDDTAMYYCYQYNSGHTFGGGTKLEIK 80 EIVLTQSPASLAVSLGQRATISCKASHNINKNLEWYQ Caninizedvariablelight QKPGQPPKLLIYYANNLQTGVPARFSGSGSGTDYSLN chainofMabBv3and IHPMEEDDTAMYYCYQYNSGHTFGGGTKLEIKRNDAQ caninelightconstant PAVYLFQPSPDQLHTGSASVVCLLNSFYPKDINVKWK region VDGVIQDTGIQESVTEQDKDSTYSLSSTLTMSSTEYL (CaninizedBLCv3) SHELYSCEITHKSLPSTLIKSFQRSECQRVD 81 GPGLVQPSQTLSLTCTVSGFSLSSYHVHWVRQPPGKG MabEvariableHC LEWLGVMWNDGDTSYNLALNSRLSISRDTSKSQVFFK MSSLQTEDTATYYCARPELPGLTYGVWFPYWGQGTLV TVS 82 ASMSISVGDRVTMNCKASQNVDSNVDWYQQKTGQSPN MabEvariableLC LLIYKASNRNTGVPDRFTGSGSGTDFTFTISNMQAED LAVYYCMQSTSYPLIFGSGTKLEIKRA 83 GPGLVQPSQTLSLTCTVSGFSLTSYGVSWVRQPPGKG MabFvariableHC LEWIGTMWNDGDTDYHSALRSRLSISRDSSKSQVLLK MNSLQTEDTAMYFCARSQLPGYNLRGWFVYWGQGTLV IVS 84 SLLSASVGDRVTLNCKASHNINKNLEWYQQKLGEAPK MabFvariableLC LLIYYANNLQTGISSRFSGSGSGTDYTLTISSLQPED VATYYCYQYNSGHTFGAGTKLELKRA 90 MWQLVSSTALLLLVSAGTQAADVPKAVVVLEPKW ExemplarycanineCD16 NRVLTMDSVTLKCQGDHLLRDNYTWLHNGRPISN withlinker,andpoly-His QISTYIIKNASIKNSGEYRCQTDQSKLSDPVQLE VHTGWLLLQVPRLVFQEGELIQLKCHSWKNTPVR NVQYFQNGRGKKFFYNNSEYHIPAATSEHNGSYF CRGIIGKKNESSEAVNIIIQGSSLPSTSLLLSHW PQGSGSHHHHHH 91 PAPEMLGGPSVFIFPPKPKDTLLIARTPEVTCVV Exemplarywild-typecanine VDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFN IgG-BFc GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSP IERTISKARGQAHQPSVYVLPPSREELSKNTVSL TCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEA LHNHYTQESLSHSPGK 92 PAPEMLGGPDVFIFPPKPKDTLLIARTPEVTCVV Exemplaryvariantcanine VDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFN IgG-BFc GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSP CD16enhancingbinding IERTISKARGQAHQPSVYVLPPSREELSKNTVSL mutant TCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ S10D LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEA LHNHYTQESLSHSPGK 93 PAPEMLGGPEVFIFPPKPKDTLLIARTPEVTCVV Exemplaryvariantcanine VDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFN IgG-BFc GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSP CD16enhancingbinding IERTISKARGQAHQPSVYVLPPSREELSKNTVSL mutant TCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ S10E LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEA LHNHYTQESLSHSPGK 94 PAPEMLGGPSVFIFPPKPKDTLLIARTPEVTCVV Exemplaryvariantcanine VDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFN IgG-BFc GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSP CD16enhancingbinding DERTISKARGQAHQPSVYVLPPSREELSKNTVSL mutant TCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ I103D LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEA LHNHYTQESLSHSPGK 95 PAPEMLGGPSVFIFPPKPKDTLLIARTPEVTCVV Exemplaryvariantcanine VDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFN IgG-BFc GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSP CD16enhancingbinding EERTISKARGQAHQPSVYVLPPSREELSKNTVSL mutant TCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ I103E LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEA LHNHYTQESLSHSPGK 96 PAPEMLGGPDVFIFPPKPKDTLLIARTPEVTCVV Exemplaryvariantcanine VDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFN IgG-BFc GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSP CD16enhancingbinding DERTISKARGQAHQPSVYVLPPSREELSKNTVSL mutant TCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ S10D LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEA I103D LHNHYTQESLSHSPGK 97 PAPEMLGGPDVFIFPPKPKDTLLIARTPEVTCVV Exemplaryvariantcanine VDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFN IgG-BFc GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSP CD16enhancingbinding EERTISKARGQAHQPSVYVLPPSREELSKNTVSL mutant TCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ S10D LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEA I103E LHNHYTQESLSHSPGK 98 PAPEMLGGPEVFIFPPKPKDTLLIARTPEVTCVV Exemplaryvariantcanine VDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFN IgG-BFc GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSP CD16enhancingbinding DERTISKARGQAHQPSVYVLPPSREELSKNTVSL mutant TCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ S10E LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEA I103D LHNHYTQESLSHSPGK 99 PAPEMLGGPEVFIFPPKPKDTLLIARTPEVTCVV Exemplaryvariantcanine VDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFN IgG-BFc GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSP CD16enhancingbinding EERTISKARGQAHQPSVYVLPPSREELSKNTVSL mutant TCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQ S10E LDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEA I103E LHNHYTQESLSHSPGK
DESCRIPTION OF CERTAIN EMBODIMENTS
(11) Antibodies that bind canine parvovirus and/or feline parvovirus are provided. Antibody heavy chains and light chains that are capable of forming antibodies that bind canine parvovirus and/or feline parvovirus are also provided. In addition, antibodies, heavy chains, and light chains comprising one or more particular complementary determining regions (CDRs) are provided. Polynucleotides encoding antibodies to canine parvovirus and/or feline parvovirus are provided. Methods of producing or purifying antibodies to canine parvovirus and/or feline parvovirus are also provided. Methods of providing passive immunity against infection with a canine or feline parvovirus and/or treatment of parvoviral infection using antibodies to canine parvovirus and/or feline parvovirus are provided.
(12) For the convenience of the reader, the following definitions of terms used herein are provided.
(13) As used herein, numerical terms such as Kd are calculated based upon scientific measurements and, thus, are subject to appropriate measurement error. In some instances, a numerical term may include numerical values that are rounded to the nearest significant figure.
(14) As used herein, a or an means at least one or one or more unless otherwise specified. As used herein, the term or means and/or unless specified otherwise. In the context of a multiple dependent claim, the use of or when referring back to other claims refers to those claims in the alternative only.
(15) Exemplary Parvovirus Antibodies
(16) Novel antibodies directed against parvovirus are provided, for example antibodies that bind to canine parvovirus and/or feline parvovirus. Parvovirus antibodies provided herein include, but are not limited to, monoclonal antibodies, chimeric antibodies, caninized antibodies, and felinized antibodies.
(17) Also provided herein are amino acid sequences of monoclonal parvovirus antibodies. For example, variable heavy chain CDRs (SEQ ID NOs: 4-6), variable light chain CDRs (SEQ ID NOs: 13-15), variable region heavy chain framework sequences (SEQ ID NOs: 7 and 8-11), and variable region light chain framework sequences (SEQ ID NOs: 16-19) for Mab A are provided. Also provided are variable heavy chain CDRs (SEQ ID NOs: 42-44), variable light chain CDRs (SEQ ID NOs: 52-54), variable region heavy chain framework sequences (SEQ ID NOs: 45, 47, 49, and 51), and variable region light chain framework sequences (SEQ ID NOs: 55, 57, 58, and 60) for Mab B. The amino acid sequences of the variable heavy chain and variable light chain of Mab A are provided (SEQ ID NOs: 20 and 22, respectively). The amino acid sequences of the variable heavy chain and variable light chain of Mab B are provided (SEQ ID NOs: 62 and 64, respectively).
(18) In addition, the amino acid sequences of the CDRs, framework sequences, variable heavy and light chains of variant Mab A and Mab B antibodies are provided. The variable heavy chain CDRs (SEQ ID NOs 4-6), variable heavy chain framework regions (SEQ ID NOs: 8-10, and 12), the variable heavy chain (SEQ ID NO: 21), the variable light chain CDRs (SEQ ID NOs: 13-15), the variable light chain framework regions (SEQ ID NOSs: 16-19), and the variable light chain (SEQ ID NO: 22) of Mab A variant 2 (v2) are provided. The variable heavy chain CDRs (SEQ ID NOs 42-44), variable heavy chain framework regions (SEQ ID NOs: 46, 48, 50, and 51), the variable heavy chain (SEQ ID NO: 63), the variable light chain CDRs (SEQ ID NOs: 52-54), the variable light chain framework regions (SEQ ID NOSs: 56, 57, 59, and 61), and the variable light chain (SEQ ID NO: 65) of Mab B variant 2 (v2) are provided.
(19) Also provided herein are chimeric canine, chimeric feline, caninized, and felinized antibodies derived from Mab A, Mab B, Mab A v2, and Mab B v2. In some embodiments, amino acid sequences of caninized and felinized Mab A, Mab B, Mab A v2, and Mab B v2 are provided, such as SEQ ID NOs: 34-41, 88, 77-80, 88, and 89. In some embodiments, amino acid sequences of chimeric antibodies derived from Mab A, Mab B, Mab A v2, and Mab B v2 are provided, such as SEQ ID NOs: 23-25, 28-33, and 66-76.
(20) The term antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (for example, bispecific (such as Bi-specific T-cell engagers) and trispecific antibodies), and antibody fragments (such as Fab, F(ab)2, ScFv, minibody, diabody, triabody, and tetrabody) so long as they exhibit the desired antigen-binding activity. Canine, feline, and equine species have different varieties (classes) of antibodies that are shared by many mammalians.
(21) The term antibody includes, but is not limited to, fragments that are capable of binding to an antigen, such as Fv, single-chain Fv (scFv), Fab, Fab, di-scFv, sdAb (single domain antibody) and (Fab)2 (including a chemically linked F(ab)2). Papain digestion of antibodies produces two identical antigen-binding fragments, called Fab fragments, each with a single antigen-binding site, and a residual Fc fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab)2 fragment that has two antigen combining sites and is still capable of cross-linking antigen. The term antibody also includes, but is not limited to, chimeric antibodies, humanized antibodies, and antibodies of various species such as mouse, human, cynomolgus monkey, canine, feline, equine, etc. Furthermore, for all antibody constructs provided herein, variants having the sequences from other organisms are also contemplated. Thus, if a murine version of an antibody is disclosed, one of skill in the art will appreciate how to transform the murine sequence based antibody into a cat, dog, horse, etc. sequence. Antibody fragments also include either orientation of single chain scFvs, tandem di-scFv, diabodies, tandem tri-sdcFv, minibodies, etc. Antibody fragments also include nanobodies (sdAb, an antibody having a single, monomeric domain, such as a pair of variable domains of heavy chains, without a light chain). An antibody fragment can be referred to as being a specific species in some embodiments (for example, mouse scFv or a canine scFv). This denotes the sequences of at least part of the non-CDR regions, rather than the source of the construct. In some embodiments, the antibodies comprise a label or are conjugated to a second moiety.
(22) The terms label and detectable label mean a moiety attached to an antibody or its analyte to render a reaction (for example, binding) between the members of the specific binding pair, detectable. The labeled member of the specific binding pair is referred to as detectably labeled. Thus, the term labeled binding protein refers to a protein with a label incorporated that provides for the identification of the binding protein. In some embodiments, the label is a detectable marker that can produce a signal that is detectable by visual or instrumental means, for example, incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (for example, streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods). Examples of labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (for example, .sup.3H, .sup.14C, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I, .sup.131I, .sup.177Lu, .sup.166Ho, or .sup.153Sm); chromogens, fluorescent labels (for example, FITC, rhodamine, lanthanide phosphors), enzymatic labels (for example, horseradish peroxidase, luciferase, alkaline phosphatase); chemiluminescent markers; biotinyl groups; predetermined polypeptide epitopes recognized by a secondary reporter (for example, leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags); and magnetic agents, such as gadolinium chelates. Representative examples of labels commonly employed for immunoassays include moieties that produce light, for example, acridinium compounds, and moieties that produce fluorescence, for example, fluorescein. In this regard, the moiety itself may not be detectably labeled but may become detectable upon reaction with yet another moiety.
(23) The term monoclonal antibody refers to an antibody of a substantially homogeneous population of antibodies, that is, the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. Thus, a sample of monoclonal antibodies can bind to the same epitope on the antigen. The modifier monoclonal indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies may be made by the hybridoma method first described by Kohler and Milstein, 1975, Nature 256:495, or may be made by recombinant DNA methods such as described in U.S. Pat. No. 4,816,567. The monoclonal antibodies may also be isolated from phage libraries generated using the techniques described in McCafferty et al., 1990, Nature 348:552-554, for example.
(24) In some embodiments, the monoclonal antibody is Mab A, Mab A v2, Mab B, or Mab B v2.
(25) Amino acid sequence, means a sequence of amino acids residues in a peptide or protein. The terms polypeptide and protein are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length. Such polymers of amino acid residues may contain natural or non-natural amino acid residues, and include, but are not limited to, peptides, oligopeptides, dimers, trimers, and multimers of amino acid residues. Both full-length proteins and fragments thereof are encompassed by the definition. The terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, phosphorylation, and the like. Furthermore, for purposes of the present disclosure, a polypeptide refers to a protein which includes modifications, such as deletions, additions, and substitutions (generally conservative in nature), to the native sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification.
(26) Parvovirus as used herein refers to any naturally occurring parvovirus or parvovirus variant, and includes canine parvovirus (CPV), such as CPV-2a, CPV-2b, and CPV-2c, and feline parvovirus (panleukopenia virus).
(27) As used herein, the term epitope refers to a site on a target molecule (for example, an antigen, such as a protein, nucleic acid, carbohydrate or lipid) to which an antigen-binding molecule (for example, an antibody, antibody fragment, or scaffold protein containing antibody binding regions) binds. Epitopes often include a chemically active surface grouping of molecules such as amino acids, polypeptides or sugar side chains and have specific three dimensional structural characteristics as well as specific charge characteristics. Epitopes can be formed both from contiguous or juxtaposed noncontiguous residues (for example, amino acids, nucleotides, sugars, lipid moiety) of the target molecule. Epitopes formed from contiguous residues (for example, amino acids, nucleotides, sugars, lipid moiety) typically are retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding typically are lost on treatment with denaturing solvents. An epitope may include but is not limited to at least 3, at least 5 or 8-10 residues (for example, amino acids or nucleotides). In some examples an epitope is less than 20 residues (for example, amino acids or nucleotides) in length, less than 15 residues or less than 12 residues. Two antibodies may bind the same epitope within an antigen if they exhibit competitive binding for the antigen. In some embodiments, an epitope can be identified by a certain minimal distance to a CDR residue on the antigen-binding molecule. In some embodiments, an epitope can be identified by the above distance, and further limited to those residues involved in a bond (for example, a hydrogen bond) between an antibody residue and an antigen residue. An epitope can be identified by various scans as well, for example an alanine or arginine scan can indicate one or more residues that the antigen-binding molecule can interact with. Unless explicitly denoted, a set of residues as an epitope does not exclude other residues from being part of the epitope for a particular antibody. Rather, the presence of such a set designates a minimal series (or set of species) of epitopes. Thus, in some embodiments, a set of residues identified as an epitope designates a minimal epitope of relevance for the antigen, rather than an exclusive list of residues for an epitope on an antigen.
(28) In some embodiments, the epitope comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, and/or SEQ ID NO: 3.
(29) The term CDR means a complementarity determining region as defined by at least one manner of identification to one of skill in the art. In some embodiments, CDRs can be defined in accordance with any of the Chothia numbering schemes, the Kabat numbering scheme, a combination of Kabat and Chothia, the AbM definition, the contact definition, or a combination of the Kabat, Chothia, AbM, or contact definitions. The various CDRs within an antibody can be designated by their appropriate number and chain type, including, without limitation as CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3. The term CDR is used herein to also encompass a hypervariable region or HVR, including hypervariable loops.
(30) In some embodiments, a parvovirus antibody comprises a heavy chain comprising (a) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 4; (b) a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 5; or (c) a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 6. In some embodiments, a parvovirus antibody comprises a light chain comprising (a) a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 13; (b) a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 14; or (c) a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 15.
(31) In some embodiments, an a parvovirus antibody comprises a heavy chain comprising (a) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 42; (b) a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 43; or (c) a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 44. In some embodiments, a parvovirus antibody comprises a light chain comprising (a) a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 52; (b) a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 53; or (c) a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 54.
(32) In some embodiments, a parvovirus antibody comprises a heavy chain comprising (a) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 4 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-H1 is substituted by a different amino acid; (b) a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 5 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-H2 is substituted by a different amino acid; and/or (c) a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 6 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-H3 is substituted by a different amino acid. In some embodiments, a parvovirus antibody comprises a light chain comprising (a) a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 13 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-L1 is substituted by a different amino acid; (b) a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 14 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-L2 is substituted by a different amino acid; and/or (c) a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 15 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-L3 is substituted by a different amino acid.
(33) In some embodiments, an a parvovirus antibody comprises a heavy chain comprising (a) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 42 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-H1 is substituted by a different amino acid; (b) a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 43 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-H2 is substituted by a different amino acid; and/or (c) a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 44 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-H3 is substituted by a different amino acid. In some embodiments, a parvovirus antibody comprises a light chain comprising (a) a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 52 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-L1 is substituted by a different amino acid; (b) a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 53 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-L2 is substituted by a different amino acid; and/or (c) a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 54 or a variant thereof wherein 1, 2, or 3 amino acids of the CDR-L3 is substituted by a different amino acid.
(34) The term variable region as used herein refers to a region comprising at least three CDRs. In some embodiments, the variable region includes the three CDRs and at least one framework region (FR). The terms heavy chain variable region or variable heavy chain are used interchangeably to refer to a region comprising at least three heavy chain CDRs. The terms light chain variable region or variable light chain are used interchangeably to refer to a region comprising at least three light chain CDRs. In some embodiments, the variable heavy chain or variable light chain comprises at least one framework region. In some embodiments, an antibody comprises at least one heavy chain framework region selected from HC-FR1, HC-FR2, HC-FR3, and HC-FR4. In some embodiments, an antibody comprises at least one light chain framework region selected from LC-FR1, LC-FR2, LC-FR3, and LC-FR4. The framework regions may be juxtaposed between light chain CDRs or between heavy chain CDRs. For example, an antibody may comprise a variable heavy chain having the following structure: (HC-FR1)-(CDR-H1)-(HC-FR2)-(CDR-H2)-(HC-FR3)-(CDR-H3)-(HC-FR4). An antibody may comprise a variable heavy chain having the following structure: (CDR-H1)-(HC-FR2)-(CDR-H2)-(HC-FR3)-(CDR-H3). An antibody may also comprise a variable light chain having the following structure: (LC-FR1)-(CDR-L1)-(LC-FR2)-(CDR-L2)-(LC-FR3)-(CDR-L3)-(LC-FR4). An antibody may also comprise a variable light chain having the following structure: (CDR-L1)-(LC-FR2)-(CDR-L2)-(LC-FR3)-(CDR-L3).
