Mutant protein for improving malic acid yield

12421511 ยท 2025-09-23

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides a class of new mutant proteins for increasing malic acid yield. Specifically, the present invention provides a class of new pyruvate carboxylase mutant protein and malic acid transporter mutant proteins or combinations thereof, a preparation method therefor and use thereof in improving malic acid yield.

Claims

1. A pyruvate carboxylase mutant protein, wherein the pyruvate carboxylase mutant protein has one or more amino acid mutations at positions corresponding to the amino acid sequence as shown in SEQ ID NO: 1 selected from the group consisting of: A762D, A762P, A762V, A762T, P826E, P826Q, P826Y, P826T, P826D and P826I; wherein the pyruvate carboxylase mutant protein has an activity of carboxylation of pyruvate into oxaloacetate, and wherein the amino acid sequence of the pyruvate carboxylase mutant protein has at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1.

2. The pyruvate carboxylase mutant protein of claim 1, wherein the amino acid sequence of the pyruvate carboxylase mutant protein has amino acid mutations at the following positions, as compared with SEQ ID NO: 1: A762D and P826E; A762D and P824V; P824V and P826E; P824V and P1031E; or A762D, P826E and P1031E.

3. The pyruvate carboxylase mutant protein of claim 1, wherein the pyruvate carboxylase mutant protein has the amino acid sequence of any one of SEQ ID NOs: 2-20, and 175.

4. An isolated polynucleotide, encoding the pyruvate carboxylase mutant protein of claim 1.

5. A vector comprising the isolated polynucleotide of claim 4.

6. A host cell, wherein the isolated polynucleotide of claim 4 is integrated into the genomic nucleic acid of the host cell; or wherein the host cell contains a vector, wherein the vector comprises the isolated polynucleotide of claim 4.

7. A method for obtaining the pyruvate carboxylase mutant protein of claim 1, comprising the steps of: i) culturing a host cell comprising a polynucleotide, which encodes the pyruvate carboxylase mutant protein of claim 1, under conditions suitable for expression of the pyruvate carboxylase mutant protein, thereby expressing the pyruvate carboxylase mutant protein of claim 1; and ii) isolating the expression product, thereby obtaining the pyruvate carboxylase mutant protein of claim 1.

8. A method for increasing the yield of malic acid, which comprises the steps of: i) introducing a polynucleotide encoding the pyruvate carboxylase mutant protein of claim 1 into a host cell; ii) in the presence of a carbon source, culturing the host cell, thereby expressing the pyruvate carboxylase mutant protein of claim 1; iii) converting pyruvate to oxaloacetate in the presence of the expressed pyruvate carboxylase mutant protein of claim 1, thus obtaining oxaloacetate in a higher yield than using the wild-type pyruvate carboxylase protein as shown in SEQ ID NO: 1; iv) subjecting oxaloacetate in the higher yield to an apple dehydrogenase then to a mutant malate transporter; and thus v) increasing the yield of malic acid from using the wild-type malate transporter as shown in SEQ ID NO: 22.

9. The method of claim 8, wherein the pyruvate carboxylase mutant protein has the amino acid sequence of any one of SEQ ID NOs: 2-20, and 175.

10. The method of claim 8, wherein the mutant malate transporter has the amino acid sequence of any one of SEQ ID NOs: 23-42, and 176.

11. A vector comprising the isolated polynucleotide of claim 4 and a polynucleotide encoding a malate transporter, wherein the malate transporter has the amino acid sequence as shown in SEQ ID NO: 22, or has the amino acid sequence of SEQ ID NO: 22 except for one or more amino acid mutations selected from the group consisting of: I80K, I80W, I80C, R272A, and R272F.

12. A host cell containing the vector of claim 11.

13. The pyruvate carboxylase mutant protein of claim 1, wherein the amino acid sequence of the pyruvate carboxylase mutant protein has an amino acid mutation as compared with SEQ ID NO: 1 selected from the group consisting of: P826E, P826Q, P826Y, P826T, P826D and P826I.

14. The pyruvate carboxylase mutant protein of claim 1, wherein the amino acid mutations comprise (a) one mutation selected from the group consisting of: A762D, A762P, A762V and A762T; and (b) an optional mutation selected from the group consisting of P826E, P826Q, P826Y, P826T, P826D and P826I; and wherein the pyruvate carboxylase mutant protein has an activity of carboxylation of pyruvate into oxaloacetate, and the amino acid sequence of the pyruvate carboxylase mutant protein has at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 1.

15. The pyruvate carboxylase mutant protein of claim 13, wherein the sequence of the pyruvate carboxylase mutant protein has amino acid mutation(s) at the following position(s), as compared with SEQ ID NO: 1: P826E; A762D and P826E; P824V and P826E; P826E and P1031E; A762D, P826E and P1031E; P824V, P826E and P1031E; or A762D, P824V, P826E and P1031E.

16. The pyruvate carboxylase mutant protein of claim 1, wherein the pyruvate carboxylase mutant protein has the amino acid sequence of any one of SEQ ID NOs: 3, 10, 12, 14, 16, 17, 19 and 20.

17. The pyruvate carboxylase mutant protein of claim 1, wherein the pyruvate carboxylase mutant protein has an activity (cA1) of converting pyruvic acid into oxaloacetate via carboxylation, wherein the activity cA1 is higher than the corresponding activity (cA0) of the wild-type pyruvate carboxylase as shown in SEQ ID NO: 1, and wherein cA1cA0)/cA0 is equal to or more than 15%.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows a map of the pyc expression plasmid.

(2) FIG. 2 shows a map of the mdh expression plasmid.

(3) FIG. 3 shows a map of mdh and pyc tandem expression plasmid.

(4) FIG. 4 shows a map of a plasmid for comparative expression and directed evolution of dicarboxylic acid transporter.

(5) FIG. 5 shows a map of the Aomae expression plasmid.

(6) FIG. 6 shows a map of pyc directed evolution engineered plasmid.

(7) FIG. 7 shows the effect of malic acid production by overexpression of pyc and mdh and overexpression of different homotransporters on malate production.

(8) FIG. 8 shows the preliminary screening of the modified inoculating plate based on the hydrolyzed circle for transporter screening.

(9) FIG. 9 shows the effect of Aomae I80 saturation mutation on malic acid production. Among them, I80K, I80W, and I80C increased malic acid production by 14.3%, 11.3%, and 11.5%, respectively.

(10) FIG. 10 shows the effect of Aomae V142 saturation mutation on malic acid production. Among them, V142I, V142S and V142C increased malic acid production by 21.1%, 16.2% and 14.1%, respectively.

(11) FIG. 11 shows the effect of Aomae R272 saturation mutation on malic acid production. Among them, R272A and R272F increased malic acid production by 21% and 22.1%, respectively.

(12) FIG. 12 shows the effect of Aomae E8 saturation mutation on malic acid production. Among them, E8Q, E8Y, E8R, and E8P increased malic acid production by 15.5%, 10.3%, 9.3%, and 10.7%, respectively.

(13) FIG. 13 shows the effect of Aomae I109 saturation mutation on malic acid production. Among them, 1109M and 1109P increased malic acid production by 12% and 10.2%, respectively.

(14) FIG. 14 shows the effect of Aomae S123 saturation mutation on malic acid production. S123, S123H, S123R, and S123D increased malic acid production by 27.4%, 28.2%, 23.4%, and 23.6%, respectively.

(15) FIG. 15 shows the effect of Aomae I301 saturation mutation on malate production. I301W, I301F, I301H, I301K, and I301Y increased malate production by 25.2%, 18.6%, 18.3%, 17.6%, and 17.6%, respectively.

(16) FIG. 16 shows the effect of Aomae P163 saturation mutation on malic acid production. Among them, P163I, P163V, P163F, P163L, P163Q, P163Y increased malic acid production by 27.4%, 25.2%, 20.6%, 18.1%, 16.5% and 15.3%, respectively,

(17) FIG. 17 shows the effect of Aomae F101 saturation mutation on malic acid production. Among them, F101Y and F101W increased malic acid production by 25% and 21%, respectively.

(18) FIG. 18 shows the effect of Aomae L140 saturation mutation on malic acid production. Among them, L140N, L140K and L140H increased malic acid production by 22%, 10% and 20%, respectively.

(19) FIG. 19 shows the effect of Aomae F97 saturation mutation on malic acid production. Among them, F97V and F97R increased malic acid production by 25% and 22.7%, respectively.

(20) FIG. 20 shows the effect of Aomae A191 saturation mutation on malic acid production. Among them, A191R and A191K increased malic acid production by 29.2% and 22.6%, respectively.

(21) FIG. 21 shows the effect of Aomae Y115 saturation mutation on malic acid production. Among them, Y115E and Y115L increased malic acid production by 28% and 16%, respectively.