(35) In some embodiments, a parvovirus antibody comprises one or more of (a) a variable region heavy chain framework 1 (HC-FR1) sequence of SEQ ID NO: 7 or SEQ ID NO: 8, (b) a HC-FR2 sequence of SEQ ID NO: 9, (c) a HC-FR3 sequence of SEQ ID NO: 10, (d) a HC-FR4 sequence of SEQ ID NO: 11 or SEQ ID NO: 12, (e) a variable region light chain framework 1 (LC-FR1) sequence of SEQ ID NO: 16, (f) an LC-FR2 sequence of SEQ ID NO: 17, (g) an LC-FR3 sequence of SEQ ID NO: 18, or (h) an LC-FR4 sequence of SEQ ID NO: 19.
(36) In some embodiments, a parvovirus antibody comprises one or more of (a) a variable region heavy chain framework 1 (HC-FR1) sequence of SEQ ID NO: 45 or SEQ ID NO: 46, (b) a HC-FR2 sequence of SEQ ID NO: 47 or SEQ ID NO: 48, (c) a HC-FR3 sequence of SEQ ID NO: 49 or SEQ ID NO: 50, (d) a HC-FR4 sequence of SEQ ID NO: 51, (e) a variable region light chain framework 1 (LC-FR1) sequence of SEQ ID NO: 55 or SEQ ID NO: 56, (f) an LC-FR2 sequence of SEQ ID NO: 57, (g) an LC-FR3 sequence of SEQ ID NO: 58 or SEQ ID NO: 59, or (h) an LC-FR4 sequence of SEQ ID NO: 60.
(37) In some embodiments, a parvovirus antibody comprises a variable light chain sequence of SEQ ID NO: 22, SEQ ID NO: 87, SEQ ID NO: 41, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 89, SEQ ID NO: 82, or SEQ ID NO: 84. In some embodiments, a parvovirus antibody comprises a variable heavy chain sequence of SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 40, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 88, SEQ ID NO: 81, or SEQ ID NO: 83.
(38) In some embodiments, a parvovirus antibody comprises a variable heavy chain sequence of SEQ ID NO: 20 and a variable light chain sequence of SEQ ID NO: 22. In some embodiments, a parvovirus antibody comprises a variable heavy chain sequence of SEQ ID NO: 21 and a variable light chain sequence of SEQ ID NO: 22. In some embodiments, a parvovirus antibody comprises a variable heavy chain sequence of SEQ ID NO: 85 and a variable light chain sequence of SEQ ID NO: 87. In some embodiments, a parvovirus antibody comprises a variable heavy chain sequence of SEQ ID NO: 86 and a variable light chain sequence of SEQ ID NO: 87. In some embodiments, a parvovirus antibody comprises a variable heavy chain sequence of SEQ ID NO: 40 and a variable light chain sequence of SEQ ID NO: 41. In some embodiments, a parvovirus antibody comprises a variable heavy chain sequence of SEQ ID NO: 62 and a variable light chain sequence of SEQ ID NO: 64 or SEQ ID NO: 65. In some embodiments, a parvovirus antibody comprises a variable heavy chain sequence of SEQ ID NO: 63 and a variable light chain sequence of SEQ ID NO: 64 or SEQ ID NO: 65. In some embodiments, a parvovirus antibody comprises a variable heavy chain sequence of SEQ ID NO: 88 and a variable light chain sequence of SEQ ID NO: 89.
(39) The term constant region as used herein refers to a region comprising at least three constant domains. The terms heavy chain constant region or constant heavy chain are used interchangeably to refer to a region comprising at least three heavy chain constant domains, CH1, CH2, and CH3. Nonlimiting exemplary heavy chain constant regions include , , , , and . Each heavy chain constant region corresponds to an antibody isotype. For example, an antibody comprising a constant region is an IgG antibody, an antibody comprising a constant region is an IgD antibody, an antibody comprising an constant region is an IgA antibody, an antibody comprising a constant region is an IgM antibody, and an antibody comprising an constant region is an IgE antibody. Certain isotypes can be further subdivided into subclasses. For example, IgG antibodies include, but are not limited to, IgG1 (comprising a .sub.1 constant region), IgG2 (comprising a .sub.2 constant region), IgG3 (comprising a .sub.3 constant region), and IgG4 (comprising a .sub.4 constant region) antibodies; IgA antibodies include, but are not limited to, IgA1 (comprising an .sub.1 constant region) and IgA2 (comprising an .sub.2 constant region) antibodies; and IgM antibodies include, but are not limited to IgM1 and IgM2. The terms light chain constant region or constant light chain are used interchangeably to refer to a region comprising a light chain constant domain, CL. Nonlimiting exemplary light chain constant regions include and . Non-function-altering deletions and alterations within the domains are encompassed within the scope of the term constant region unless designated otherwise. Canine and feline have antibody classes such as IgG, IgA, IgD, IgE, and IgM. Within the canine IgG antibody class are IgG-A, IgG-B, IgG-C, and IgG-D. Within the feline IgG antibody class are IgG1, IgG2a, and IgG2b.
(40) The term chimeric antibody or chimeric refers to an antibody in which a portion of the heavy chain or light chain is derived from a particular source or species, while at least a part of the remainder of the heavy chain or light chain is derived from a different source or species. In some embodiments, a chimeric antibody refers to an antibody comprising at least one variable region from a first species (such as mouse, rat, cynomolgus monkey, etc.) and at least one constant region from a second species (such as human, dog, cat, equine, etc.). In some embodiments, a chimeric antibody comprises at least one mouse variable region and at least one canine constant region. In some embodiments, a chimeric antibody comprises at least one mouse variable region and at least one feline constant region. In some embodiments, all of the variable regions of a chimeric antibody are from a first species and all of the constant regions of the chimeric antibody are from a second species. In some embodiments, a chimeric antibody comprises a constant heavy chain region or constant light chain region from a companion animal. In some embodiments, a chimeric antibody comprises a mouse variable heavy and light chains and a companion animal constant heavy and light chains. For example, a chimeric antibody may comprise a mouse variable heavy and light chains and a canine constant heavy and light chains; a chimeric antibody may comprise a mouse variable heavy and light chains and a feline constant heavy and light chains; or a chimeric antibody may comprise a mouse variable heavy and light chains and an equine constant heavy and light chains.
(41) In some embodiments, a parvovirus antibody comprises a chimeric antibody comprising: (a) (i) a heavy chain amino acid sequence of SEQ ID NO: 23; (ii) a light chain amino acid sequence of SEQ ID NO: 25; or (iii) a heavy chain amino acid sequence as in (i) and a light chain sequence as in (ii); (b) (i) a heavy chain amino acid sequence of SEQ ID NO: 24; (ii) a light chain amino acid sequence of SEQ ID NO: 25; or (iii) a heavy chain amino acid sequence as in (i) and a light chain sequence as in (ii); (c) (i) a heavy chain amino acid sequence of SEQ ID NO: 31; (ii) a light chain amino acid sequence of SEQ ID NO: 32; or (iii) a heavy chain amino acid sequence as in (i) and a light chain sequence as in (ii); (d) (i) a heavy chain amino acid sequence of SEQ ID NO: 31; (ii) a light chain amino acid sequence of SEQ ID NO: 33; or (iii) a heavy chain amino acid sequence as in (i) and a light chain sequence as in (ii); (e) (i) a heavy chain amino acid sequence of SEQ ID NO: 66; (ii) a light chain amino acid sequence of SEQ ID NO: 68; or (iii) a heavy chain amino acid sequence as in (i) and a light chain sequence as in (ii); (f) (i) a heavy chain amino acid sequence of SEQ ID NO: 67; (ii) a light chain amino acid sequence of SEQ ID NO: 69; or (iii) a heavy chain amino acid sequence as in (i) and a light chain sequence as in (ii); (g) (i) a heavy chain amino acid sequence of SEQ ID NO: 74; (ii) a light chain amino acid sequence of SEQ ID NO: 75; or (iii) a heavy chain amino acid sequence as in (i) and a light chain sequence as in (ii); or (h) (i) a heavy chain amino acid sequence of SEQ ID NO: 74; (ii) a light chain amino acid sequence of SEQ ID NO: 75; or (iii) a heavy chain amino acid sequence as in (i) and a light chain sequence as in (ii).
(42) A canine chimeric, chimeric canine, or canine chimeric antibody refers to a chimeric antibody having at least a portion of a heavy chain or a portion of a light chain derived from a dog. A feline chimeric, chimeric feline, or feline chimeric antibody refers to a chimeric antibody having at least a portion of a heavy chain or a portion of a light chain derived from a cat. In some embodiments, a canine chimeric antibody comprises a mouse or rat variable heavy and light chains and a canine constant heavy and light chains. In some embodiments, a feline chimeric antibody comprises a mouse or rat variable heavy and light chains and a feline constant heavy and light chains.
(43) In some embodiments, a parvovirus antibody comprises a canine heavy chain constant region selected from an IgG-A, IgG-B, IgG-C, and IgG-D constant region.
(44) In some embodiments, a parvovirus antibody comprises a feline heavy chain constant region selected from an IgG1, IgG2a, and IgG2b constant region.
(45) A caninized antibody means an antibody in which at least one amino acid in a portion of a non-canine variable region has been replaced with the corresponding amino acid from a canine variable region. In some embodiments, a caninized antibody comprises at least one canine constant region (e.g., a constant region, an constant region, a constant region, an constant region, a constant region, or etc.) or fragment thereof. In some embodiments, a caninized antibody is an antibody fragment, such as Fab, scFv, (Fab).sub.2, etc. The term caninized also denotes forms of non-canine (for example, murine) antibodies that are chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab, F(ab).sub.2 or other antigen-binding sequences of antibodies) that contain minimal sequence of non-canine immunoglobulin. Caninized antibodies can include canine immunoglobulins (recipient antibody) in which residues from a CDR of the recipient are substituted by residues from a CDR of a non-canine species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity. In some instances, Fv framework region (FR) residues of the canine immunoglobulin are replaced by corresponding non-canine residues. Furthermore, the caninized antibody can comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance.
(46) In some embodiments, at least one amino acid residue in a portion of a rat or a mouse variable heavy chain or a rat or a mouse variable light chain has been replaced with the corresponding amino acid from a canine variable region. In some embodiments, the modified chain is fused to a canine constant heavy chain or a canine constant light chain.
(47) A felinized antibody means an antibody in which at least one amino acid in a portion of a non-feline variable region has been replaced with the corresponding amino acid from a feline variable region. In some embodiments, a felinized antibody comprises at least one feline constant region (e.g., a constant region, an constant region, a constant region, an constant region, a constant region, or etc.) or fragment thereof. In some embodiments, a felinized antibody is an antibody fragment, such as Fab, scFv, (Fab).sub.2, etc. The term felinized also denotes forms of non-feline (for example, murine) antibodies that are chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab, F(ab).sub.2 or other antigen-binding sequences of antibodies) that contain minimal sequence of non-feline immunoglobulin. Felinized antibodies can include feline immunoglobulins (recipient antibody) in which residues from a CDR of the recipient are substituted by residues from a CDR of a non-feline species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity. In some instances, Fv framework region (FR) residues of the feline immunoglobulin are replaced by corresponding non-feline residues. Furthermore, the felinized antibody can comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance.
(48) In some embodiments, at least one amino acid residue in a portion of a mouse variable heavy chain or a mouse variable light chain has been replaced with the corresponding amino acid from a feline variable region. In some embodiments, the modified chain is fused to a feline constant heavy chain or a canine constant light chain.
(49) A fragment crystallizable polypeptide or Fe polypeptide is the portion of an antibody molecule that interacts with effector molecules and cells. It comprises the C-terminal portions of the immunoglobulin heavy chains. As used herein, an Fc polypeptide includes fragments of the Fc domain having one or more biological activities of an entire Fc polypeptide. An effector function of the Fc polypeptide is an action or activity performed in whole or in part by any antibody in response to a stimulus and may include complement fixation and/or ADCC (antibody-dependent cellular cytotoxicity) induction and/or ADCP (antibody-dependent cellular phagocytosis).
(50) In some embodiments, a biological activity of an Fc polypeptide is the ability to bind FcRn. In some embodiments, a biological activity of an Fc polypeptide is the ability to bind C1q. In some embodiments, a biological activity of an Fc polypeptide is the ability to bind CD16. In some embodiments, a biological activity of an Fc polypeptide is the ability to bind protein A.
(51) The term IgX Fe means the Fc region is derived from a particular antibody isotype (e.g., IgG, IgA, IgD, IgE, IgM, etc.), where X denotes the antibody isotype. Thus, IgG Fc denotes the Fc region of a chain, IgA Fc denotes the Fc region of an chain, IgD Fc denotes the Fc region of a chain, IgE Fc denotes the Fc region of an chain, IgM Fc denotes the Fc region of a chain, etc. In some embodiments, the IgG Fc region comprises CH1, hinge, CH2, CH3, and CL1. IgX-N-Fc denotes that the Fc region is derived from a particular subclass of antibody isotype (such as canine IgG subclass A, B, C, or D; or feline IgG subclass 1, 2a, or 2b), where N denotes the subclass. In some embodiments, IgX Fc or IgX-N-Fc regions are derived from a companion animal, such as a dog or a cat. In some embodiments, IgG Fc regions are isolated from canine heavy chains, such as IgG-A, IgG-B, IgG-C, or IgG-D. In some instances, IgG Fc regions are isolated from feline heavy chains, such as IgG1, IgG2a, or IgG2b. Antibodies comprising an Fc region of IgG-A, IgG-B, IgG-C, or IgG-D may provide for higher expression levels in recombination production systems.
(52) The terms IgX Fe and IgX Fc polypeptide include wild-type IgX Fc polypeptides and variant IgX Fc polypeptides, unless indicated otherwise.
(53) In some embodiments, a variant IgG Fc polypeptide comprises a variant IgG Fc polypeptide of a companion animal species. In some embodiments, a variant IgG Fc polypeptide comprises a variant canine IgG Fc polypeptide or a feline IgG Fc polypeptide. In some embodiments, a variant IgG Fc polypeptide (e.g., a variant canine IgG-A Fc polypeptide, a variant canine IgG-C Fc polypeptide, or a variant canine IgG-D Fc polypeptide, variant feline IgG1a Fc polypeptide, variant feline IgG1b Fc polypeptide, or variant feline IgG2 Fc polypeptide) has an activity that the reference (e.g., wild-type) polypeptide substantially lacks.
(54) An antibody may be modified to extend or shorten its half-life. In some embodiments involving a higher dose of antibody, a shorter half-life may be desirable for acute treatment. In some embodiments involving a lower dose of antibody, a longer half-life may be desirable for prolonged treatment. For example, as discussed below, mutations in IgG Fc that affect FcRn interactions may be introduced.
(55) In some embodiments, a parvovirus antibody comprises a wild-type or variant IgG Fc having complement fixation activity (or complement-dependent cytotoxicity (CDC)). In some embodiments, a parvovirus antibody comprises a wild-type or variant IgG Fc having antibody-dependent cellular cytotoxicity (ADCC) activity. In some embodiments, a parvovirus antibody comprises a wild-type or variant IgG Fc having antibody-dependent cellular phagocytosis (ADCP) activity. In some embodiments, a parvovirus antibody comprises a wild-type or variant IgG Fc having complement fixation activity and/or ADCC activity and/or ADCP activity. IgG Fc polypeptides may be modified to have an effector function or to have an enhanced effector function.
(56) In some embodiments, a parvovirus antibody comprises a wild-type or variant IgG Fc the binds to canine FcRn at low pH. In some embodiments, a parvovirus comprises a wild-type or variant IgG Fc that binds to C1q. In some embodiments, a parvovirus comprises a wild-type or variant IgG Fc that binds to CD16. In some embodiments, a parvovirus comprises a variant IgG Fc comprising one or more afucosylated glycan.
(57) In some embodiments, a variant IgG Fc (e.g., a variant canine IgG Fc polypeptide or a variant feline IgG Fc polypeptide) has modified FcRn binding affinity compared to a reference polypeptide. In some embodiments, a variant IgG Fc has increased FcRn binding affinity at an acidic pH (e.g., at a pH in the range of from about 5.0 to about 6.5, such as at a pH of about 5.0, a pH of about 5.5, a pH of about 6.0, or a pH of about 6.5) compared to a reference polypeptide. Exemplary variant IgG Fc polypeptides having increased FcRn binding affinity are disclosed in WO 2020/082048, which is incorporated by reference herein in its entirety.
(58) In some embodiments, a variant IgG Fc (e.g., a variant canine IgG Fc polypeptide or a variant feline IgG Fc polypeptide) has modified C1q binding affinity compared to a reference polypeptide. In some embodiments, a variant IgG Fc has increased C1q binding affinity compared to a reference polypeptide. Exemplary variant IgG Fc polypeptides having increased C1q binding affinity are disclosed in WO 2020/139984 (e.g., Example 2), which is incorporated by reference herein in its entirety.
(59) In some embodiments, a variant IgG Fc (e.g., a variant canine IgG Fc polypeptide or a variant feline IgG Fc polypeptide) has modified CD16 binding affinity compared to a reference polypeptide. In some embodiments, a variant IgG Fc has increased CD16 binding affinity compared to a reference polypeptide. Exemplary variant IgG Fc polypeptides having increased CD16 binding affinity are disclosed in WO 2020/139984 (e.g., Example 2), which is incorporated by reference herein in its entirety.
(60) In some embodiments, a variant canine IgG Fc has enhanced CD16 binding affinity compared to a reference polypeptide. In some embodiments a variant IgG Fc comprises a) an aspartic acid or a glutamic acid at a position corresponding to position 10 of SEQ ID NO: 91; b) an aspartic acid or a glutamic acid at position 10 of SEQ ID NO: 91; c) an aspartic acid or a glutamic acid at a position corresponding to position 103 of SEQ ID NO: 91; d) an aspartic acid or a glutamic acid at position 103 of SEQ ID NO: 91; e) an aspartic acid or a glutamic acid at a position corresponding to position 10 and/or position 103 of SEQ ID NO: 91; f) an aspartic acid or a glutamic acid at position 10 and/or position 103 of SEQ ID NO: 91. In some embodiments a variant IgG Fc comprises the amino acid sequence of SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, or SEQ ID NO: 99.