(22) FIG. 22 shows the effect of Aomae A214 saturation mutation on malic acid production. Among them, A214V, A214G and A214D increased malic acid production by 25%, 22.1% and 21.3%, respectively.

(23) FIG. 23 shows the effect of Aomae F201 saturation mutation on malic acid production. Among them, F201Q, F201G, F201K, and F201N increased malic acid production by 32%, 22%, 18%, and 19%, respectively.

(24) FIG. 24 shows the effect of Aomae H227 saturation mutation on malic acid production. Among them, H227F and H227W increased malic acid production by 22% and 18%, respectively.

(25) FIG. 25 shows the effect of Aomae E222 saturation mutation on malic acid production. Among them, E222S and E222G increased malic acid production by 22% and 22%, respectively.

(26) FIG. 26 shows the effect of Aomae M251 saturation mutation on malic acid production. Among them, M251E and M251G increased malic acid production by 28% and 23%.

(27) FIG. 27 shows the effect of Aomae combination mutation on malic acid production. Among them, I80K/R272A can increase malic acid production by more than 30%.

(28) FIG. 28 shows the effect of pyc from different sources on malic acid production. Among them, the production of malic acid by Corynebacterium glutamicum is up to 53.2 g/L.

(29) FIG. 29 shows the preliminary screening of PYC based on the hydrolysis circle on an inoculating plate

(30) FIG. 30 shows the effect of CgPyc H51 saturation mutation on malic acid production. Among them, H51N and H51G increased malic acid production by 19% and 18%, respectively.

(31) FIG. 31 shows the effect of CgPyc F453 saturation mutation on malic acid production. Among them, F453E and F453P increased malic acid production by 17% and 17%, respectively.

(32) FIG. 32 shows the effect of CgPyc A254 saturation mutation on malic acid production. Among them, A254K, A254E, A254R and A254F increased malic acid production by 19%, 17%, 16% and 15%, respectively.

(33) FIG. 33 shows the effect of CgPyc G837 saturation mutation on malic acid production. Among them, G837D and G837H increased malic acid production by 24% and 17%, respectively.

(34) FIG. 34 shows the effect of CgPyc P824 saturation mutation on malic acid production. Among them, P824V, P824A, P8241, P824Y, P824L, P824M, P824N, P824R, P824T increased malic acid production by 29.4%, 28.2%, 25.9%, 22.4%, 23.5%, 23.5%, 23.6%, 23.2%, 20%, respectively.

(35) FIG. 35 shows the effect of CgPyc A762 saturation mutation on malic acid production. Among them, A762D, A762P, A762V and A762T increased malic acid production by 33.5%, 30.6%, 29.6% and 22.4%, respectively.

(36) FIG. 36 shows the effect of CgPyc P826 saturation mutation on malic acid production. Among them, P826E, P826Q, P826Y, P826T, P826D, P826I increased malic acid production by 28.3%, 20.9%, 24.1%, 22.9%, 20.9%, and 21.6%, respectively.

(37) FIG. 37 shows the effect of CgPyc P1031 saturation mutation on malic acid production. Among them, P1031E, P1031N, P1031S, and P1031G increased malic acid production by 34.2%, 30.8%, 128.2%, and 122.2%, respectively.

(38) FIG. 38 shows the effect of CgPyc combination mutations on malate production. Among them, A762D/P826E, A762D/P824V, P824V/P826E, P824V/P1031E, A762D/P826E/P1031E increased malate production by 41.4% and 38.6%, 36.7%, 37.1%, and 42.3% respectively.

(39) FIG. 39 shows Saccharomyces cerevisiae which expresses PYC, AoMae, and MDH to produce malate, and the three gene co-expressing strain could produce 22 g/L malate.

(40) FIG. 40 shows malic acid production of a strain which overexpresses mutant malic acid transporter. Among them, the overexpression mutant having Aomae I80K/R272A increased malic acid production by 9.5%.

(41) FIG. 41 shows malic acid production of a strain which overexpresses mutant pyruvate carboxylase. Among them, overexpression mutant having CgPYC A762D/P826E/P1031E increased malic acid production by 16%.

DETAILED DESCRIPTION OF THE INVENTION

(42) After extensive and extensive research, the inventors have unexpectedly discovered for the first time that, after the catalytic machinery and transporter for malate synthesis were modified, that is, after the core the amino acid of specific sites of pyruvate carboxylase and malate transporter is mutated, the ability of the microbial strain to produce malic acid has been significantly improved, so that more pyruvate precursor can flow to the target product malic acid, thereby effectively increasing malic acid production. Specifically, the inventors first constructed a high-throughput screening scheme for malate synthesis coupling in Pichia pastoris, compared pyruvate carboxylase and malate transporters from different sources, and found the target protein to be modified. The inventors constructed random mutation libraries for the two target proteins separately, and obtained multiple pyruvate carboxylase and malate transporter mutants with increased malate production after multiple screenings, and then performed single amino acid saturation mutation and combination mutation to obtain pyruvate carboxylase mutants with improved catalytic activity and malate transporter mutants with improved malate transport capacity, and constructed a series of engineering strains for the efficient synthesis of malate. On this basis, the invention is completed.

(43) Malic Acid and its Synthesis

(44) Malic acid (2-hydroxy-1,4-succinic acid) is an important platform compound and is widely used in the pharmaceutical, cosmetic, food and beverage industries.

(45) There are currently five main routes reported for malate synthesis, namely TCA cycle, reduced TCA (or reverse TCA) or rTCA, cyclic glyoxylic acid cycle and non-cyclic glyoxylic acid cycle, and reverse catalyzation of pyruvate into malic acid via malic enzyme. Among them, the rTCA cycle and the malic enzyme pathway are the most effective. The theoretical conversion rate of glucose to malic acid is 2. However, malic enzyme mainly catalyzes the decomposition of malic acid into pyruvate. Therefore, the most common method is the rTCA pathway for synthesizing malic acid.

(46) Starting from glucose, it is converted into pyruvate by glycolysis, and pyruvate is converted into oxaloacetate by pyruvate carboxylase, and oxaloacetate is converted into malate by malate dehydrogenase. Malate is transported out of cell by a transporter. The conversion efficiency of each step in the process, the side reaction diversion, the coenzyme that catalyzes each step of the reaction, and reducibility and the energy state of cells will all affect the synthesis of malic acid.

(47) In the past, the synthesis was mainly based on chemical methods. However, these processes mainly produced a mixture of D- and L-malic acid, which was difficult to separate. However, the microbiology method of the present invention can synthesize high-purity L-malic acid.

(48) Pyruvate Carboxylase

(49) Pyruvate carboxylase (PYC) is one of the key enzymes involved in the central metabolic pathway in the organism. It forms oxaloacetate through the carboxylation of pyruvate and participates in the TCA cycle. This reaction is also the first step of the gluconeogenesis pathway. Most pyruvate carboxylase is composed of four identical subunits, the molecular weight of a single subunit is 120-130 kDa, and the molecular weight of the functional tetramer is about 520 kDa. Pyruvate carboxylase requires tetramerization to function. The protein after tetramerization is as much as 520 kDa, which is difficult to secrete out of the cell. Although pyruvate carboxylase can be screened by measuring enzyme activity, since it only resides in the cell, it is necessary to break the cell to perform enzyme activity measurement. If it is difficult to carry out the cell-breaking treatment for all mutants in a mutation library, it is very difficult to improve the protein. At present, there are only a few site-directed mutations that target complex formation based on the crystal structure of such complex-forming proteins and very few mutants are involved. No protein engineering modification has been done for CgPYC without crystal structure.

(50) The pyruvate carboxylase of the present invention is derived from Corynebacterium glutamicum and its wild-type (named CgPYC) has a sequence number of WP_011013816.1, as shown in SEQ ID NO: 1, and its encoding nucleic acid is shown in SEQ ID NO: 21, which is for the first time used in malate synthesis strains. By constructing random mutations, site-directed mutations and combined mutations, multiple single point mutations that can significantly increase malate synthesis Pichia pastoris by more than 30%, and two double and triple mutations that increase malate by more than 40% are obtained. Meanwhile, the mutant protein can increase malic acid by 16% in Myceliophthora thermophila.

(51) Malate Transporter

(52) Malate transporter plays an important role in the synthesis of malate. The transporters used in the present invention for malate production are mainly from Aspergillus oryzae (A0090023000318 (C4T318)), wherein the wild-type protein sequence (named AoMae) is shown in SEQ ID NO: 22, and its encoding nucleic acid is shown in SEQ ID NO: 43; or from Schizosaccharomyces pombe (NM 001020205.2) and DCT from Aspergillus carbonarius (AQW79505.1), wherein the theoretical molecular weight of the key AoMae protein is 42.2 kDa.