(61) In some embodiments, a variant IgG Fc (e.g., a variant canine IgG Fc polypeptide or a variant feline IgG Fc polypeptide) has modified Protein A binding affinity compared to a reference polypeptide. In some embodiments, a variant IgG Fc has increased Protein A binding affinity compared to a reference polypeptide. Exemplary variant IgG Fc polypeptides having increased Protein A binding affinity are disclosed in WO 2020/139984 (e.g., Example 2), which is incorporated by reference herein in its entirety.
(62) The term affinity means the strength of the sum total of noncovalent interactions between a single binding site of a molecule (for example, an antibody) and its binding partner (for example, an antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K.sub.D). Affinity can be measured by common methods known in the art, such as, for example, immunoblot, ELISA KD, KinEx A, biolayer interferometry (BLI), or surface plasmon resonance devices.
(63) The terms K.sub.D, K.sub.d, Kd or Kd value as used interchangeably to refer to the equilibrium dissociation constant of an antibody-antigen interaction. In some embodiments, the K.sub.d of the antibody is measured by using biolayer interferometry assays using a biosensor, such as an Octet System (Pall ForteBio LLC, Fremont, CA) according to the supplier's instructions. Briefly, biotinylated antigen is bound to the sensor tip and the association of antibody is monitored for ninety seconds and the dissociation is monitored for 600 seconds. The buffer for dilutions and binding steps is 20 mM phosphate, 150 mM NaCl, pH 7.2. A buffer only blank curve is subtracted to correct for any drift. The data are fit to a 2:1 binding model using ForteBio data analysis software to determine association rate constant (k.sub.on), dissociation rate constant (k.sub.off), and the K.sub.d. The equilibrium dissociation constant (K.sub.d) is calculated as the ratio of k.sub.off/k.sub.on. The term k.sub.on refers to the rate constant for association of an antibody to an antigen and the term k.sub.off refers to the rate constant for dissociation of an antibody from the antibody/antigen complex.
(64) The term binds to an antigen or epitope is a term that is well understood in the art, and methods to determine such binding are also well known in the art. A molecule is said to exhibit binding if it reacts, associates with, or has affinity for a particular cell or substance and the reaction, association, or affinity is detectable by one or more methods known in the art, such as, for example, immunoblot, ELISA KD, KinEx A, biolayer interferometry (BLI), surface plasmon resonance devices, or etc.
(65) Surface plasmon resonance denotes an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIAcore system (BIAcore International AB, a GE Healthcare company, Uppsala, Sweden and Piscataway, N.J.). For further descriptions, see Jonsson et al. (1993) Ann. Biol. Clin. 51: 19-26.
(66) Biolayer interferometry refers to an optical analytical technique that analyzes the interference pattern of light reflected from a layer of immobilized protein on a biosensor tip and an internal reference layer. Changes in the number of molecules bound to the biosensor tip cause shifts in the interference pattern that can be measured in real-time. A nonlimiting exemplary device for biolayer interferometry is an Octet system (Pall ForteBio LLC). See, e.g., Abdiche et al., 2008, Anal. Biochem. 377: 209-277.
(67) In some embodiments, a parvovirus antibody binds to a canine parvovirus or a feline parvovirus with a dissociation constant (Kd) of less than 510.sup.6 M, less than 110.sup.6 M, less than 510.sup.7 M, less than 110.sup.7 M, less than 510.sup.8M, less than 110.sup.8M, less than 510.sup.9M, less than 110.sup.9M, less than 510.sup.10 M, less than 110.sup.10 M, less than 510.sup.11M, less than 110.sup.11 M, less than 510.sup.12 M, or less than 110.sup.12 M, as measured by biolayer interferometry. In some embodiments, a parvovirus antibody binds to a canine parvovirus or a feline parvovirus with a Kd of between 510.sup.6 M and 110.sup.6 M, between 510.sup.6 M and 510.sup.7 M, between 510.sup.6 M and 110.sup.7 M, between 510.sup.6 M and 510.sup.8M, 510.sup.6 M and 110.sup.8 M, between 510.sup.6 M and 510.sup.9 M, between 510.sup.6 M and 110.sup.9 M, between 510.sup.6 M and 510.sup.10 M, between 510.sup.6 M and 110.sup.10 M, between 510.sup.6 M and 510.sup.11M, between 510.sup.6 M and 110.sup.11M, between 510.sup.6M and 510.sup.12M, between 510.sup.6M and 110.sup.12M, between 110.sup.6 M and 510.sup.7 M, between 110.sup.6 M and 110.sup.7 M, between 110.sup.6M and 510.sup.8M, 110.sup.6M and 110.sup.8M, between 110.sup.6 M and 510.sup.9M, between 110.sup.7 M and 110.sup.9M, between 110.sup.7 M and 510.sup.10 M, between 110.sup.7 M and 110.sup.10 M, between 110.sup.6M and 510.sup.11M, between 110.sup.6 M and 110.sup.11 M, between 110.sup.6M and 510.sup.12M, between 110.sup.6M and 110.sup.12M, between 510.sup.7M and 110.sup.7M, between 510.sup.7M and 510.sup.8M, 510.sup.7M and 110.sup.8M, between 510.sup.7M and 510.sup.9M, between 510.sup.7M and 110.sup.9M, between 510.sup.7M and 510.sup.10 M, between 510.sup.7 M and 110.sup.10 M, between 510.sup.7M and 510.sup.11M, between 510.sup.7 M and 110.sup.11 M, between 510.sup.7M and 510.sup.12M, between 510.sup.7 M and 110.sup.12M, between 110.sup.7 M and 510.sup.8M, 110.sup.7 M and 110.sup.8 M, between 110.sup.7 M and 510.sup.9 M, between 110.sup.7 M and 110.sup.9 M, between 110.sup.7M and 510.sup.10 M, between 110.sup.7M and 110.sup.10 M, between 110.sup.7M and 510.sup.11 M, between 110.sup.7 M and 110.sup.11M, between 110.sup.7M and 510.sup.12 M, between 110.sup.7M and 110.sup.12M, between 510.sup.8M and 110.sup.8M, between 510.sup.8M and 510.sup.9M, between 510.sup.8 M and 110.sup.9M, between 510.sup.8 M and 510.sup.10 M, between 510.sup.8 M and 110.sup.10 M, between 510.sup.8 M and 510.sup.11M, between 510.sup.8M and 110.sup.11 M, between 510.sup.8M and 510.sup.12M, between 510.sup.8M and 110.sup.12M, 110.sup.8M and 510.sup.9M, between 110.sup.8M and 110.sup.9M, between 110.sup.8M and 510.sup.10 M, between 110.sup.8 M and 110.sup.10 M, between 110.sup.8M and 510.sup.11M, between 110.sup.8 M and 110.sup.11 M, between 110.sup.8M and 510.sup.12M, between 110.sup.8M and 110.sup.12M, between 510.sup.9M and 110.sup.9M, between 510.sup.9M and 510.sup.10 between 510.sup.9M and 110.sup.10 M, between 510.sup.9M and 510.sup.11 M, M, between 510.sup.9M and 110.sup.11M, between 510.sup.9 M and 510.sup.12 M, between 510.sup.9M and 110.sup.12M, between 110.sup.9M and 510.sup.10 M, between 110.sup.9M and 110.sup.10 M, between 110.sup.9M and 510.sup.11M, between 110.sup.9M and 110.sup.11M, between 110.sup.9M and 510.sup.12 M, between 110.sup.9 M and 110.sup.12 M, between 510.sup.10 M and 110.sup.10 M, between 510.sup.10 M and 510.sup.11M, between, 110.sup.10 M and 510.sup.11M, 110.sup.10 M and 110.sup.11M, between 110.sup.10 M and 510.sup.12 M, between 110.sup.10 M and 110.sup.12M, between 510.sup.11M and 110.sup.12 M, between 510.sup.11 M and 510.sup.12M, between 510.sup.11 M and 110.sup.12 M, between 110.sup.11 M and 510.sup.12 M, or between 110.sup.11 M and 110.sup.12 M, as measured by biolayer interferometry. In some embodiments, a parvovirus antibody binds to a canine parvovirus or a feline parvovirus, as determined by immunoblot analysis.
(68) Wild-type refers to a non-mutated version of a polypeptide that occurs in nature, or a fragment thereof. A wild-type polypeptide may be produced recombinantly.
(69) A variant means a biologically active polypeptide having at least about 50% amino acid sequence identity with the native sequence polypeptide after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Such variants include, for instance, polypeptides wherein one or more amino acid residues are added, deleted, at the N- or C-terminus of the polypeptide.
(70) In some embodiments, a variant has at least 1, 2, 3, 4, or 5 amino acids substituted by a different amino acid.
(71) In some embodiments, a variant has at least about 50% sequence identity with the reference nucleic acid molecule or polypeptide after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Such variants include, for instance, polypeptides wherein one or more amino acid residues are added, deleted, at the N- or C-terminus of the polypeptide. In some embodiments, a variant has at least about 50% sequence identity, at least about 60% sequence identity, at least about 65% sequence identity, at least about 70% sequence identity, at least about 75% sequence identity, at least about 80% sequence identity, at least about 85% sequence identity, at least about 90% sequence identity, at least about 95% sequence identity, at least about 97% sequence identity, at least about 98% sequence identity, or at least about 99% sequence identity with the sequence of the reference nucleic acid or polypeptide.
(72) As used herein, position corresponding to position n, wherein n is any number, refers to an amino acid position of a subject polypeptide that aligns with position n of a reference polypeptide after aligning the amino acid sequences of the subject and reference polypeptides and introducing gaps. Alignment for purposes of whether a position of a subject polypeptide corresponds with position n of a reference polypeptide can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, CLUSTAL OMEGA, ALIGN, or MEGALIGN (DNASTAR) software. Those skilled in the art can determine appropriate parameters for alignment, including any parameters needed to achieve maximal alignment over the full length of two sequences being compared. In some embodiments, the subject polypeptide and the reference polypeptide are of different lengths.
(73) A point mutation is a mutation that involves a single amino acid residue. The mutation may be the loss of an amino acid, substitution of one amino acid residue for another, or the insertion of an additional amino acid residue.
(74) An amino acid substitution refers to the replacement of one amino acid in a polypeptide with another amino acid. In some embodiments, an amino acid substitution is a conservative substitution. Nonlimiting exemplary conservative amino acid substitutions are shown in Table 2. Amino acid substitutions may be introduced into a molecule of interest and the products screened for a desired activity, for example, retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC or enhanced pharmacokinetics.
(75) TABLE-US-00002 TABLE 2 Original Residue Exemplary Substitutions Ala (A) Val; Leu; Ile Arg (R) Lys; Gln; Asn Asn (N) Gln; His; Asp; Lys; Arg Asp (D) Glu; Asn Cys (C) Ser; Ala Gln (Q) Asn; Glu Glu (E) Asp; Gln Gly (G) Ala His (H) Asn; Gln; Lys; Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Lys (K) Arg; Gln; Asn Met (M) Leu; Phe; Ile Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Pro (P) Ala Ser (S) Thr Thr (T) Val; Ser Trp (W) Tyr; Phe Tyr (Y) Trp; Phe; Thr; Ser Val (V) Ile; Leu; Met; Phe; Ala; Norleucine
(76) Amino acids may be grouped according to common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe.
(77) Non-conservative substitutions will entail exchanging a member of one of these classes with another class.
(78) The term vector is used to describe a polynucleotide that can be engineered to contain a cloned polynucleotide or polynucleotides that can be propagated in a host cell. A vector can include one or more of the following elements: an origin of replication, one or more regulatory sequences (such as, for example, promoters or enhancers) that regulate the expression of the polypeptide of interest, or one or more selectable marker genes (such as, for example, antibiotic resistance genes and genes that can be used in colorimetric assays, for example, -galactosidase). The term expression vector refers to a vector that is used to express a polypeptide of interest in a host cell.
(79) A host cell refers to a cell that may be or has been a recipient of a vector or isolated polynucleotide. Host cells may be prokaryotic cells or eukaryotic cells. Exemplary eukaryotic cells include mammalian cells, such as primate or non-primate animal cells; fungal cells, such as yeast; plant cells; and insect cells. Nonlimiting exemplary mammalian cells include, but are not limited to, NSO cells, PER.C6 cells (Crucell), 293 cells, and CHO cells, and their derivatives, such as 293-6E, DG44, CHO-S, and CHO-K cells. Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation. A host cell includes cells transfected in vivo with a polynucleotide(s) encoding an amino acid sequence(s) provided herein.
(80) The term isolated as used herein refers to a molecule that has been separated from at least some of the components with which it is typically found in nature or produced. For example, a polypeptide is referred to as isolated when it is separated from at least some of the components of the cell in which it was produced. Where a polypeptide is secreted by a cell after expression, physically separating the supernatant containing the polypeptide from the cell that produced it is considered to be isolating the polypeptide. Similarly, a polynucleotide is referred to as isolated when it is not part of the larger polynucleotide (such as, for example, genomic DNA or mitochondrial DNA, in the case of a DNA polynucleotide) in which it is typically found in nature, or is separated from at least some of the components of the cell in which it was produced, for example, in the case of an RNA polynucleotide. Thus, a DNA polynucleotide that is contained in a vector inside a host cell may be referred to as isolated. In some embodiments, the parvovirus antibody is purified using chromatography, such as size exclusion chromatography, ion exchange chromatography, protein A column chromatography, hydrophobic interaction chromatography, and CHT chromatography.
(81) To reduce or inhibit means to decrease, reduce, or arrest an activity, function, or amount as compared to a reference. In some embodiments, by reduce or inhibit is meant the ability to cause an overall decrease of 20% or greater. In some embodiments, by reduce or inhibit is meant the ability to cause an overall decrease of 50% or greater. In some embodiments, by reduce or inhibit is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater. In some embodiments, the amount noted above is inhibited or decreased over a period of time, relative to a control dose (such as a placebo) over the same period of time. A reference as used herein, refers to any sample, standard, or level that is used for comparison purposes. A reference may be obtained from a healthy or non-diseased sample. In some examples, a reference is obtained from a non-diseased or non-treated sample of a companion animal. In some examples, a reference is obtained from one or more healthy animals of a particular species, which are not the animal being tested or treated.
(82) The term substantially reduced, as used herein, denotes a sufficiently high degree of reduction between a numeric value and a reference numeric value such that one of skill in the art would consider the difference between the two values to be of statistical significance within the context of the biological characteristic measured by said values. In some embodiments, the substantially reduced numeric values is reduced by greater than about any one of 10%, 15% 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100% compared to the reference value.
(83) In some embodiments, an parvovirus antibody may reduce parvovirus titers in a canine or a feline by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% compared to parvovirus titers in the absence of the antibody, as measured by a Hemagglutination Inhibition (HI) assay or Virus Neutralization (VN) assay. In some embodiments, the reduction in parvovirus titer is between 10% and 15%, between 10% and 20%, between 10% and 25%, between 10% and 30%, between 10% and 35%, between 10% and 40%, between 10% and 45%, between 10% and 50%, between 10% and 60%, between 10% and 70%, between 10% and 80%, between 10% and 90%, between 10% and 100%, between 15% and 20%, between 15% and 25%, between 15% and 30%, between 15% and 35%, between 15% and 40%, between 15% and 45%, between 15% and 50%, between 15% and 60%, between 15% and 70%, between 15% and 80%, between 15% and 90%, between 15% and 100%, between 20% and 25%, between 20% and 30%, between 20% and 35%, between 20% and 40%, between 20% and 45%, between 20% and 50%, between 20% and 60%, between 20% and 70%, between 20% and 80%, between 20% and 90%, between 20% and 100%, between 25% and 30%, between 25% and 35%, between 25% and 40%, between 25% and 45%, between 25% and 50%, between 25% and 60%, between 25% and 70%, between 25% and 80%, between 25% and 90%, between 25% and 100%, between 30% and 35%, between 30% and 40%, between 30% and 45%, between 30% and 50%, between 30% and 60%, between 30% and 70%, between 30% and 80%, between 30% and 90%, between 30% and 100%, between 35% and 40%, between 35% and 45%, between 35% and 50%, between 35% and 60%, between 35% and 70%, between 35% and 80%, between 35% and 90%, between 35% and 100%, between 40% and 45%, between 40% and 50%, between 40% and 60%, between 40% and 70%, between 40% and 80%, between 40% and 90%, between 40% and 100%, between 45% and 50%, between 45% and 60%, between 45% and 70%, between 45% and 80%, between 45% and 90%, between 45% and 100%, between 50% and 60%, between 50% and 70%, between 50% and 80%, between 50% and 90%, between 50% and 100%, between 60% and 70%, between 60% and 80%, between 60% and 90%, between 60% and 100%, between 70% and 80%, between 70% and 90%, between 70% and 100%, between 80% and 90%, between 80% and 100%, or between 90% and 100%.
(84) Exemplary Pharmaceutical Compositions
(85) The terms pharmaceutical formulation and pharmaceutical composition refer to a preparation which is in such form as to permit the biological activity of the active ingredient(s) to be effective, and which contains no additional components that are unacceptably toxic to a subject to which the formulation would be administered.
(86) A pharmaceutically acceptable carrier refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a pharmaceutical composition for administration to a subject. A pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation. The pharmaceutically acceptable carrier is appropriate for the formulation employed. Examples of pharmaceutically acceptable carriers include alumina; aluminum stearate; lecithin; serum proteins, such as human serum albumin, canine or other animal albumin; buffers such as phosphate, citrate, tromethamine or HEPES buffers; glycine; sorbic acid; potassium sorbate; partial glyceride mixtures of saturated vegetable fatty acids; water; salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, or magnesium trisilicate; polyvinyl pyrrolidone, cellulose-based substances; polyethylene glycol; sucrose; mannitol; or amino acids including, but not limited to, arginine.
(87) The pharmaceutical composition can be stored in lyophilized form. Thus, in some embodiments, the preparation process includes a lyophilization step. The lyophilized composition may then be reformulated, typically as an aqueous composition suitable for parenteral administration, prior to administration to the dog, cat, or horse. In other embodiments, particularly where the antibody is highly stable to thermal and oxidative denaturation, the pharmaceutical composition can be stored as a liquid, i.e., as an aqueous composition, which may be administered directly, or with appropriate dilution, to the dog, cat, or horse. A lyophilized composition can be reconstituted with sterile Water for Injection (WFI). Anti-bacterial agents (e.g., bacteriostatic reagents, such benzyl alcohol, may be included. Thus, the invention provides pharmaceutical compositions in solid or liquid form.
(88) The pH of the pharmaceutical compositions may be in the range of from about pH 5 to about pH 8, when administered. The compositions of the invention are sterile if they are to be used for therapeutic purposes. Sterility can be achieved by any of several means known in the art, including by filtration through sterile filtration membranes (e.g., 0.2 micron membranes). Sterility may be maintained with or without anti-bacterial agents.