(53) The malate transporter Aomae is a membrane protein. The usual evaluation standard for membrane proteins is to measure the substrate transport ability. The protein needs to be purified, constructed in liposomes, or constructed in a strain without similar function and having multiple gene knockout, and then measured by isotope-labeled substrates. In addition, the transport is divided into efflux type and internal transport type, and the protein consistency of the membrane protein is generally low. All these factors make it very difficult to modify membrane protein.

(54) In the present invention, through random mutation, site-directed mutation and combined mutation, a series of mutation sites were obtained to significantly improve the level of malic acid synthesis. Among them, I80K/E8Q/R272A and I80K/R272A can improve malate synthesis in Pichia pastoris by more than 10%. Malic acid can also be increased by 10.5% in Myceliophthora thermophila.

(55) Mutant Protein and its Derivatives

(56) It is known to the skilled in the art that if a certain enzyme is to be mutated in order to obtain a mutant with improved activity, the key point is to find a site where the activity can be improved after the mutation. In the present invention, enzymes whose amino acid sequences are shown in SEQ ID NO: 1 and 22 are mutated at specific sites to obtain corresponding mutants with significantly improved activity. As used herein, the terms mutant protein and mutant are used interchangeably and refer to the mutant protein of pyruvate carboxylase and/or malate transporter, and the correspondence of the mutant protein of pyruvate carboxylase or mutant protein of malate transporter can be obtained accordingly in the context of context. Specifically, the pyruvate carboxylase mutant protein of the present invention generally refers to the sequence shown in SEQ ID NO: 1 and/or 22 (wild-type), and after modification, it has one or more core amino acid mutations selected at the following sites. (1) When the mutation is performed based on the sequence of SEQ ID NO: 1, it may have one or more core amino acid mutations as follows: A762D, A762P, A762V or A762T; P826E, P826Q, P826Y, P826T, P826D or P826I; P824V, P824A, P8241, P824Y, P824L, P824M, P824N, P824R, or P824T; P1031E, 1031S, P1031N or P1031G; P824V, P824A, P8241, P824Y, P824L, P824M, P824N, P824R, or P824T; P1031E, 1031S, P1031N or P1031G; G837D, or G837H; A254K, A254E, A254R, or A254F; H51N, or H51G; and/or F453E, or F453P; and the pyruvate carboxylase mutant protein has the activity of carboxylation of pyruvate into oxaloacetate, a precursor for synthesizing malate.

(57) A preferred pyruvate carboxylase mutant protein, based on a sequence as shown in SEQ ID NO: 1, has one or more core amino acid mutations selected from the group consisting of: A762D and P826E; A762D and P824V; P824V and P826E P824V and P1031E; or A762D, P826E and P1031E.

(58) The sequence of a preferred pyruvate carboxylase mutant protein is shown in any of SEQ ID NOs: 2-20, and 175. (2) When the mutation is performed based on the sequence of SEQ ID NO: 22, it may have one or more core amino acid mutations as follows: I80K, I80W, or I80C; R272A, or R272F; E8Q, E8Y, E8R, or E8P; V142I, V142S or V142C; F97V, or F97R; F101Y, or F101W; Y115E; S123K, S123H, S123R, or S123D; I301W, I301F, I301H, I301K, or I301Y; L140N, L140H, or L140K; P163I, P163V, P163F, P163L, P163Q, or P163Y; A191R, or A191K; F201Q, F201G, F201N or F201K; E222S, or E222G; H227F, or H227W; and/or M251E, or M251G; and the mutant malate transporter has the activity of transporting malate from inside to outside of a cell.

(59) A preferred mutant malate transporter, based on a sequence as shown in SEQ ID NO: 22, has one or more core amino acid mutations selected from the group consisting of: I80K and R272A; or I80K, E8Q and R272A.

(60) The sequence of a preferred mutant malate transporter is shown in any of SEQ ID NOs: 23-42, and 176.

(61) TABLE-US-00001 SEQIDNo.:1 MSTHTSSTLPAFKKILVANRGEIAVRAFRAALETGAATVAIYPREDRGSFHRSFASEAVR 60 IGTEGSPVKAYLDIDEIIGAAKKVKADAIYPGYGFLSENAQLARECAENGITFIGPTPEV 120 LDLTGDKSRAVTAAKKAGLPVLAESTPSKNIDEIVKSAEGQTYPIFVKAVAGGGGRGMRF 180 VASPDELRKLATEASREAEAAFGDGAVYVERAVINPQHIEVQILGDHTGEVVHLYERDCS 240 LQRRHQKVVEIAPAQHLDPELRDRICADAVKFCRSIGYQGAGTVEFLVDEKGNHVFIEMN 300 PRIQVEHTVTEEVTEVDLVKAQMRLAAGATLKELGLTQDKIKTHGAALQCRITTEDPNNG 360 FRPDTGTITAYRSPGGAGVRLDGAAQLGGEITAHFDSMLVKMTCRGSDFETAVARAQRAL 420 AEFTVSGVATNIGFLRALLREEDFTSKRIATGFIADHPHLLQAPPADDEQGRILDYLADV 480 TVNKPHGVRPKDVAAPIDKLPNIKDLPLPRGSRDRLKQLGPAAFARDLREQDALAVTDTT 540 FRDAHQSLLATRVRSFALKPAAEAVAKLTPELLSVEAWGGATYDVAMRFLFEDPWDRLDE 600 LREAMPNVNIQMLLRGRNTVGYTPYPDSVCRAFVKEAASSGVDIFRIFDALNDVSQMRPA 660 IDAVLETNTAVAEVAMAYSGDLSDPNEKLYTLDYYLKMAEEIVKSGAHILAIKDMAGLLR 720 PAAVTKLVTALRREFDLPVHVHTHDTAGGQLATYFAAAQAGADAVDGASAPLSGTTSQPS 780 LSAIVAAFAHTRRDTGLSLEAVSDLEPYWEAVRGLYLPFESGTPGPTGRVYRHEIPGGQL 840 SNLRAQATALGLADRFELIEDNYAAVNEMLGRPTKVTPSSKVVGDLALHLVGAGVDPADF 900 AADPQKYDIPDSVIAFLRGELGNPPGGWPEPLRTRALEGRSEGKAPLTEVPEEEQAHLDA 960 DDSKERRNSLNRLLFPKPTEEFLEHRRRFGNTSALDDREFFYGLVEGRETLIRLPDVRTP 1020 LLVRLDAISEPDDKGMRNVVANVNGQIRPMRVRDRSVESVTATAEKADSSNKGHVAAPFA 1080 GVVTVTVAEGDEVKAGDAVAIIEAMKMEATITASVDGKIDRVVVPAATKVEGGDLIVVVS 1140 SEQIDNo.:22 MLTPPKFEDEKQLGPVGIRERLRHFTWAWYTLTMSGGGLAVLIISQPFGFRGLREIGIAV 60 YILNLILFALVCSTMAIRFILHGNLLESLRHDREGLFFPTFWLSVATIICGLSRYFGEES 120 NESFQLALEALFWIYCVCTLLVAIIQYSFVFSSHKYGLQTMMPSWILPAFPIMLSGTIAS 180 VIGEQQPARAALPIIGAGVTFQGLGFSISFMMYAHYIGRLMESGLPHSDHRPGMFICVGP 240 PAFTALALVGMSKGLPEDFKLLHDAHALEDGAIIELLAISAGVFLWALSLWFFCIAIVAV 300 IRSPPEAFHLNWWAMVFPNTGFTLATITLGKALNSNGVKGVGSAMSICIVCMYIFVFVNN 360 VRAVIRKDIMYPGKDEDVSD 380

(62) In view of the teaching of the present invention and the prior art, those skilled in the art should understand that the mutant protein of the present invention should also include the active fragment of the mutant protein, modified or unmodified variant or derivatives thereof.

(63) Specifically, the active fragment, variant or derivative protein of the pyruvate carboxylase mutant protein includes a sequence which is based on SEQ ID NOs: 2-20, and may has one or several (for example, usually 1-30, preferably 1-10, more preferably 1-6, and further preferably 1-3, and most preferably 1) deletion, insertion and/or substitution of amino acid residues, and still has an activity (cA1) of convert pyruvic acid into malate precursor oxaloacetate via carboxylation, wherein the activity cA1 is significantly higher than the corresponding activity (cA0) of wild-type pyruvate carboxylase shown in SEQ ID NO: 1 and the term significantly higher mean any value in (cA1-cA0)/cA010%-500%, such as 15%, 20%, 25%, 30%, 40%, 50%, or 100%.