(89) In some embodiments, the pharmaceutically acceptable carrier or the pharmaceutical composition has a pH of from 5.0 to 6.2, from 5.0 to 6.0, or from 5.3 to 5.7. In some embodiments, the pharmaceutical carrier is phosphate buffered saline, pH 7.2. In some embodiments, the pharmaceutical carrier is 50 mM NaCitrate pH 7, 150 mM NaCl.
(90) In some embodiments, the pharmaceutically acceptable carrier or a pharmaceutical composition comprises an anti-bacterial agent.
(91) Exemplary Uses of Antibodies and Pharmaceutical Compositions
(92) The antibodies or pharmaceutical compositions comprising the antibodies of the invention may be useful for providing passive immunity against infection with parvovirus and/or treating a parvoviral infection. As used herein, a parvoviral infection means a condition associated with, caused by, or characterized by, a parvoviral infection. Such conditions include, but are not limited to, infections confirmed by cage-side ELISA tests, hemagglutination assay (HA), histopathology, virus isolation or virus titers, or PCR. Infections with parvovirus often include fever, vomiting, diarrhea, lymphopenia, dehydration, and/or secondary septicemia.
(93) As used herein, treatment is an approach for obtaining beneficial or desired clinical results. Treatment as used herein, covers any administration or application of a therapeutic for disease in a subject, such as a mammal, including a human and a companion animal (e.g., a canine or feline). For purposes of this disclosure, beneficial or desired clinical results include, but are not limited to, any one or more of: alleviation of one or more symptoms, prevention of mortality, diminishment of extent and severity of disease, preventing or delaying spread of disease, eliminating or shorting duration of viral shedding, preventing or delaying recurrence of disease, preventing or decreasing viral cytopathic effects, delay or slowing of disease progression, amelioration of the disease state, inhibiting the disease or progression of the disease, resolution of clinical signs of disease, inhibiting or slowing the disease or its progression, arresting its development, and remission (whether partial or total). Also encompassed by treatment is a reduction of pathological consequence of a proliferative disease. The methods provided herein contemplate any one or more of these aspects of treatment. In-line with the above, the term treatment does not require one-hundred percent removal of all aspects of the disorder.
(94) In some embodiments, a parvovirus antibody or pharmaceutical compositions comprising it can be utilized in accordance with the methods herein to provide passive immunity against infection parvovirus and/or treat parvoviral infections. In some embodiments, a parvovirus antibody or pharmaceutical compositions is administered to subject, such as a companion animal (e.g., a canine or a feline) or a human to provide passive immunity against infection with parvovirus and/or treat an a parvoviral infection.
(95) A therapeutically effective amount of a substance/molecule, agonist or antagonist may vary according to factors such as the type of disease to be treated, the disease state, the immune status of the individual subject, the virulent viral load encountered, the severity and extent of viremia, the severity and course of the disease, the type of therapeutic purpose, any previous therapy, the clinical history, the response to prior treatment, the maternally-derived antibody passive transfer status, the previous immunization status of the individual animal, the discretion of the attending veterinarian, age, sex, and weight of the subject, and the ability of the substance/molecule, agonist or antagonist to elicit a desired response in the subject. A therapeutically effective amount is also one in which any toxic or detrimental effects of the substance/molecule, agonist or antagonist are outweighed by the therapeutically beneficial effects. A therapeutically effective amount may be delivered in one or more administrations. A therapeutically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
(96) In some embodiments, a parvovirus antibody or pharmaceutical composition comprising a parvovirus antibody is administered parenterally, by subcutaneous administration, intravenous infusion, or intramuscular injection. In some embodiments, a parvovirus antibody or pharmaceutical composition comprising a parvovirus antibody is administered as a single dose or multiple dose bolus injection. In some embodiments, a parvovirus antibody or pharmaceutical composition comprising a parvovirus antibody is administered by an intramuscular, an intravenous, an intraperitoneal, an intracerebrospinal, a subcutaneous, an intra-arterial, an intrasynovial, an intrathecal, or an inhalation route.
(97) Parvovirus antibodies described herein may be administered in an amount in the range of 0.01 mg/kg body weight to 100 mg/kg body weight per dose. In some embodiments, parvovirus antibodies may be administered in an amount in the range of 0.5 mg/kg body weight to 50 mg/kg body weight per dose. In some embodiments, parvovirus antibodies may be administered in an amount in the range of 0.1 mg/kg body weight to 10 mg/kg body weight per dose. In some embodiments, parvovirus antibodies may be administered in an amount in the range of 0.1 mg/kg body weight to 100 mg/kg body weight per dose. In some embodiments, parvovirus antibodies may be administered in an amount in the range of 1 mg/kg body weight to 10 mg/kg body weight per dose. In some embodiments, parvovirus antibodies may be administered in an amount in the range of 0.5 mg/kg body weight to 100 mg/kg body, in the range of 1 mg/kg body weight to 100 mg/kg body weight, in the range of 5 mg/kg body weight to 100 mg/kg body weight, in the range of 10 mg/kg body weight to 100 mg/kg body weight, in the range of 20 mg/kg body weight to 100 mg/kg body weight, in the range of 50 mg/kg body weight to 100 mg/kg body weight, in the range of 1 mg/kg body weight to 10 mg/kg body weight, in the range of 5 mg/kg body weight to 10 mg/kg body weight, in the range of 0.5 mg/kg body weight to 10 mg/kg body weight, in the range of 0.01 mg/kg body weight to 0.5 mg/kg body weight, in the range of 0.01 mg/kg body weight to 0.1 mg/kg body weight, or in the range of 5 mg/kg body weight to 50 mg/kg body weight. In some embodiments, parvovirus antibodies may be administered in an amount of 0.5 mg/kg body weight.
(98) A parvovirus antibody or a pharmaceutical composition comprising a parvovirus antibody can be administered to a subject, such as a human or companion animal (e.g., a canine or a feline) as a single dose, at one time or over a series of treatments. For example, a parvovirus antibody or a pharmaceutical composition comprising a parvovirus antibody may be administered at least once, more than once, at least twice, at least three times, at least four times, or at least five times.
(99) In some embodiments, the dose is administered once per week for at least two or three consecutive weeks, and in some embodiments, this cycle of treatment is repeated two or more times, optionally interspersed with one or more weeks of no treatment. In other embodiments, the therapeutically effective dose is administered once per day for two to five consecutive days, and in some embodiments, this cycle of treatment is repeated two or more times, optionally interspersed with one or more days or weeks of no treatment.
(100) In some embodiments, the dose is administered to a subject, such as a human or companion animal (e.g., a canine or a feline) less than 1 week of age, less than 2 weeks of age, less than 3 weeks of age, less than 4 weeks of age, less than 5 weeks of age, less than 6 weeks of age, less than 6 weeks of age, less than 7 weeks of age, less than 8 weeks of age, less than 9 weeks of age, less than 10 weeks of age, less than 11 weeks of age, less than 12 weeks of age, less than 6 months of age, between 0 and 12 weeks of age, between 0 and 10 weeks of age, between 0 and 8 weeks of age, between 0 and 6 weeks of age, between 0 and 4 weeks of age, between 0 and 2 weeks of age, between 4 and 12 weeks of age, between 6 and 12 weeks of age, between 10 and 12 weeks of age, between 4 weeks and 6 months of age, between 2 months and 6 months of age, between 4 months and 6 months of age, between 6 months and 1 year of age, greater than 13 weeks of age, or greater than 1 year of age.
(101) It may be advantageous to deliver the parvovirus antibody or a nucleic acid encoding the parvovirus antibody to an infant subject prenatally and/or postnatally to provide passive immunity against parvovirus infection. In some embodiments, the parvovirus antibody is administered to a pregnant or nursing maternal subject, such as a human or companion animal (e.g., a canine or a feline). In some embodiments, the parvovirus antibody is administered to the placenta of a pregnant subject.
(102) In some embodiments, a method of providing passive immunity in an infant subject against infection with a canine or feline parvovirus comprises administering to a pregnant or nursing maternal subject a therapeutically effective amount of a monoclonal antibody that binds to the canine or feline parvovirus. In some embodiments the parvovirus antibody is administered to the placenta of a pregnant subject. In some embodiments, the parvovirus antibody is administered to a nursing subject.
(103) Provided herein are methods of using the parvovirus antibodies, polypeptides and polynucleotides for detection, diagnosis and monitoring of a parvoviral infection. Provided herein are methods of determining whether a subject will respond to parvovirus antibody therapy. In some embodiments, the method comprises virus serum neutralization. In some embodiments, the method comprises detecting whether the subject has cells that express parvovirus using a parvovirus antibody. In some embodiments, the method of detection comprises contacting the sample with an antibody, polypeptide, or polynucleotide and determining whether the level of binding differs from that of a reference or comparison sample (such as a control). In some embodiments, the method may be useful to determine whether the antibodies or polypeptides described herein are an appropriate treatment for the subject.
(104) In some embodiments, the sample is a biological sample. The term biological sample means a quantity of a substance from a living thing or formerly living thing. In some embodiments, the biological sample is a swab containing cellular debris, cell or cell/tissue lysate. In some embodiments, the biological sample includes, but is not limited to, blood, (for example, whole blood), plasma, serum, urine, synovial fluid, lymphatic tissue and epithelial cells.
(105) In some embodiments, the cells or cell/tissue lysate are contacted with a parvovirus antibody and the binding between the antibody and the cell is determined. When the test cells show binding activity as compared to a reference cell of the same tissue type, it may indicate that the subject would benefit from treatment with a parvovirus antibody. In some embodiments, the test cells are from tissue of a subject, such as a human or companion animal (e.g., a canine or a feline).
(106) Various methods known in the art for detecting specific antibody-antigen binding can be used. Exemplary immunoassays which can be conducted include fluorescence polarization immunoassay (FPIA), fluorescence immunoassay (FIA), enzyme immunoassay (EIA), nephelometric inhibition immunoassay (NIA), enzyme linked immunosorbent assay (ELISA), and radioimmunoassay (RIA). An indicator moiety, or label group, can be attached to the subject antibodies and is selected so as to meet the needs of various uses of the method which are often dictated by the availability of assay equipment and compatible immunoassay procedures. Appropriate labels include, without limitation, radionuclides (for example .sup.125I, .sup.131I, .sup.35S, .sup.3H, or .sup.32P), enzymes (for example, alkaline phosphatase, horseradish peroxidase, luciferase, or b-galactosidase), fluorescent moieties or proteins (for example, fluorescein, rhodamine, phycoerythrin, GFP, or BFP), or luminescent moieties (for example, Qdot nanoparticles supplied by the Quantum Dot Corporation, Palo Alto, Calif.). General techniques to be used in performing the various immunoassays noted above are known to those of ordinary skill in the art.
(107) For purposes of diagnosis, the polypeptide including antibodies can be labeled with a detectable moiety including but not limited to radioisotopes, fluorescent labels, and various enzyme-substrate labels know in the art. Methods of conjugating labels to an antibody are known in the art. In some embodiments, the parvovirus antibodies need not be labeled, and the presence thereof can be detected using a second labeled antibody which binds to the first parvovirus antibody. In some embodiments, the parvovirus antibody can be employed in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays. Zola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC Press, Inc. 1987). The parvovirus antibodies and polypeptides can also be used for in vivo diagnostic assays, such as in vivo imaging. Generally, the antibody or the polypeptide is labeled with a radionuclide (such as .sup.111In, .sup.99Tc, .sup.14C, .sup.131I, .sup.125I, .sup.13H, or any other radionuclide label, including those outlined herein) so that the cells or tissue of interest can be localized using immunoscintiography. The antibody may also be used as staining reagent in pathology using techniques well known in the art.
(108) In some embodiments, a first antibody is used for a diagnostic and a second antibody is used as a therapeutic. In some embodiments, the first and second antibodies are different. In some embodiments, the first and second antibodies can both bind to the antigen at the same time, by binding to separate epitopes.
(109) The following examples illustrate particular aspects of the disclosure and are not intended in any way to limit the disclosure.
EXAMPLES
Example 1
Preparation of Chimeric Canine Antibodies Mab A and Mab B
(110) Structural analysis of canine parvovirus and feline parvovirus complexed with antibody fragments from eight different neutralizing monoclonal antibodies were reported in Hafenstein S., et al, J Virol. 2009 June, 83(11):5556-66. Incomplete amino acid sequence information was provided for rat Mab E and Mab F Fab fragments, which exhibited canine parvovirus neutralization in an in vitro assay. The incomplete amino acid sequences for the variable heavy chain and variable light chain of Mab E are SEQ ID NOs. 81 and 82, respectively. The incomplete amino acid sequences for the variable heavy chain and variable light chain of Mab F are SEQ ID NOs. 83 and 84, respectively.
(111) Three-dimensional protein structure analysis was performed to construct a redesigned first framework region for both heavy and light chains of Mab E and Mab F. The amino acid sequences of the heavy and light chain of redesigned monoclonal antibodies, designated Mab A and Mab B, are SEQ ID NO: 20 (Mab A heavy chain), SEQ ID NO: 22 (Mab A light chain), SEQ ID NO: 62 (Mab B heavy chain), and SEQ ID NO: 64 (Mab B light chain).
(112) DNA sequences encoding a chimeric antibody were designed for fusions of Mab A VH (SEQ ID NO: 20) and Mab B VH (SEQ ID NO: 62) to canine constant IgG-B heavy chain and Mab A VL (SEQ ID NO: 22) and Mab B LC (SEQ ID NO: 64) to canine constant light chain resulting in SEQ ID NO: 23 (Chimeric A HC IgG-B), SEQ ID NO: 66 (Chimeric B HC IgG-B), SEQ ID NO: 25 (Chimeric A LC ), and SEQ ID NO: 68 (Chimeric B LC ). The heavy chain and light chain nucleotide sequences were synthesized chemically and inserted into an expression vector suitable for transfection into a mammalian host cell. Following transfection of heavy and light chain vector pairs into cells and culture, antibodies were affinity purified from the culture media using CaptivA Protein A Affinity Resin (Repligen). The purified Chimeric Canine Mab A and Mab B antibodies were confirmed by SDS-PAGE analysis (data not shown).
(113) Chimeric antibodies may also be designed and prepared based on fusions of Mab A VH (SEQ ID NO: 20) and Mab B VH (SEQ ID NO: 62) to canine constant IgG-A, IgG-C, and IgG-D heavy chains.
Example 2
Chimeric Canine Antibodies Mab A and Mab B Activity
(114) Both purified Chimeric Canine Mab A and Mab B (formulated in PBS, pH 7.2 at 200 g/mL) were used for assessing anti-canine parvovirus activity using a hemagglutination inhibition (HI) assay. The assay was performed at Companion Animal Vaccine and Immuno Diagnostic Service Laboratory, University of Wisconsin, essentially as described by Carmichael, et al., Am J of Vet Res. 1980 May, 41 (5):784-91. Serial dilutions of samples of Chimeric Canine Mab A and Chimeric Canine Mab B incubated with CPV were prepared. Porcine red blood cells were then added. Canine parvovirus induces porcine red blood cells to agglutinate. Both Chimeric Canine Mab A and Chimeric Canine Mab B prevented agglutination. Both antibodies resulted in a CPV-2b HI of 40960, while irrelevant canine IgG produced HI of <20. Most vaccinated dogs are understood to have antibody HI around 1280.
(115) Furthermore, the activity of the antibodies to prevent live CPV from infecting and destroying cells was analyzed using Virus Serum Neutralization assay.
Example 3
Variant VII and VL Sequences for Enhanced Expression of Chimeric Canine Mab A and Mab B
(116) Chimeric Canine Mab A and Chimeric Canine Mab B consistently expressed poorly in transient CHOS or stable CHOK1 cells. To enhance expression levels, three-dimensional protein structure analysis was performed to identify VH and VL amino acid residues suitable for modification. Multiple constructs with various mutations in VH and VL were generated. The expression level of antibodies having combinations of canine IgG-B with VH and VL variants were tested.
(117) Enhanced expression variants were analyzed for their specific activity by canine parvovirus HI assay. In these experiments, each of the antibody variants tested was formulated in PBS, pH 7.2 at 200 g/mL. Both Chimeric Canine Mab A (SEQ ID NOs: 23 and 25) and Chimeric Canine Mab B (SEQ ID NOs: 66 and 68) demonstrated a CPV-2b HI of 10240. Enhanced expression variants, Chimeric Canine Mab A v2 (SEQ ID NOs: 24 and 25) and Chimeric Canine Mab B v2 (SEQ ID NOs: 67 and 69), maintained the same HI value of 10240, while other variants displayed lower specific activity.
Example 4
Parvovirus Infection Assay Activity (SVN)
(118) To determine the ability of Chimeric Canine Mab A v2 (SEQ ID NOs: 24 and 25) and Chimeric Canine Mab B v2 (SEQ ID NOs: 67 and 69) to prevent live parvovirus from infecting and destroying cells, a serum virus neutralization (SVN) assay was performed. In this assay, Madin Darby Canine Kidney (MDCK) cells were grown. Serial dilutions of antibody were mixed with a fixed titer of parvovirus. The mixture was then incubated with the cells. After incubation, the cells were examined by microscopy to identify the viral cytopathic effect (CPE). The readout is the final dilution of the antibody sample where it reached limits in preventing parvovirus from causing the cytopathic effect.
(119) Both Chimeric Canine Mab A v2 (1) kept at 4 C. and (2) subjected to 7 freeze-thaw cycles at 200 ug/mL had the same activity: SVN for CPV-2b 32000 and SVN for CPV2c 8000.
Example 5
Stability of Chimeric Canine Mab A v2 and Mab B v2
(120) Stability of Chimeric Canine Mab A v2 (SEQ ID NOs: 24 and 25) at 25 mg/mL and Chimeric Canine Mab B v2 (SEQ ID NOs: 67 and 69) at 20.5 mg/mL was tested. Chimeric Canine Mab A v2 and Chimeric Canine Mab B v2 have similar specific activity by HI assay at a concentration of about 25 mg/mL and about 20.5 mg/mL, respectively.
(121) Both Chimeric Canine Mab A v2 and Chimeric Canine Mab B v2 produced and purified from CHOK1 stable pool can be readily concentrated to 25 mg/mL in PBS, pH7.2, suggesting that both antibodies have no solubility concerns.
(122) Chimeric Canine Mab A v2 and Chimeric Canine Mab B v2 are monomeric (>99%) at neutral pH and after storage for 10 hours at pH 4.1, as assessed by size-exclusion high performance liquid chromatography (HPLC). In this analysis, monomer and aggregates of antibodies were separated by SEC-HPLC, using Agilent 1100 system, Shodex KW803 column (8 mm300 mm) with a KW-G guard column, and mobile phase buffer of 2PBS pH7.2 (270 mM NaCl, 5.4 mM KCl, 8.6 mM Na2HPO4, 2.8 mM KPO4) at constant flow rate of 0.5 mL/minute. The column was calibrated using Bio Rad markers (Catalog No. 151-1901) composed of Thyroglobulin, -globulin, Ovalbumin, Myoglobin and Vitamin B12.