(64) The active fragment, variant or its derivative of the mutant malate transporter includes a sequence which is based on a sequence as shown in SEQ ID NOs: 23-42, and may has one or several (for example, usually 1-30, preferably 1-10, more preferably 1-6, and further preferably 1-3, and most preferably 1) deletion, insertion and/or substitution of amino acid residues, and still has an activity (aA1) of transporting malic acid from inside to outside of cells wherein the activity aA1 is significantly higher than the corresponding activity (aA0) of the wild-type malate transporter shown in SEQ ID NO: 22, and the term significantly higher mean any value in (cA1cA0)/cA010500%, such as 15%, 20%, 25%, 30%, 40%, 50%, or 100%.

(65) The skilled in the art can generate conservatively mutated mutants based on, for example, the conservative amino acid substitutions as shown in the following table.

(66) TABLE-US-00002 Primary residue Representative substitution Preferred substitution Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Lys; Arg Gln Asp (D) Glu Glu Cys (C) Ser Ser Gln (Q) Asn Asn Glu (E) Asp Asp Gly (G) Pro; Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe Leu Leu (L) Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Leu; Val; Ile; Ala; Tyr Leu Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala Leu

(67) As used herein, modification (typically without changing the primary structure) forms of proteins include: chemically derived forms of proteins such as acetylation or carboxylation in vivo or in vitro. Modifications also include glycosylation. Modification forms also include sequences with phosphorylated amino acid residues (e.g. phosphotyrosine, phosphoserine, phosphothreonine). Also included are proteins that have been modified to improve their proteolytic resistance or optimize their solubility. These techniques are known to those skilled in the art.

(68) In addition, the derivative protein of the mutant protein of the present invention also includes a fusion protein or conjugate formed by the mutant protein of the present invention or an active fragment thereof and other proteins or markers.

(69) Preferably, the active fragment, variant or derivative protein of the mutant protein of the present invention has a sequence identity to SEQ ID NO: 1 or 22 of at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, respectively.

(70) The mutant protein of the present invention can be combined to further increase the production of malic acid.

(71) Encoding Nucleic Acid and its Combination

(72) Based on the pyruvate carboxylase mutant protein or mutant malate transporter of the present invention, the present invention also provides an isolated polynucleoside or its degenerate variants encoding pyruvate carboxylase mutant protein or mutant malate transporter. The polynucleotide of the present invention may be in the form of DNA or RNA. DNA forms include cDNA, genomic DNA, or synthetic DNA. DNA can be single-stranded or double-stranded. DNA can be a coding strand or a non-coding strand. The coding region sequence encoding the mature polypeptide may be the same as the nucleotide sequence encoding the pyruvate carboxylase mutant protein and/or the mutant malate transporter in the embodiments of the present invention or is a degenerate variant. As used herein, degenerate variant in the present invention refers to a nucleotide sequence which encodes a pyruvate carboxylase mutant protein and/or the mutant malate transporter in the claims of the present invention, but is different from the nucleotide sequence for the acid carboxylase mutant protein or mutant malate transporter in the examples of the present invention.

(73) Vectors, Host Cells

(74) The coding polynucleotide sequence can be inserted into a recombinant expression vector or genome. The term recombinant expression vector refers to a bacterial plasmid, bacteriophage, yeast plasmid, plant cell virus, mammalian cell virus or other vectors well known in the art. In short, as long as it can replicate and stabilize in the host, any plasmid and vector can be used. An important feature of expression vectors is that they usually contain an origin of replication, a promoter, a marker gene and translation control elements.

(75) Those skilled in the art can use well-known methods to construct vectors for expression of DNA sequences containing coding sequences for pyruvate carboxylase mutant protein and/or mutant malate transporter and appropriate transcription/translation control signals, including in vitro recombinant DNA technology, DNA synthesis technology, in vivo recombinant technology, etc. The DNA sequence can be effectively linked to an appropriate promoter in an expression vector to guide mRNA synthesis. The expression vector also includes a ribosome binding site for translation initiation and a transcription terminator.

(76) The host cells described herein include host cells containing the above-mentioned expression vector, or in which the coding sequence of the mutant protein of the present invention is integrated into its genome. The host cells may include those derived from Sac fungi, have a very high evolutionary relationship, and have high similarity in the sequence and functionality of pyruvate carboxylase and malate transporter. The preferred microorganism cells are as follows:

(77) Saccharomyces cerevisiae, Pichia pastoris, Saccharomyces monacensis, Saccharomyces bayanus, Saccharomyces pastorianus, Saccharomyces carlsbergensis, Saccharomyces pombe, Kluyveromyces marxiamus, Kluyveromyces lactis, Kluyveromyces fragilis, Pichia stipites, Candida shehatae, Candida tropicalis, Escherichia coli, Bacillus subtilis, Torulopsis glabrata, Aspergillus oryzae, Rhizopus oryzae, Ustilago trichophora, Thermobifida fusca, Myceliophthora thermophila, Myceliophthora heterothallica.