(123) Chimeric Canine Mab A v2 real-time stability in (1) PBS, pH 7.2 at 25 mg/mL and (2) 50 mM NaCitrate pH 7, 150 mM NaCl at 25 mg/mL at various temperatures were evaluated. The HPLC-SEC results at ten months are summarized in Table 3.
(124) TABLE-US-00003 TABLE 3 Chimeric Canine Mab Buffer Temperature % HMW A v2 (% monomer) PBS pH 7.2 80 C. <LOQ 100 (control) 20 C. <LOQ 100 4 C. <LOQ 100 25 C. 2.1% 97.9 50 mM 80 C. <LOQ 100 NaCitrate pH 7, (control) 150 mM NaCl 20 C. <LOQ 100
(125) Stability was also tested by subjecting the antibodies to three freeze-thaw cycles with freezing at 70 C. and thawing at room temperature. No loss of activity was observed for either antibody in terms of both CPV-2b HI and CPV-2c HI value.
(126) Stability was further tested by subjecting the antibodies to seven freeze-thaw cycles with freezing at 20 C. and thawing at room temperature. Both antibodies maintained full activity as measured by HI assay.
(127) Thermostability of the two antibodies in different formulations and across a range of pH was analyzed using differential scanning fluorescence (DSF). The melting temperature (Tm) of each antibody at the different conditions were measured. Buffer and 12 g of antibody were mixed together with 1 Protein thermal shift dye (Applied Biosystem, Catalog No. 4461146). A melting curve was performed with StepOne Real Time PCR System (Applied Biosystem, Catalog No. 4376357). The temperature was increased from 25 C. to 99 C. with a ramp rate of 1% according to the manufacturer's instructions. The data was analyzed by Protein Thermal Shift Software v1.0 (Applied Biosystem, Catalog No. 4466038) to determine the Tm, which was calculated as the highest value derived from taking the first derivative of the protein melting curve. For each of the formulations tested, including PBS pH7.2, Chimeric Canine Mab A v2 was significantly more stable than Chimeric Canine Mab B v2.
Example 6
VLP Bindings of Chimeric Canine Antibodies Mab A v2 and Mab B v2
(128) Apparent affinity of Chimeric Canine Mab A v2 (SEQ ID NOs: 24 and 25) and Chimeric Canine Mab B v2 (SEQ ID NOs: 67 and 69) with parvovirus VLP was measured. First, biotinylated Chimeric Canine Mab A v2 and Chimeric Canine Mab B v2 were bound to streptavidin sensor tips. Then, binding of recombinant canine parvovirus CPV2b capsid (Advanced ImmunoChemical Inc Cat #8-CPV) to the Mab-bound sensor tip was assessed.
(129) Chimeric Canine Mab A v2 and Chimeric Canine Mab B v2 antibodies each exhibited affinity to canine CPV 2b VLP with kinetics potentially sufficient for therapeutic activity. The binding analysis was performed using an Octet Biosensor as follows. Briefly, Chimeric Canine Mab A v2 (SEQ ID NOs: 24 and 25) and Chimeric Canine Mab B v2 (SEQ ID NOs: 67 and 69) was biotinylated through amine chemistry. The free unreacted biotin was removed by extensive dialysis. Biotinylated Chimeric Canine Mab A v2 and Chimeric Canine Mab B v2 was captured on streptavidin sensor tips. The association of either Mab A v2 or Mab B v2 and canine CPV 2b VLP (40 g/mL) was monitored for 300 seconds. Dissociation was monitored for 300 seconds. A biotinylated irrelevant canine IgG-B was used as negative control. The data were fit to a 1:1 binding model using ForteBio data analysis software to determine the kon, koff, and the Kd. The buffer for dilutions and all binding steps was 20 mM phosphate, 150 mM NaCl, pH 7.2. The Kd of Chimeric Canine Mab A v2 and VLP2b was 9.7810.sup.11 M and of Chimeric Canine Mab B v2 and VLP2b was 9.3810.sup.12 M (See
Example 7
Caninization of Mab A v2 and Mab B v2
(130) To reduce potential immunogenicity, particularly where repeated administration of antibodies A or B are needed, VH and VL from Mab A v2 and B v2 were subjected to caninization. A number of caninized VH and VL were designed, expressed, and purified. Good expressors were selected for specific activity using CPV2b HI assay. Caninized A HC v3 IgG-B (SEQ ID NO: 37) plus Caninized A LC (SEQ ID NO: 39) and Caninized A HC v4 IgG-B (SEQ ID NO: 38) plus Caninized A LC (SEQ ID NO: 39) maintained full activity compared to Chimeric A HC IgG-B (SEQ ID NO: 23) plus Chimeric A LC (SEQ ID NO: 25) and compared to Chimeric A HC v2 IgG-B (SEQ ID NO: 24) plus Chimeric A LC (SEQ ID NO: 25). Caninized B HC v3 IgG-B (SEQ ID NO: 79) plus Caninized B LC v3 (SEQ ID NO: 80) maintained full activity compared to Chimeric B HC IgG-B (SEQ ID NO: 66) plus Chimeric B LC (SEQ ID NO: 68) and compared to Chimeric B HC v2 IgG-B (SEQ ID NO: 67) plus Chimeric B LC v2 (SEQ ID NO: 69).
Example 8
Feline Chimeric Mab A and Mab B
(131) Chimeric Canine Mab A v2 (SEQ ID NOs: 24 and 25) and Chimeric Canine Mab B v2 (SEQ ID NOs: 67 and 69) showed activity in a feline parvovirus HI assay. Chimeric Canine Mab A v2 at 200 m/mL exhibited a feline parvovirus HI of 262144, while Chimeric Canine Mab B v2 at 200 ug/ml exhibited a feline parvovirus HI of 131072.
(132) Thus, Mab A and Mab B may be used in feline Parvovirus (panleukopenia virus) prevention or treatment. Furthermore, chimeric feline Mab A variable heavy chain and feline IgG-1 was designed to pair with chimeric feline Mab A variable light chain and feline kappa (SEQ ID NOs: 31 and 32). To remove potential heterogeneity, a mutation that removes the glycosylation site can be introduced to make chimeric feline Mab A-IgG1 paired with an aglycosylated kappa (e.g., SEQ ID NOs: 31 and 33).
(133) Further, chimeric feline Mab B variable heavy chain and feline IgG-1 was designed to pair with chimeric feline Mab B variable light chain and feline kappa (SEQ ID NOs: 74 and 75). A mutation that removes the glycosylation site can be introduced to make chimeric feline Mab A-IgG1 paired with an aglycosylated kappa (e.g., SEQ ID NOs: 74 and 76).
Example 9
Safety and Pharmacodynamics in Puppies
(134) An in vivo study was performed using Chimeric Canine Mab A (SEQ ID NOs: 23 and 25) and Chimeric Canine Mab B (SEQ ID NOs: 66 and 68) monoclonal antibodies. The objectives of this study were to evaluate safety, effect of Chimeric Canine Mab A and Chimeric Canine Mab B on Canine Parvovirus-2 (CPV-2) titers, virus neutralization, and response to a monovalent modified live vaccine after treatment with the two antibodies in purpose-bred, unvaccinated, healthy puppies. See study design summary in Table 4, below.
(135) TABLE-US-00004 TABLE 4 Identity Anti-Canine Parvovirus Neutralizing Antibodies Chimeric Canine Mab A (SEQ ID NOs: 23 and 25) and Chimeric Canine Mab B (SEQ ID NOs: 66 and 68). Protocol Number KB-030-PK-301 Protocol Title Pilot Pharmacodynamic and Safety Study of Mab A and Mab B in Purpose Bred Puppies Materials and The study was open label Methods Non-GLP Single-dose laboratory PD and safety study in unvaccinated, CPV-2 titer negative, healthy beagles Puppies were randomized to one of two equal treatment groups (3 to Mab A:3 to Mab B) Allocation occurred using a randomization list supplied by Sponsor Concomitant medications were given for coccidia and helminth prophylaxis during the acclimation phase. Study Population 6 healthy female beagle puppies 10-12 weeks of age Weight at least 1.5 kg Sourced from Ridglan Farms, Wisconsin Study Dates Study Initiation/Acclimation: 21 Jan. 2019 TA Administered: 28 Jan. 2019 Study End: 9 May 2019
(136) After randomization when puppies were allocated into two groups (3 Mab A (Dog IDs BDW-8, DEW-8, and DFW-8):3 Mab B (Dog IDs CTW-8, CWW-8, and DHW-8). Puppies received the respective antibody in a single intravenous dose (5 mg/kg) via a clipped and prepared cephalic vein on study Day 0. A monovalent CPV vaccine, Nobivac 1-Pv (Merck Animal Health, Kenilworth, NJ) was initially administered to puppies at titers of 80 or lower. A second dose was administered at 21 days after the first dose. A third dose was administered if the puppy had not seroconverted at about 21 days after the second dose.
(137) Puppies were monitored using Hemagglutination Inhibition (HI) and Virus Neutralization (VN) for a total of 100 days. HI quantifies the amount of antibody in a serum sample and VN is utilized to determine the ability of an antibody to prevent live virus from infecting and destroying cells. The puppies were also followed to determine if they seroconverted following CPV vaccination.
(138) All puppies were validated to have HI titers of <20 on Day 0 before intravenous administration of Mab A or B antibodies. Day 1 HI titers after administration of Mab A or B were between 2560 and 5120. Titers were monitored for 100 days to document the degradation of the antibodies and evaluate serum half-life.
(139) On Day 37 when titers from individual puppies began to fall to 1:40, vaccinations began to be administered to assess neutralization of vaccinal CPV-2. Mab A or B antibodies were documented to block immunization at varying levels in the puppies. Puppies were given subsequent doses of vaccination on schedule and response was verified. Vaccinal seroconversion ultimately occurred in 5 of the 6 puppies. The HI assay titers for both groups of animals are reflected in the Table 5, below and in
(140) Two phase decay kinetics was used to obtain the fast distribution and slow phase decay using HI as function of time. Half-life of Chimeric Canine Mab A was 10.1 days (
(141) This initial pharmacodynamic study demonstrates that intravenously administered Chimeric Canine Mab A (SEQ ID NOs: 23 and 25) and Chimeric Canine Mab B (SEQ ID NOs: 66 and 68) resulted in initial antibody titers between 2560 and 5120 within 24 hours post-administration. Additionally, VN follows HI titers very closely. The approximate half-life of the antibodies is between 7 and 10 days. The duration of immunity (i.e., the duration in which the HI titer was maintained at 80 or higher), ranged from 30-42 days after one dose of Chimeric Canine Mab A or Chimeric Canine Mab B. Interference with vaccination is likely until the antibody degrades sufficiently to no longer neutralize vaccinal CPV-2. Both Chimeric Canine Mab A and Chimeric Canine Mab B resulted in high titers, were well-tolerated and no adverse events or injection site reactions were reported.
(142) The initial CPV vaccination did not result in seroconversion in 5 out of 6 puppies, potentially due to residual Chimeric Canine Mab A or B antibodies neutralizing the vaccine. Blocking of vaccinal virus replication by both Canine Mab A or Chimeric Canine Mab B was the first in vivo correlation to the in vitro neutralization data. Subsequently, three puppies seroconverted after the second and one after the third vaccination.
(143) Regarding puppy CWW-8, seroconversion on Day 56 did not correlate with the timeframe of vaccination administered on Day 37. It is suspected that vaccinal virus shedding from other puppies in the study exposed CWW-8 and produced the seroconversion once the titers were <20.
(144) TABLE-US-00005 TABLE 5 Study Day Day Day Day Day Day Day Day Day Day Day Day Day Day Day Day 7 0 1 3 5 7 10 14 18 21 23 25 28 30 32 Animal ID Hemagglutination Inhibition Assay/Parvovirus titer BDW-8 <20 <20 2560 2560 2560 640 1280 640 320 640 320 320 160 160 80 DEW-8 <20 <20 5120 2560 1280 1280 1280 640 640 640 640 320 320 320 160 DFW-8 <20 <20 2560 2560 1280 1280 640 640 640 320 640 320 160 160 160 CTW-8 <20 <20 2560 1280 1280 640 640 320 320 160 160 160 80 80 40 CWW-8 <20 <20 2560 1280 1280 640 640 320 320 160 160 160 80 80 40 DHW-8 <20 <20 2560 1280 1280 1280 640 320 640 160 160 160 160 160 80 Study Day Day Day Day Day Day Day Day Day Day Day Day Day Day Day 35 37 39 42 49 56 58 63 70 77 84 87 91 98 Animal ID Hemagglutination Inhibition Assay/Parvovirus titer BDW-8 80 40 40 .sup.20.sup.1 <20 <20.sup. <20.sup.2 <20.sup. <20.sup. <20 XX.sup.4 <20 <20.sup. DEW-8 80 80 80 .sup.80.sup.1 40 40.sup. 20.sup.2 <20.sup. 1280.sup.3 2560 DFW-8 80 80 80 .sup.40.sup.1 40 40.sup. 20.sup.2 80.sup.3 80.sup. 320 CTW-8 40 .sup.40.sup.1 20 20 <20.sup. <20.sup.2 10240.sup.3 5120.sup. 5120.sup. 2560 CWW-8 40 .sup.40.sup.1 40 <20 20480.sup.3 10240.sup.2 10240.sup. 5120.sup. 5120.sup. 5120 DHW-8 80 40 40 .sup.20.sup.1 20 <20.sup. <20.sup.2 <20.sup. <20.sup. <20 XX.sup.4 <20 320.sup.3 .sup.11.sup.st Monovalent parvo vaccine given .sup.22.sup.nd Monovalent parvo vaccine given .sup.3Vaccinal Seroconversion .sup.43.sup.rd Monovalent parvo vaccine given
(145) TABLE-US-00006 TABLE 6 Study Day Day 0 Day 1 Day 7 Day 14 Day 21 Day 28 Day 35 Day 42 Day 29 Day 63 Day 84 Animal ID Virus Neutralization Assay BDW-8 <2 1024 512 256 128 32 32 16 8 2 2 DEW-8 <2 1024 512 256 128 64 32 32 16 4 1024 DFW-8 <2 1024 512 256 128 16 32 16 16 8 32 CTW-8 <2 512 256 64 64 32 16 4 4 >4096 1024 CWW-8 <2 512 256 128 64 32 16 16 4 >4096 4096 DHW-8 <2 1024 256 128 64 32 16 8 8 4 <2 Underline = 1.sup.st Monovalent parvo vaccine given Italic = 2.sup.nd Monovalent parvo vaccine given
Example 10
Prevention and Treatment
(146) This in vivo study utilized MabA v2 antibody. The objective of this study was to validate the dose of live CPV-2 that will be used to challenge dogs in future pivotal studies of MabA v2 and to provide proof of concept for MabA v2 for two indications, both as a prophylactic treatment to prevent CPV-2 infection and as a therapeutic treatment for dogs with CPV-2 infection. See study design summary in Table 7, below.
(147) TABLE-US-00007 TABLE 7 Identity Anti-Canine Parvovirus Neutralizing Antibody Chimeric Canine Mab A v2 (SEQ ID NOs: 24 and 25) Protocol Number KB-030-PLC-301 Protocol Title Evaluation of the Efficacy of Mab A v2 as a Prophylactic and Therapeutic Treatment in Dogs to Prevent Clinical Signs of CPV-2 Infection Materials and Methods The study was open label Non-GLP Single-dose laboratory PD and safety study in unvaccinated, CPV-2 titer negative, healthy beagles Puppies were randomized to one of six equal treatment groups Study Population 12 healthy beagle puppies Equal numbers of males and females 11 weeks of age Weight at least 1.5 kg Sourced from Ridglan Farms Inc., Wisconsin Study Dates Study Day 1: 22 Jun. 2019 CPV-2 Inoculation: 25 Jun. 2019 Study End: 7 Jul. 2019
(148) Twelve dogs were randomized and assigned to one of 6 groups with a male and female in each group. Groups 1-3 were only to receive the live CPV-2 challenge in order to validate the dose required to produce required morbidity and mortality at three different viral logs. Dogs in groups 4 and 5 received Mab A v2 as a prophylactic treatment before inoculation with live CPV-2b. Dogs in group 6 were given Mab A v2 after challenge and confirmed development CPV-2 infection via fecal cage-side ELISA SNAP Test. See Table 8 (below) for CPV-2 inoculation challenge schedule.
(149) TABLE-US-00008 TABLE 8 Study Number Day of Group of Dogs Challenge Inoculation Route Dose 1 2 CPV-2b Day 4 IN 10.sup.2 TCID.sub.50 2 2 CPV-2b Day 4 IN 10.sup.4 TCID.sub.50 3 2 CPV-2b Day 4 IN 10.sup.6 TCID.sub.50 4* 2 CPV-2b Day 4 IN 10.sup.6 TCID.sub.50 5* 2 CPV-2b Day 4 IN 10.sup.6 TCID.sub.50 6** 2 CPV-2b Day 4 IN 10.sup.6 TCID.sub.50 *Groups 4 and 5 were treated with Mab on Day 1 per Table 9 **Group 6 was treated with Mab after CPV-2 infection was confirmed by detection of virus in feces (via cage-side CPV-2 ELISA) per Table 10
(150) Groups 4 and 5 were given MabA v2 on study Day 1 per Table 9, below.
(151) TABLE-US-00009 TABLE 9 Study Number Day of Group of Dogs Treatment Treatment Route Dose 4 2 Mab A v2 Day 1 IV 5 mg/kg 5 2 Mab A v2 Day 1 SC 5 mg/kg
(152) Group 6 was given Mab A v2 on study Day 7, after each puppy had developed a positive cage-side CPV-2 ELISA test documenting CPV-2 in the feces confirming parvovirus infection. See Table 10, below.
(153) TABLE-US-00010 TABLE 10 Study Number Day of Group of Dogs Treatment Treatment Route Dose 6 2 Mab A v2 Upon IV 5 mg/kg detection of virus in feces
(154) This study provided the first pharmacodynamic data on MabA v2 administered subcutaneously. The intravenously administered dose in group 4 dogs provided instantaneous rise in HI titers as predicted. The subcutaneously administered dose in group 5 dogs produced comparable titers over a 24-hour period. In Table 11, below, it can be seen how the intravenous and sub-cutaneous doses differ in timing at which the peak post-administration of MabA v2 HI titers were achieved.
(155) As shown in Table 12, below, administration of MabA v2 produced circulating antibody titers in the dogs within 24 hours (IV) and 48 hours (SC) after administration. Protective passive antibody titers were maintained for 16 days in face of a high load virulent challenge.
(156) TABLE-US-00011 TABLE 11 Treatment Serum HI Titers Group Treatment Dog ID Day 1 Day 2 Day 3 Day 4 Day 6 Day 8 Day 11 Day 15 Day 16 1 None AA1001 <20 <20 <20 <20 <20 <20 2560 20480 >20480 AA1101 <20 <20 <20 <20 <20 <20 320 20480 >20480 2 None AA2001 <20 <20 <20 <20 <20 <20 160 >20480 >20480 AA2101 <20 <20 <20 <20 <20 <20 10240 NA NA 3 None AA3001 <20 <20 <20 <20 <20 <20 no NA NA sample AA3101 <20 <20 <20 <20 <20 <20 2560 NA NA 4 Mab A v2 AA4001 5120 5120 5120 5120 2560 2560 1280 2560 2560 (Day 1, IV) AA4101 10240 5120 5120 5120 2560 2560 2560 1280 2560 5 Mab A v2 AA5001 <20 2560 2560 2560 2560 2560 2560 1280 2560 (Day 1, SC) AA5101 <20 2560 2560 2560 2560 2560 5120 1280 1280 6 Mab A v2 AA6001 <20 <20 <20 <20 <20 5120 5120 5120 10240 (upon detection AA6101 <20 <20 <20 <20 <20 5120 10240 10240 10240 of CPV-2 in feces, IV)
(157) TABLE-US-00012 TABLE 12 Treatment CPV-2 SVN Antibody Titers Group Treatment Dog ID Day 1 Day 2 Day 3 Day 4 Day 6 Day 8 Day 11 Day 15 Day 16 1 None AA1001 <10 <10 <10 <10 <10 <10 2560 10240 10240 AA1101 <10 <10 <10 <10 <10 <10 160 20480 5120 2 None AA2001 <10 <10 <10 <10 <10 <10 160 5120 10240 AA2101 <10 <10 <10 <10 <10 <10 2560 NA NA 3 None AA3001 <10 <10 <10 <10 <10 <10 no NA NA sample AA3101 <10 <10 <10 <10 <10 <10 2560 NA NA 4 Mab A v2 AA4001 2560 2560 1280 1280 1280 640 640 320 320 (Day 1, IV) AA4101 2560 1280 1280 1280 1280 640 320 320 320 5 Mab A v2 AA5001 <10 640 640 1280 640 640 640 320 320 (Day 1, SC) AA5101 <10 640 640 1280 1280 640 640 320 320 6 Mab A v2 AA6001 <10 <10 <10 <10 <10 1280 5120 5120 5120 (upon detection AA6101 <10 <10 <10 <10 <10 640 5120 5120 5210 of CPV-2 in feces, IV) NA Not applicable
(158) On Day 1, groups 4 and 5 were given MabA v2 intravenously or subcutaneously, respectively. On Day 4, all 12 dogs in all 6 groups were administered virulent CPV-2 intranasally per the inoculation dose in Table 8. For a total of 14 days, the dogs were monitored every 6 hours to record General Health Observations (GHO), every 12 hours to document clinical scores (via validated system, Mohr et al, 2003), and frequent sampling of blood for hematology, HI, and VN as well as fecal hemagglutination assay (HA). Additionally, all dogs were given a cage-side CPV-2 ELISA test every day after inoculation until tested positive to evaluate when parvovirus infection was present. Table 13 summarizes the clinical signs of CPV-2 observed during the study.
(159) TABLE-US-00013 TABLE 13 Diarrhea, blood or Lympho- Fecal mucus RT penia Viral Early Group Dog ID in feces 103.4 F. 50% HA Euthanasia 1 AA1001 + + AA1101 2 AA2001 + + AA2101 + + + + (at study day 11) 3 AA3001 + + + (at study day 10) AA3101 + + + + + (at study day 11) 4 AA4001 AA4101 5 AA5001 AA5101 6 AA6001 + AA6101 + +
(160) Dogs in groups 3 and 6 (those who were challenged with 10.sup.6 live CPV-2 and not pre-treated with MabA v2) showed positive cage-side CPV-2 ELISA tests on the third or fourth day post-inoculation. Both dogs in group 3 (effectively the control group) developed profound classic clinical signs of parvovirus infection including depression, vomiting, bloody diarrhea, progressive dehydration and were moribund and euthanized by 7 days post-inoculation. Both dogs in group 6 tested positive on cage-side CPV-2 ELISA test 3 days after inoculation with live CPV-2. After confirming the positive cage-side CPV-2 ELISA test they were subsequently treated with Mab A v2 intravenously at 5 mg/kg. They received no additional adjunctive or supportive care.
(161) While the dogs in group 3 continued to get sicker and eventually became moribund and were humanely euthanized, the dogs in group 6 survived and experienced full clinical recovery during the study period. Group 6 dogs also returned to a negative cage-side CPV-2 ELISA test, indicating that they were no longer shedding viral particles.
(162) All dogs in groups 4 and 5 given Mab A v2 as a prophylactic treatment not only survived, but remained healthy (e.g. never developed a positive cage-side CPV-2 ELISA and never exhibited clinical signs of parvovirus infection).
(163) Anatomic histopathology of Groups 3-6 following humane euthanasia at scheduled study completion was performed, unless euthanasia was performed early for humane reasons. Groups 4 and 5 showed no significant pathologic changes. Group 6 showed lymphoid depletion of the thymus, but the other organs examined were normal. Group 3 showed lymphoid depletion of all lymphoid organs, moderate to severe small intestinal villus atrophy/necrosis with mild to severe crypt necrosis indicative of CPV-2 infection.
(164) This pilot proof of concept study demonstrated Mab A v2 is promising as a prophylactic and therapeutic intervention. All dogs in the prophylactic groups (n=4) never developed parvovirus infection and remained clinically normal. All dogs in the therapeutic group (n=2) which were confirmed to be infected with parvovirus survived and experienced full clinical recovery after administration of Mab A v2 with no other adjunctive or supportive treatments. This study also validated that sub-cutaneous dosing of Mab A v2 for prophylaxis is a viable option. Finally, the product was well-tolerated with no adverse events or injection site reactions. In this proof of concept study, prophylactic administration of Mab A v2 prior to challenge protected 100% of puppies from CPV-2 infection. In addition, 100% of puppies given therapeutic administration of Mab A v2 after confirmed CPV infection survived and recovered.
Example 11
Therapeutic Treatment Pivotal Effectiveness Study
(165) This pivotal study evaluates the effectiveness of Mab A v2 as a treatment of canine parvovirus (CPV) disease. Satisfactory completion of this study and demonstration of efficacy may support a label claim stating, This product has been shown to be effective for the treatment of dogs 13 weeks of age or older against canine parvovirus (CPV) disease.
(166) This GCP, randomized, blinded, placebo-controlled study is 14 days in length following at least 7-days acclimation period. A total of 28 nave, CPV-2 titer negative dogs (13 weeks old on Day 0, of any sex, and weighing 1.5 kg) are randomized to the study at a 3:1 ratio to two groups (n=21 dogs in Group 1 and n=7 in Group 2) as per Table 14.
(167) During acclimation, the dogs are acclimated to feeding, housing and handling procedures while being administered anthelmintic and antibiotic medications to eliminate common helminth and coccidia infections.
(168) The day of CPV-2b challenge is considered as Day 0. On Day 0 all dogs in Groups 1 and 2 are administered virulent CPV-2b at a dose of approximately 110.sup.6 TCID.sub.50 intranasally (IN) (approximately 1 mL volume; approximately 0.5 mL per nostril). On the same day as detection of CPV in feces (via positive cage-side CPV SNAP test) each dog is administered Mab A v2 or Control Product (CP; phosphate buffered saline (PBS)) via intravenous (IV) injection to an accessible vein (e.g., cephalic) catheter using a luer-lock syringe. Mab A v2 is administered in a single 5 mg/kg dose based on body weight. The CP has a pH of 7.20.2. The dose for Mab A v2Mab A v2 and CP is calculated as follows:
{(Body weight in kg)(5 mg/kg)}{25 mg/mL}=volume in mL to be injected
(169) At the scheduled times outlined in Table 15 individual dog health is closely monitored for 14 days with physical examinations (PEs), general health observations (GHO), measurement of rectal temperature (RT), cage-side CPV SNP test, serum HI, fecal hemagglutination assay (HA), serum biochemistry, and hematology.
(170) The primary efficacy variable is prevention of mortality from CPV infection in Group 1 dogs versus Group 2 dogs.
(171) See treatment groups in Table 14 below.
(172) TABLE-US-00014 TABLE 14 Concen- Number Treat- tration Group of Dogs ment Day Route (mg/mL) Dose 1 21 IVP Day of IV 25 5 mg/kg Positive mg/mL CPV SNAP Test 2 7 CP Day of IV NA Volume Positive equivalent CPV to Group 1 SNAP Test
(173) Randomization. This study may require a two-step randomization. The first step is to determine which 28 dogs are enrolled in the study. Dogs are then randomized at a block size of 4 based on litter if possible, with a 3:1 ratio to Groups 1 and 2, respectively. The randomization is based on random numbers generated by the PLAN procedure in SAS (version 9.4 or later, SAS Institute, Cary NC) using the randomized selection method with a seed number.
(174) After arrival to the Test Facility, dogs are placed into cages in 2 rooms based on the order of arrival, and dogs from the same litter/block stay in the same room if possible. Dogs might get secondary exposure to virus that is shed from infected dogs. To keep a similar level of secondary virus exposure for both treatment groups and to maintain blinding to Test Facility personnel, each room contains both treatment groups. After the 28 dogs are selected, their cages are sequentially numbered from 1-28. Dogs from the same litter have adjacent cage numbers, with litters of 4 taking earlier numbers (e.g., 1-4, 5-8, etc.) per room. One room should contain cage numbers 1-12, and the other room contain cage numbers 13-28. The dogs are enrolled in the order of cage numbers in the randomization list.
(175) Study Blinding. The Investigator and all other Test Facility Personnel (excluding the Dispenser and one designated person who restrains dogs for dosing) do not have knowledge of the actual treatment group assignment at Day 0. Only the Dispenser and the person designated for restraining dogs during dosing at the Test Facility have access to actual treatment group assignment (Mab A v2 or CP) for each dog. The Dispenser and the dog restrainer/holder do not perform any study assessments.
(176) Specifications. A total of at least 30 purpose-bred, unvaccinated, CPV-2 seronegative (HI<20), healthy Beagle dogs are procured. The dogs are confirmed CPV negative via CPV SNAP test upon arrival to the Test Facility. Although the study enrollment includes 28 dogs, two additional dogs are purchased to ensure dog numbers are met after screening and acclimation. Ideally, the 30 dogs are comprised of 7 litters with 4 dogs per litter, plus 2 dogs from another litter (a partial litter).
(177) Pivotal Potency Determination. The pivotal efficacy serial sets the release potency of subsequent serials, each serial needs to be at, or above potency of the pivotal efficacy serial as compared in the potency assay in order to be considered satisfactory for release. In order to set a Master Reference for the potency assay, the pivotal efficacy serial is tested using the reference monitoring assay(s). The testing is conducted on Day 07 days of administration for the first efficacy dose administered to the study dogs.
(178) Observations
(179) Physical Examination (PE). Physical examinations are performed on all dogs by the Test Facility Veterinarian on at least Days 7, 1, Mab A v2/CP dosing day, Day 13 and on an unscheduled basis when necessary. Physical examinations include a comprehensive assessment of all body systems, including hydration status and BW, and are recorded.
(180) Food Consumption. Once daily, qualitative assessment of food consumption is made in conjunction with general health observations (GHOs). All abnormalities in food consumption observed are recorded.
(181) General Health Observations (GHOs) and Measurement of Rectal Temperature (RT). GHOs are conducted by the Test Facility Veterinarian or their designee at least once daily during the acclimation period from Day 7 through Day 1. GHOs are conducted every 12 hours (1 hour) starting on Day 0 through Day 12. Beginning on Day 0, in conjunction with each GHO, the RT is also measured using a calibrated thermometer in Fahrenheit scale.
(182) Specific GHO information are collected on these four parameters: Attituderecorded as normal, mild to moderate depression, severe depression, or collapsed or moribund Appetiterecorded as normal, voluntarily eats small amounts, no interest in food, or not offered Vomitingrecorded as absent, mild (once per 12 hours), moderate (2-5 times per 12 hours), or severe (6 times per 12 hours) Fecesrecorded as well-formed or absent, soft or pasty feces, watery non-bloody diarrhea, or water, bloody diarrhea
GHOs may also include other observations in addition to these four parameters. These parameters are documented for each dog at each observation period.
(183) Cage-side CPV SNAP Test. Cage-side CPV ELISA tests are performed using the IDEXX CPV SNAP test according to the manufacturer's instructions. Preliminary CPV SNAP tests are performed on all dogs upon arrival on Day 7 from the Vendor to confirm the dogs do not have active CPV infection. Subsequent CPV SNAP tests are evaluated at a consistent time of morning from Day 1 through study termination. In the unlikely event that a dog does not test positive on CPV SNAP test and therefore does not receive Mab A v2/CP, it is excluded from efficacy analysis.
(184) Serum CPV-2 Hemagglutination (HI) Testing. Whole blood samples are collected (approximately 1.5 mL) from all dogs via a jugular, cephalic, or lateral saphenous vein into serum separator tubes and processed to serum on Days 7, 0, 3, 4, 6, 8, 10, and 13 with the Day 0 sample being collected prior to being challenged with virulent CPV-2b. Samples are also collected prior to unscheduled euthanasia. Samples are inventoried and expedited in shipment on dry ice to the Laboratory Investigator at the earliest opportunity. Samples are stored at frozen conditions (60 C.) until shipment. Data are recorded.
(185) Fecal CPV-2 Hemagglutination Assay (HA) Testing. A bulk fecal sample is collected from each dog on Day 0 through study termination. Bulk feces is collected from each dog into a 50 mL tube, individually frozen, and kept for fecal HA testing to validate CPV SNAP test results and to meet one of the four CPV-2b infection criteria. Fecal samples are homogenized prior to HA testing to maximize accuracy of results and sample size. Procedures for collection, storage and shipping of feces follow the Laboratory Investigator's instructions. Data are recorded.
(186) CPV-2b Infection Criteria. The criteria for CPV infection are in accordance with 9 CFR 113.317, (c), (3), (i). This regulation defines the four criteria for an active CPV infection. A valid CPV-2b challenge should produce three of the four criteria or mortality in at least four of seven CP dogs. Per 9 CFR 113.317 definition, the four criteria of parvovirus are as follows: Body temp 103.4 F. Lymphopenia of 50% of pre-challenge normal Diarrhea, mucus and/or blood in the feces Viral hemagglutinins at a level of 1:64 in a 1:5 dilution of feces (or a test of equal sensitivity)
These four criteria are monitored daily in all dogs via q 12-hour GHOs including rectal temperature (RT), hematology at specified intervals to monitor lymphocyte counts, and CPV SNAP tests which are performed daily with results verified via fecal HA. Post challenge, dogs from either group that die due to CPV infection are considered a mortality from CPV infection. Dogs that are deemed moribund and must be euthanized via the rescue clause are also considered a mortality from CPV infection.
(187) Clinical Pathology (Hematology and Clinical Biochemistry). On Day 7 a baseline complete blood count (CBC) and biochemical profile is evaluated to verify the dogs are healthy with no pre-existing conditions. On Days 1, 0, 3, 4, 5, 6, 7, 8, 10 and 13 blood is collected for CBC to monitor blood lymphocyte counts. The samples should be collected at a consistent time each morning and recorded. Approximately 0.5 mL of blood is collected for hematology and approximately 1 mL of blood is collected for clinical biochemistry via any accessible vein (e.g. jugular, cephalic, or lateral saphenous vein). All samples are analyzed to evaluate CBC data in real-time to determine if lymphopenia has occurred which is one of the four clinical signs consistent with active CPV per 9 CFR 113.317.
(188) Effectiveness Outcomes
(189) Primary Outcome. The primary efficacy variable is CPV-induced mortality. Mortality rate in Mab A v2 and CP groups is calculated. The prevented fraction (PF) and lower 95% confidence limit is calculated to compare the Mab A v2 group to the CP group with Room as a stratified variable using the Cochran-Mantel-Haenszel method (the FREQ procedure in SAS, SAS Institute, Cary NC, version 9.4 or later). In case the PF cannot be generated due to the data (e.g., 100% Mab A v2 survival rate), and results are homogenous across rooms, the same analysis without Room as a stratified variable is conducted. The primary efficacy endpoint is met if the lower 95% confidence limit of the PF is >0 and the mortality rate in the CP group is higher than the Mab A v2 group. Mortality in Mab A v2/CP dogs is defined as death from CPV infection or dogs which are deemed moribund and must be euthanized via the rescue clause. In the unlikely event that a dog does not test positive on CPV SNAP test and therefore does not receive Mab A v2/CP, it is excluded from efficacy analysis.
(190) Rescue Clause. If an individual dog is deemed moribund by the Test Facility Veterinarian, they can remove the dog from the study via the rescue clause and elect euthanasia. Dogs removed from the study for humane reasons are included in the efficacy assessment as a mortality unless the reason for euthanasia is unrelated to CPV.
(191) The schedule of events is provided in Table 15 below.
(192) TABLE-US-00015 TABLE 15 Acclimation In-Life Study Day Day 7 Day 6 Day 5 Day 4 Day 3 Day 2 Day 1 Day 0 Day 1 Day 2 Day 3 GHOs and RT.sup.1 X X X X X X X q q q q 12 12 12 12 PE and BW.sup.2 X X IVP/CP Dose.sup.3 TBD Intranasal CVP-2b X Challenge Randomization X Hematology X X X X Biochemistry X CPV SNAP Test X X X X X X CPV-2 HI (serum) X X X Bulk feces X X X X collection for CPV-2 HA (feces).sup.4 Fenbendazole X X X X X Sulfadimethoxine X X X X X Study Termination In-Life Study Day May also be Day 4 Day 5 Day 6 Day 7 Day 8 Day 9 Day 10 Day 11 Day 12 Day 13 Unscheduled GHOs and RT.sup.1 q q q q q q q q q X 12 12 12 12 12 12 12 12 12 PE and BW.sup.2 X X IVP/CP Dose.sup.3 Intranasal CVP-2b Challenge Randomization Hematology X X X X X X X Biochemistry CPV SNAP Test X X X X X X X X X X X CPV-2 HI (serum) X X X X X Bulk feces X X X X X X X X X X X collection for CPV-2 HA (feces).sup.4 Fenbendazole Sulfadimethoxine Study Termination X 1GHOs occur at least once daily during Acclimation. On Day 0, GHOs and rectal temperature (RT) are recorded every 12 hours (1 hour) through study termination. .sup.2PE and BW are also performed on the same day as IVP/CP Dosing. .sup.3IVP/CP Dose are administered upon detection of CPV-2 in individual dog's feces using the CPV SNAP test. .sup.4Fecal HA are conducted to verify parvovirus infection and validate CPV SNAP test results.
(193) The following is the Canine Parvovirus Challenge Inoculation Procedure: 1. Remove food 12 hours before the challenge material is administered. Water remains available. 2. Remove the challenge material from the ultracold (80 C.) freezer and allow to thaw at room temperature approximately 1 hour before use. 3. Thaw five extra aliquots in order to have back-up doses in case of handling error. 4. Retain challenge material on wet ice until use. 5. Draw up 1 mL aliquot challenge material with a syringe one dose at a time. 6. Use syringe (without needle) with nasal canula to administer 0.5 mL into each nostril. 7. Restraint is by hand; no sedation is needed. 8. Handler holds the dog's head up with nose slightly elevated during dosing. 9. Allow a few seconds time between each nostril for the dog to swallow and be comfortable. 10. Expect that some challenge material may be expelled from the nostrils. 11. Record Dog ID, date and time on the Animal Challenge Record as dosing is completed. 12. Return food to all dogs immediately after dosing. 13. Return unused challenge material to 80 C. freezer, label as retention aliquot, date. 14. Retain aliquot until study end and return to the Laboratory Investigator.
(194) The following is the Bulk Feces Collection Procedure: 1. Select individual fecal pile (or section of pile) that appears to be most abnormal. 2. Using a separate wooden tongue depressor, collect up to several grams of feces from each individual dogone collection per dog per day. Highly diarrheic feces may need to be collected using a syringe. 3. Place feces into 50 mL conical plastic centrifuge tube. Tube should be no more than half full. 4. Label with Dog ID and date. 5. Store in plastic freezer bags, grouped by date and treatment group. 6. Freeze at 80 C. until shipping to the Laboratory Investigator. 7. At the end of the collection period, ship all collected feces on dry ice to arrive overnight to the Laboratory Investigator.
Example 12
Prophylaxis Pivotal Effectiveness Study
(195) The purpose of this pivotal study is to evaluate the effectiveness of Mab A v2 as a prophylactic therapy to prevent clinic signs of canine parvovirus (CPV) infection.
(196) Satisfactory completion of this study and demonstration of efficacy may support a label claim stating, This product has been shown to be effective for passive immunity of healthy dogs 13 weeks of age or older against canine parvovirus (CPV) disease.
(197) This GCP, randomized, blinded, placebo-controlled study is 14 days in length following at least a 7-day acclimation period. A total of 25 nave, CPV-2 seronegative (CPV hemagglutination inhibition (HI) titer <20) dogs are randomized to two groups (n=20 dogs in Group 1 and n=5 in Group 2) as per Table 16. Dogs are 13 weeks old on Day 0, of any sex, weigh 1.5 kg upon arrival and are in good health and free from any clinical signs of disease at study start.
(198) During acclimation, the dogs are acclimated to feeding, housing and handling procedures while being administered anthelmintic and antibiotic medications to eliminate common helminth and coccidia infections.
(199) On Day 0, all dogs are administered their assigned Mab A v2 (Group 1) or Control Product [CP; Group 2; phosphate buffered saline (PBS)] via subcutaneous (SC) injection. Mab A v2 is administered in a single 5 mg/kg dose based on body weight. The CP has a pH of 7.20.2 administered in a volume equal to Group 1. The dose for Mab A v2 and CP is calculated as follows:
{(Body weight in kg)(5 mg/kg)}{25 mg/mL}=volume in mL to be injected
(200) Local and systemic safety data are collected from Day 0 (post treatment) to Day 2. On Day 3 all dogs from both Groups 1 and 2 are administered virulent CPV-2b at a dose of approximately 110.sup.6 TCID.sub.50/mL intranasally (IN) (a volume equaling approximately 0.5 mL per nostril).
(201) At scheduled times outlined in Table 17 individual dog health is closely monitored for 14 days with physical examinations (PEs), measurement of rectal temperature (RT), cage-side CPV-2 ELISA IDEXX SNAP test (CPV SNAP test), serum hemagglutination inhibition assay (HI), fecal hemagglutination assay (HA), and hematology.
(202) The primary efficacy variable is prevention of CPV infection in Group 1 dogs as defined by the criteria of 9 CFR 113.317, (c), (3), (i): Body temp 103.4 F. Lymphopenia of 50% of pre-CPV-2b challenge normal Diarrhea, mucus and/or blood in feces Viral hemagglutinins at a level of 1:64 in a 1:5 dilution of feces (or a test of equal sensitivity)
(203) Efficacy is demonstrated if at least 80% of Group 2 (CP) dogs have at least three of the four criteria outlined in 9 CFR 113.317, (c), (3), (i) and if at least 19 Mab A v2 treated dogs remain alive and show 1 of the four possible clinical signs.
(204) See treatment groups in Table 16 below.
(205) TABLE-US-00016 TABLE 16 Number Concentration Group of Dogs Treatment Route (mg/mL) Dose 1 20 Mab A v2 SC 25 mg/mL 5 mg/kg 2 5 CP SC 25 NA Volume equivalent to Group 1
(206) Randomization. This study may require a two-step randomization. The first step is to determine which 25 dogs are enrolled in the study. Dogs are then randomized at a block size of 5 with a 4:1 ratio to Groups 1 and 2, respectively. The randomization is based on random numbers generated by the PLAN procedure in SAS (version 9.4 or later, SAS Institute, Cary NC) using the randomized selection method with a seed number.
(207) After arrival to the Test Facility, dogs are placed into cages in 2 rooms based on the order of arrival, and dogs from the same litter/block stay in the same room if possible. Dogs might get secondary exposure to virus that is shed from infected dogs. To keep a similar level of secondary virus exposure for both treatment groups and to maintain blinding to Test Facility personnel, each room contains both treatment groups. After the 25 dogs are selected, their cages are sequentially numbered from 1-25. Dogs from the same litter have adjacent cage numbers, with litters of 5 taking earlier numbers (e.g., 1-5, 6-10, etc.) per room. One room should contain cage numbers 1-10, and the other room contain cage numbers 11-25. The dogs are enrolled in the order of cage numbers in the randomization list.
(208) Masking of Study. The Investigator and all other Test Facility Personnel (excluding the Dispenser and one designated person who restrains dogs for dosing) do not have knowledge of the actual treatment group assignment at Day 0. Only the Dispenser and the person designated for restraining dogs during dosing at the Test Facility has access to actual treatment group assignment (Mab A v2 or CP) for each dog. The Dispenser and the dog restrainer/holder do not perform any study assessments.
(209) Specifications. A total of at least 27 purpose-bred, unvaccinated, CPV-2 seronegative (HI<20), healthy Beagle dogs re procured. The dogs are confirmed CPV negative via CPV SNAP test upon arrival to the Test Facility. Although the study enrollment includes 25 dogs, two additional dogs are purchased to ensure dog numbers are met after screening and acclimation. Ideally, the 27 dogs are comprised of 5 litters with 5 dogs per litter, plus 2 dogs from another litter (a partial litter).
(210) Observations
(211) Physical Examination (PE). Physical examinations are performed on all dogs by the Test Facility Veterinarian on Days 7, 0, 3, 13 and on an unscheduled basis when necessary. Physical examinations include a comprehensive assessment of all body systems, including hydration status and BW.
(212) Food Consumption. Once daily, qualitative assessment of food consumption is made in conjunction with general health observations (GHOs). All abnormalities in food consumption observed are recorded.
(213) Injection Site Observations (ISO). ISO is made at 4 hours1 hour after administration of Mab A v2/CP for clinical signs of local inflammation (e.g. erythema, heat or swelling) once daily on Day 1 and Day 2. The size of any reactions is recorded. All abnormalities observed are recorded.
(214) General Health Observations (GHOs) and Measurement of Rectal Temperature (RT). GHOs are conducted by the Test Facility Veterinarian or their designee once daily during the acclimation period from Day 7 through Day 1. GHOs are conducted every 12 hours (1 hour) from Day 0 through Day 12 or on an unscheduled basis. Beginning on Day 0, in conjunction with each GHO, the rectal temperature (RT) is also measured using a calibrated thermometer in Fahrenheit scale. General health observations include, but are not be limited to, observations of general physical appearance, abnormalities of food or water consumption, and/or occurrence of vomiting or diarrhea. The condition of all dogs, including those without abnormal signs, are documented.
(215) Cage-side CPV ELISA (CPV SNAP Test). Cage-side CPV ELISA tests are performed using the IDEXX CPV SNAP test according to the manufacturer's instructions. Preliminary CPV SNAP tests are performed on all dogs upon arrival on Day 7 from the Vendor to confirm the dogs do not have active CPV infection. Subsequent CPV SNAP tests are evaluated at a consistent time of morning on Day 0, Day 3 (prior to inoculation with virulent CPV-2b) and then once daily through study termination. CPV SNAP test data are recorded.
(216) Serum CPV-2 Hemagglutination (HI) Testing. Whole blood samples are collected (1.5 mL) from all dogs via a jugular, cephalic, or lateral saphenous vein into serum separator tubes and processed to serum at a consistent time of morning on Days 7, 0, 2, 3, 4, 6, 8, 10, and 13 with the Day 3 sample being collected prior to inoculation with virulent CPV-2b. Samples are also collected prior to unscheduled euthanasia. Samples are inventoried and expedited in shipment on dry ice to the Laboratory Investigator at the earliest opportunity. Samples are stored at frozen conditions (60 C.) until shipment. Data are recorded.
(217) Fecal CPV-2 Hemagglutination Assay (HA) Testing. A bulk fecal sample is collected from each dog on Day 0, and Day 3 through study termination at a consistent time of morning. Bulk feces is collected from each dog into a 50 mL tube, individually frozen, and kept for fecal HA testing to validate CPV SNAP test results and to meet one of the four CPV-2b infection criteria. Fecal samples are homogenized prior to HA testing to maximize accuracy of results and sample size. Procedures for collection, storage and shipping of feces follow the Laboratory Investigator's instructions. Data are recorded.
(218) CPV-2b Infection Criteria. The criteria for CPV infection are in accordance with 9 CFR 113.317, (c), (3), (i). This regulation defines the four criteria for an active CPV infection. A valid CPV-2b challenge should produce three of the four criteria in at least 80% of the challenge control dogs. Per 9 CFR 113.317 definition, the four criteria of parvovirus are as follows: Body temp 103.4 F. Lymphopenia of 50% of pre-challenge normal Diarrhea, mucus and/or blood in the feces Viral hemagglutinins at a level of 1:64 in a 1:5 dilution of feces (or a test of equal sensitivity)
(219) These four criteria are monitored daily in all dogs via q 12-hour GHOs including rectal temperature (RT), hematology at specified intervals to monitor lymphocyte counts, and CPV SNAP tests which are performed daily with results verified via fecal HA.
(220) Clinical Pathology (Hematology and Clinical Biochemistry). On Day 7 a baseline complete blood count (CBC) and biochemical profile is evaluated to verify the dogs are healthy with no pre-existing conditions. On Days 0, 3, 5, 6, 7, 8, 9, 10 and 13 blood is collected for CBC to monitor blood lymphocyte counts. The samples are collected at a consistent time each morning and recorded. Approximately 0.5 mL of blood is collected for hematology and approximately 1 mL of blood is collected for clinical biochemistry via any accessible vein (e.g. jugular, cephalic, or lateral saphenous vein). All samples are analyzed to evaluate CBC data in real-time to determine if lymphopenia has occurred which is one of the four clinical signs consistent with active CPV per 9 CFR 113.317.
(221) Effectiveness Outcomes
(222) Primary Outcome. The primary efficacy variable is prevention of CPV infection as defined by the criteria of 9 CFR 113.317, (c), (3), (i): Body temp 103.4 F. Lymphopenia of 50% of pre-CPV-2b challenge normal (Average of Days 7, 0 and 3 pre-challenge) Diarrhea, mucus and/or blood in feces Viral hemagglutinins at a level of 1:64 in a 1:5 dilution of feces (or a test of equal sensitivity) Efficacy is established if 80% of control dogs have three of the four criteria outlined in 9 CFR 113.317 and if at least 19 Mab A v2 treated dogs remain alive and show 1 of the four possible clinical signs.
(223) Second Outcomes. Secondary outcomes such as CPV SNAP test results, serum HI titers, or other parameters may be evaluated.
(224) Safety Outcomes. Dogs from this pivotal study are applied to the required number of dogs treated in the Mab A v2 Pivotal Field Safety Study. Safety evaluation is through collation of all local and systemic adverse events (AEs) from Day 0 (post-treatment) through Day 3. Specifically, dogs are monitored for injection site reactions such as erythema, heat and swellings (via daily ISO) and systemic reactions, including anaphylaxis post administration of Mab A v2. The AE data are not statistically analyzed but are summarized and tabulated for final reporting.
(225) Serious AE. A serious AE is any AE that results in death, is life-threatening, results in persistent or significant disability/incapacity, or a congenital anomaly or birth defect. The Study Investigator notifies the Clinical Development Manager within 24 hours of the occurrence of any serious AE.
(226) The schedule of events is provided in Table 17 below.
(227) TABLE-US-00017 TABLE 17 Acclimation Phase Treatment/Observation Study Day Day 7 Day 6 Day 5 Day 4 Day 3 Day 2 Day 1 Day 0 Day 1 Day 2 Day 3 GHOs .sup.1 X X X X X X X q q q q 12 12 12 12 Randomization X PE X X X Rectal Temperature q q q q (RT) 12 12 12 12 IVP/CP Dose X Intranasal CVP-2b X Challenge ISO X X X Hematology X X X Biochemistry X CPV SNAP Test.sup.2 X X X CPV-2 HI (serum) X X X X Bulk feces X X collection for CPV-2 HA (feces).sup.3 Fenbendazole X X X X X Sulfadimethoxine X X X X X Treatment/Observation Study Day Day 4 Day 5 Day 6 Day 7 Day 8 Day 9 Day 10 Day 11 Day 12 Day 13 Unscheduled GHOs .sup.1 q q q q q q q q q X X 12 12 12 12 12 12 12 12 12 Randomization PE X X Rectal Temperature q q q q q q q q q q X (RT) 12 12 12 12 12 12 12 12 12 12 IVP/CP Dose Intranasal CVP-2b Challenge ISO Hematology X X X X X X X Biochemistry CPV SNAP Test.sup.2 X X X X X X X X X X X CPV-2 HI (serum) X X X X X Bulk feces X X X X X X X X X X X collection for CPV-2 HA (feces).sup.3 Fenbendazole Sulfadimethoxine q = Every GHO = General health observation PE = Physical examination CPV-2 = Canine Parvovirus type 2 HI = Hemagglutinin inhibition assay HA = Hemagglutinin assay IVP = Investigational Veterinary Product ISO = Injection Site Observation .sup.1 GHOs occur every 24 hours during acclimation. After administration of the IVP/CP on Day 0, GHOs are increased to every 12 hours. General health observations includes, but is not limited to, observations of general physical appearance, abnormalities of food or water consumption, and/or occurrence of vomiting or diarrhea. .sup.2CPV-2 SNAP test may also be evaluated if a dog is found to have fever, lethargy, vomiting or diarrhea or other signs which the Investigator or Test Facility Veterinarian determines may indicate parvovirus infection. .sup.3Fecal HA is conducted to verify parvovirus infection and validate CPV-2 SNAP test results.
(228) The following is the Canine Parvovirus Challenge Inoculation Procedure: 1. Remove food approximately 12 hours before the challenge material is administered. Water remains available. 2. Remove the challenge material from the ultracold (80 C.) freezer and allow to thaw at room temperature approximately 1 hour before use. 3. Thaw five extra aliquots in order to have back-up doses in case of handling error. 4. Retain challenge material on wet ice until use. 5. Draw up 1 mL aliquot challenge material with a syringe one dose at a time. 6. Use syringe (without needle) with nasal canula to administer 0.5 mL into each nostril. 7. Restraint is by hand; no sedation is needed. 8. Handler holds the dog's head up with nose slightly elevated during dosing. 9. Allow a few seconds time between each nostril for the dog to swallow and be comfortable. 10. Expect that some challenge material may be expelled from the nostrils. 11. Record Dog ID, date and time on the Animal Challenge Record as dosing is completed. 12. Return food to all dogs immediately after dosing. 13. Return unused challenge material to 80 C. freezer, label as retention aliquot, date. 14. Retain aliquot until study end and return to the Laboratory Investigator.
(229) The following is the Bulk Feces Collection Procedure: 1. Select individual fecal pile (or section of pile) that appears to be most abnormal. 2. Using a separate wooden tongue depressor, collect up to several grams of feces from each individual dogone collection per dog per day. Highly diarrheic feces may need to be collected using a syringe. 3. Place feces into 50 mL conical plastic centrifuge tube. Tube should be no more than half full. 4. Label with Dog ID and date. 5. Store in plastic freezer bags, grouped by date and treatment group. 6. Freeze at 80 C. until shipping to the Laboratory Investigator. 7. At the end of the collection period, ship all collected feces on dry ice to arrive overnight to the Laboratory Investigator.
Example 13
Half-Life Degradation and Lack of Antibody Interference
(230) This in vivo study monitors degradation of Mab A v2 in vivo and evaluates the duration hemagglutination inhibition (HI) titer levels remain sufficient to neutralize vaccinal strains of CPV. The following objectives are addressed: Characterizes the half-life degradation of Mab A v2 after subcutaneous (SC) administration Determines the timeframe after administration that Mab A v2 will no longer inhibit active immunization against parvovirus (lack of antibody interference, or LOAI)
(231) Serologic monitoring of HI titers after administration of Mab A v2 may characterize the degradation half-life. LOAI is determined by active immune responses against parvovirus after vaccine administration in at least 80% of dogs within each group. Active response is defined as a four-fold increase in titer over baseline (seroconversion) with achievement of antibody titers equal to or above a 1:80 dilution as determined by HI. This level of antibody response provides immunity against canine parvovirus, as shown by challenge of immunity studies (Pollock and Carmichael, JAVMA 1982 Jan. 1; 180(1):37-42).
(232) Secondarily, safety data are collected post treatment and prior to CPV immunization which may be used contribute to the total number of dogs required to meet the 300-dog minimum requirement by the USDA-CVB to satisfy Veterinary Services Memorandum (VSM) No. 800.204.
(233) Satisfactory completion of this study and demonstration when LOAI to CPV immunization occurs may support two label claims stating: This product has been shown to passively immunize healthy dogs 13 weeks of age or older for prevention of canine parvovirus (CPV) disease. This product has been shown to be effective for the treatment of canine parvovirus (CPV) disease in dogs 13 weeks of age or older.
(234) In example 9 above, describing prior study KB-030-PK-301, Mab A v2 neutralized vaccinal CPV much like maternally derived antibody. The current study may provide information regarding the timing of CPV vaccination subsequent to administration of the Mab A v2 as a prophylactic therapy.
(235) This is a randomized, non-blinded, open label, GCP study conducted in healthy CPV seronegative Beagle dogs. The study is up to 113 days in length with a 7-day acclimation period. During acclimation, the dogs are acclimated to feeding, housing and handling procedures; and receive an anthelmintic and antibiotic medications to eliminate common helminth and coccidia infections.
(236) On Day 0, 5 mg/kg of Mab A v2 is administered SC in the interscapular region to Groups 1 and 2. Groups 3 and 4 do not receive Mab A v2. From Day 0 to Day 41, general health observations (GHOs), physical examinations (PEs) and injection site observations (ISO) are collected at various time points to monitor the dogs for any local and systemic reactions to the Mab A v2.
(237) On Day 42, one pre-assigned monovalent CPV vaccine is administered to Groups 1 and 3, and another pre-assigned monovalent CPV vaccine is administered to Groups 2 and 4. Each dog is administered the pre-assigned monovalent CPV vaccine (either Vaccine 1 or Vaccine 2) on Day 42 after serum has been collected for HI titers. If vaccinal seroconversion is not documented after the previous vaccine, a booster vaccination (2.sup.nd CPV vaccine) is administered 3 weeks after the first vaccine, on Day 63. If vaccinal seroconversion is not documented after the 2.sup.nd CPV vaccine, a third booster of the pre-assigned monovalent CPV vaccine (3.sup.rd booster) is administered on Day 84. Study Exit by individual dogs occurs upon receipt of HI results which document seroconversion. In the event that some dogs have not mounted an immune response to vaccination after Day 91 HI titers, a fourth and final monovalent CPV booster (4.sup.th booster) is administered on Day 105. Serum hemagglutination inhibition (HI) titers are measured at various time points to monitor degradation of Mab A v2 and when LOAI to CPV vaccination occurs.
(238) From Day 43 to Study Exit, GHOs and PEs are collected at various time points to monitor the dogs for general health.
(239) The two monovalent CPV vaccines to be preassigned and administered in the study are:
(240) TABLE-US-00018 Vaccine 1 Registered name: Nobivac Canine 1-PV Vaccine: Canine parvovirus (modified live) Pharmaceutical form: Sterile injectable solution Test dose: 1 mL (1 dose) Route of administration: Subcutaneous Manufacturer: Merck Animal Health Packaging: Individual vials per manufacturer packaging Storage conditions: 2-7 C. Accountable unit: 1 vial Vaccine 2 Registered name: Recombitek Vaccine: Canine parvovirus (modified live) Pharmaceutical form: Sterile injectable solution Test dose: 1 mL (1 dose) Route of administration: Subcutaneous Manufacturer: Merial Packaging: Individual vials per manufacturer packaging Storage conditions: 2-7 C. Accountable unit: 1 vial
(241) See treatment groups in Table 18 below.
(242) TABLE-US-00019 TABLE 18 Concen- Monovalent Number Treat- tration Vaccine to be Group of Dogs ment Route (mg/mL) Dose Administered 1 10 Mab SC 25 5 Vaccine 1 A v2 mg/mL mg/kg 2 10 Mab SC 25 5 Vaccine 2 A v2 mg/mL mg/kg 3* 5 None NA NA NA Vaccine 1 4* 5 None NA NA NA Vaccine 2 Vaccine 1 = Nobivac Canine 1-PV (Merck); Vaccine 2 = Recombitek (Merial)
(243) Randomization. Dogs (13 weeks old on Day 0, of any sex, and weighing 1.5 kg) are randomized at a 2:2:1:1 ratio to Groups 1 through 4 on or before Day 0 using a randomization list provided by the Sponsor's Study Programmer. Treatment is randomly assigned within each block of 6 dogs. The randomization is based on random numbers generated by the PLAN procedure in SAS (SAS Institute, Cary NC, version 9.4 or later) using the randomized selection method with a seed number.
(244) Observations
(245) Physical Examinations (PEs). PEs are performed on all days on Days 7, 0, Study Exit and on an unscheduled basis when necessary. Physical examinations include a comprehensive assessment of all body systems, including hydration status and body weight (BW).
(246) Injection Site Observations (ISOs). On Day 3 the injection site is clipped in preparation for dosing on Day 0. Prior to dosing, the clipped injection site is evaluated and recorded as free of any inflammation or clipper burn. Beginning on Day 0, the injection site is evaluated once daily through Day 14 for local injection site reactions including but not limited to erythema, heat, and swelling (e.g. nodule). The size of any reactions is recorded. Any injection site reaction observed is documented on the Injection Site Observation Form and is recorded as an adverse event (AE).
(247) General Health Observations (GHOs). GHOs are conducted by the Study Investigator or a designee once daily from Day 7 through Study Termination. General health observations include, but are not limited to, observations of general physical appearance, abnormalities of food or water consumption, and/or occurrence of vomiting or diarrhea. The condition of all dogs, including those without abnormal signs, is documented on the General Health Observation Form for each dog at each observation period. On Days 7, 0 and Study Exit when PEs are conducted, the PE replaces the GHO.
(248) Serum CPV-2 Hemagglutination (HI) Testing. Whole blood samples are collected (approximately 1.5 mL) from all dogs via a jugular, cephalic, or lateral saphenous vein and are placed into serum separator tubes and processed to serum on Days 7, 0, 1, 7, 14, 21, 28, 35, 42, 49, 56, 63, 70, 77, 84, 91, 98, 105, 112. If seroconversion is documented on HI, subsequent scheduled sampling ceases, and the individual dog exits the study. Samples are stored at frozen conditions (60 to 80 C.) until they are delivered to the Analytical Laboratory at the earliest opportunity.
(249) Clinical Pathology. On Day 7 a baseline complete blood count (CBC) and biochemical profile are evaluated to verify the dogs are healthy with no pre-existing conditions. Approximately 0.5 mL of blood is collected for hematology and approximately 1 mL is collected for clinical biochemistry from the jugular, cephalic, or lateral saphenous vein.
(250) Adverse Events (AE). An AE is defined as any observation in dogs that is unfavorable, unexpected, and unintended, and occurs after the use of a veterinary product, whether or not considered to be product related. Once experimental treatment is initiated (Day 0 when Mab A v2 is administered), any abnormal GHO, PE, or ISO is considered an AE.
(251) Primary Endpoint. The primary endpoint for each group is the number of days from Day 0 to the time when 80% of dogs within the group have demonstrated CPV seroconversion via serum HI titers to the monovalent CPV vaccination. Seroconversion is defined as a four-fold increase in titer over baseline with achievement of antibody titers equal to or above a 1:80 dilution as determined by serum HI titers. The number of dogs per group that have demonstrated an immune response to vaccines and the study day when this occurred is not statistically analyzed but summarized and tabulated for final reporting.
(252) See the schedule of events in Table 19 below.
(253) TABLE-US-00020 TABLE 19 Mab Serum Clip 1.sup.st 2.sup.nd 3.sup.rd 4.sup.th General A v2 CPV-2 Clinical Hair at Monovalent Monovalent Monovalent Monovalent Study Fenbendazole & Random- Body Physical Health Admin- Injection Site HI Bio- Injection CPV CPV CPV CPV Day Sulfadimethoxine ization.sup.1 Weight Exam Observations istration Observations.sup.2 Testing CBC chemistry Site vaccine vaccine.sup.3 Vaccine.sup.3 Vaccine.sup.3 7 X X X X X X 6 X X 5 X X 4 X X 3 X X X 2 X 1 X 0 X X X X X X 1 X X X 2-6 X X 7 X X X 8-13 X X 14 X X X 15-20 X 21 X X 22-27 X 28 X X 29-34 X 35 X X 36-41 X 42 X X X 43-48 X 49 X X 50-55 X 56 X X 57-62 X 63 X X X 64-69 X 70 X X 71-76 X 77 X X 78-83 X 84 X X X 85-90 X 91 X X 92-97 X 98 X X 99-104 X 105 X X X 106-111 X 112 X X X .sup.1Randomization occurs on or before Day 0. .sup.2Injection Site Observations for clinical signs of intolerance (e.g. erythema, heat, swelling) are made daily from Day 0, prior to dosing and after dosing, through Day 14. All abnormal observations are characterized (e.g. size of swelling) and documented on the Injection Site Observation CRF .sup.32.sup.nd, 3.sup.rd, and 4.sup.th CPV vaccines are only administered to dogs who have not demonstrated seroconversion from the previous vaccine
Example 14
Multi-Center, Pivotal Safety Study in Healthy Dogs
(254) This in vivo field safety study evaluates the local and systemic tolerance of MabA v2. Individual dogs are observed for injection site inflammation (including but not limited to erythema, heat and/or swelling) and for systemic reactions (e.g. anaphylaxis).
(255) A minimum of 300 dogs are administered Mab A v2, either via subcutaneous (SC) (n=150) or via intravenous (IV) (n=150) routes. The safety data collected during this study is intended to meet the pivotal field safety 300-dog requirement for the United States Department of Agriculture Center for Veterinary Biologics (USDA-CVB).
(256) Satisfactory completion of this study and demonstration of safety may support two label claims stating: This product has been shown to be effective for passive immunity of healthy dogs 10 weeks of age or older for prevention of canine parvovirus (CPV) disease. This product has been shown to be effective for the treatment of canine parvovirus (CPV) disease in dogs 10 weeks of age or older.
(257) This is a randomized, non-masked, GCP field safety study conducted in young, healthy, purpose-bred dogs. This study is 16 days in length at each study site. At least 100 minimum age dogs (10 weeks of age) of any gender, and at least 200 dogs older than the minimum age (>10 weeks of age) of any gender, are enrolled into the study.
(258) Exclusion criteria. The dog: Is currently enrolled in another study. Has been enrolled in another study within the previous 30 days. Has received chimeric biologics 90 days prior to Day 2. Is not cooperative for study procedures. Is not reasonably expected to survive the duration of the study. Has any pre-existing skin conditions which may confound ISOs. Has current medical history suggesting a significant comorbidity (e.g., polyuria, polydipsia, polyphagia, vomiting or diarrhea, unexplained weight loss, etc.).
(259) The minimum age dogs are located in one site (Ridglan Farms (Mount Horeb, WI)) whereas the remaining dogs are divided among Test Facilities in three geographic regions. A minimum of three Test Facilities located in three separate geographical regions and unique breeding colonies to diversify genetics as much as possible are used. At each site, dogs are randomized 1:1:1:1 to Groups 1, 2, 3 and 4 as per Table 20.
(260) On Day 0, all dogs are administered Mab A v2 either SC or IV. Two different pre-licensing serials (PLS) of Mab A v2 are administered in this study. Within each age group and treatment method group, approximately half of the dogs randomly receive PLS No. 1 and the other half randomly receive PLS No. 2.
(261) Dose volume is calculated in mL by the EDC system based on Day 0 body weight (BW). The dose is calculated by the EDC System as follows:
{(Body weight in kg)(5 mg/kg)}{TBD mg/mL}=volume in mL to be injected
(262) Subcutaneous doses are administered into the subcutis of the interscapular region. Intravenous doses re administered in a cephalic vein.
(263) At scheduled times outlined in Table 20, individual dog health is closely monitored via physical examinations (PEs), injection site observations (ISO) and general health observations (GHOs).
(264) Safety evaluation is through collation of all adverse events (AEs). Specifically, dogs are monitored for injection site reactions such as erythema, heat or swelling (via daily ISO) and for systemic reactions, including anaphylaxis, post administration of Mab A v2. The AE data are not statistically analyzed but are summarized and tabulated.
(265) See treatment groups in Table 20 below.
(266) TABLE-US-00021 TABLE 20 Number of Dogs Number of Dogs of Minimum Age of Older Age Mab A v2 Concentration Group (10 weeks) (>10 weeks) Treatment Route (mg/mL) Dose 1 25 50 PLS No. 1 SC TBD 5 mg/kg 2 25 50 PLS No. 2 SC TBD 5 mg/kg 3 25 50 PLS No. 1 IV TBD 5 mg/kg 4 25 50 PLS No. 2 IV TBD 5 mg/kg
(267) Randomization. Due to challenges with finding Test Facilities with appropriately aged dogs, the approximately 100 minimum age dogs is sourced from one location. Approximately 200 remaining dogs are divided among Test Facilities in at least three geographic regions and are divided as evenly as possible amongst the Test Facilities. Randomization is stratified by the Test Facility site into blocks containing four dogs. Within each site, dogs are randomized at a 1:1:1:1 ratio to Groups 1 (PLS No. 1, SC), 2 (PLS No. 2, SC), 3 (PLS No. 1, IV), and 4 (PLS No. 2, IV). The randomization is based on random numbers generated by the PLAN procedure in SAS (SAS Institute, Cary NC, version 9.4 or later) using the randomized selection method with a seed number.
(268) Acclimation. This study is conducted in Test Facilities where the dogs are previously acclimated to diet, housing, handling procedures, etc. Therefore, only a 2 day acclimation phase is implemented to ensure dogs meet the enrollment criteria and to clip the injection sites on Day 2.
(269) Physical Examination (PE). A PE is performed by on site veterinarian on Days 2, 0 (pre-dose), 7, and 14. PEs include a subjective assessment of general appearance and attitude, otic, ocular, oral, mucous membranes, respiratory, cardiovascular, gastrointestinal, neurologic, musculoskeletal, integumentary and genitourinary. VeDDRA low level terminology is utilized to describe specific PE abnormalities. Abnormalities (excluding pre-existing conditions and worsening abnormalities) recorded after Day 0 are considered as AEs.
(270) Injection Site Observations (ISO). On Day 2 the injection site is clipped in preparation for dosing on Day 0. Prior to treatment, the clipped injection site is evaluated and recorded as free of any inflammation or clipper burn. Beginning on Day 0 through Day 14, the injection site location is evaluated once daily for local injection site reactions including but not limited to erythema, heat, swelling (e.g. nodule). The size of any reactions is recorded. Any injection site reaction observed is recorded as an AE.
(271) General Health Observations (GHOs). GHOs re conducted once daily beginning on acclimation through study end with one exception: On Days 2, 0, 7 and 14 when PEs are performed, the PE replaces the GHO. General health observations include, but are not limited to, observations of general physical appearance, abnormalities of food or water consumption, and/or occurrence of vomiting or diarrhea. VeDDRA low level terminology is utilized to describe specific observations. The condition of all dogs, including those without abnormal signs, is documented.
(272) Body weights. On Day 0, BW (recorded in kilograms (kg)) is measured using a calibrated scale and recorded. Dogs may be weighed fed or fasted. Body weights are documented.
(273) Safety Population. The safety population consists of all dogs who receive Mab A v2.
(274) Safety Outcomes. Safety evaluation is through collation of all AEs. Specifically, dogs are monitored for injection site reactions such as erythema, heat or swelling (via daily ISO) and systemic reactions, including anaphylaxis post administration of Mab A v2. The AE data are not statistically analyzed but are summarized and tabulated.
(275) Adverse Events (AE). An AE is defined as any observation in dogs that is unfavorable, unexpected, and unintended, and occurs after the use of a veterinary product, whether or not considered to be product related. All AEs are documented and recorded using low level VEDDRA terms.
(276) Serious AE. An AE that is fatal or life-threatening or requires professional intervention (e.g., the dog's health is such that the Investigator determines that the dog should either be euthanized or receive medical treatment).
(277) Non-Serious AE. An AE that is not severe enough to require professional intervention or removal of the dog from the study.
(278) See the schedule of events in Table 21 below.
(279) TABLE-US-00022 TABLE 21 Event Day 2 Day 0 Days 1-6 Day 7 Days 8-13 Day 14 Unscheduled Clip Hair Over Injection Site Inclusion/Exclusion Criteria Signalment Physical Exam with Body Weight Mab A v2 Administration General Health Observations (GHOs)* Injection Site Observation (ISO)** Record Adverse Events Study Exit *GHOs include, but are not limited to, observations of general physical appearance, abnormalities of food or water consumption, and/or occurrence of vomiting or diarrhea. *The injection site is evaluated once daily from Days 0 to 14 for clinical signs of local inflammation (including but not limited to erythema, heat, swelling, nodules). Size of reactions are recorded.
Example 15
Identification of Variant Canine IgG-B Fc Polypeptides for Enhanced ADCC Activity
(280) Structural models of canine CD16 and canine IgG-B Fc were prepared using the structural coordinates of human IgG1 Fc/CD16 complex (1e4k1.pdb) as template. See Sondermann P., The 3.2-A Crystal Structure of the Human IgG1 Fc Fragment-Fc gammaRIII complex, Nature 406(6793):267-73 (2000). Amino acid residues that appear to interact between wild-type canine IgG-B Fc (SEQ ID NO: 91) and canine CD16 (SEQ ID NO: 90) were identified. Both Ser10 and Ile103 of canine IgG-B Fc SEQ ID NO: 91 are in close proximity to Lys148 of canine CD16 SEQ ID NO: 90. To gain electrostatic interaction, Ser10 and/or Ile103 of canine IgG-B Fc SEQ ID NO: 90 may be substituted with acidic amino acids Asp or Glu to introduce a salt bridge to K148 of canine CD16 SEQ ID NO: 90. The distance between Ser10Asp and Lys148; between Ser10Glu and Lys148; between Ile103Asp and Lys148; and between Ile103Glu and Lys148 are each less than 4 (
REFERENCES
(281) 1. S. Nandi, Manoj Kumar. Canine Parvovirus: Current Perspective. Indian J. Virol. 2010; 21(1):31-44. 2. Carla Miranda, Gertrude Thompson. Canine parvovirus: the worldwide occurrence of antigenic variants. Journal of General Virology. 2016; 97, 2043-2057. 3. Melissa Kennedy, Adesola Odunayo. Canine Parvovirus. Clinician's Brief. 2017. 4. Brindhalakshmi B, Mukhopadhyay H K, Antony P X, Thanislass J, Vijayalakshmi P, Mangadevi N. Isolation and molecular characterization of canine and feline parvovirus strainsan updated review. Journal of Dairy, Veterinary & Animal Research. 2016; 3(5):164-169. 5. Emilee Venn, Karolina Preisner, Pedro Boscan, David Twedt, Lauren A. Sullivan. Evaluation of an outpatient protocol in the treatment of canine parvoviral enteritis. Journal of Veterinary Emergency and Critical Care. 2017; 27(1):52-65.