(78) The mutant protein of the present invention can be obtained by a conventional recombinant transformation method in the art, and the mutant protein can be expressed in a cell, on a cell membrane, or secreted out of the cell. If necessary, the recombinant protein can be isolated and purified by various separation methods using its physical, chemical and other characteristics. These methods are well known to those skilled in the art. Examples of these methods include but are not limited to: conventional renaturation treatment, treatment with protein precipitation agent (salting out method), centrifugation, osmotic disruption, ultrasonic treatment, high-pressure homogenization, ultracentrifugation, molecular sieve chromatography (gel filtration), adsorption chromatography, ion exchange chromatography, affinity chromatography, high performance liquid chromatography (HPLC) and various other liquid chromatography techniques and combinations of these methods. The host cell obtained in the present invention can express pyruvate carboxylase mutant protein and mutant malate transporter separately and/or simultaneously.

(79) Preparation of Mutant Protein

(80) The present invention also provides a method for preparing pyruvate carboxylase mutant protein mutant malate transporter, which includes culturing the host cell of the present invention under conditions suitable for expression, thereby expressing pyruvate carboxylase mutant protein and/or the mutant malate transporter; and isolating the pyruvate carboxylase mutant protein and/or the mutant malate transporter.

(81) The obtained mutant protein may optionally be purified to obtain a more pure mutant protein product.

(82) Preferably, the conditions suitable for expression include conventional techniques in the art, and purification techniques include nickel column purification, ion exchange chromatography and the like.

(83) Carbon Source

(84) There is no particular limitation on carbon sources useful in the present invention. Carbon source is a type of nutrient for the growth of microorganisms (such as the host cells of the present invention) and is a carbon-containing compound. Preferably, carbon sources that can be used in the present invention include glucose, sucrose, cellobiose, lactose, galactose, xylose, glycerin, or methanol.

(85) Application

(86) The mutant protein of the present invention can be used separately or simultaneously to increase the yield of malic acid. The pyruvate carboxylase mutant protein of the present invention improves malate synthesis by at least 10% with a single mutation at a specific site, and mutations in preferred strains can reach more than 30%, while double and triple mutations can increase malic acid yield by 40%. For mutant malate transporters, malate production is increased by at least 10% after mutation at specific sites, and mutations in preferred strains can reach more than 30%. When the two proteins are modified and combined in the present invention, the production of malic acid is synergistically improved.

(87) The Beneficial Effects of the Invention

(88) In the present invention, by constructing a malate synthesis pathway in Pichia pastoris, the pyruvate carboxylase and malate transporter synthesizing ability in the malate synthesis pathway are coupled with malate production, and then to CaCO.sub.3 hydrolysis circle so that the directed evolution of the two proteins is realized for the first time, and significantly improves the level of malic acid synthesis. The pyruvate carboxylase mutant protein of the present invention improves malate synthesis by at least 10% with a single mutation at a specific site, and mutations in preferred strains can reach more than 30%, while double and triple mutations increase malic acid yield by 40%. For mutant malate transporters, malate production is increased by at least 10% after mutations at specific sites, and mutations in preferred strains can reach more than 30%. When the two proteins are modified and combined in the present invention, the production of malic acid is synergistically improved.

(89) The invention will now be further described with reference to specific embodiments. It should be understood that these examples are merely illustrative of the invention and are not intended to limit the scope of the invention. The experimental methods not specified for conditions in the following examples are generally carried out according to conventional conditions, such as those described in Sambrook et al., Molecular Cloning: Laboratory Manual (New York: Cold Spring Harbor Laboratory Press, 1989), or conditions suggested by the manufacturer.

(90) All the primers used were synthesized by Jinweizhi Biotechnology Co., Ltd. The genes involved were also synthesized by Jinweizhi Biotechnology Co., Ltd. The sequence involved in the present invention is shown in the SEQUENCE LISTING.

(91) The methods for obtaining various biological materials described in the examples are merely to provide an experimentally obtained method to achieve the purpose of specific disclosure, and should not be a limitation on the source of the biological materials of the present invention. In fact, the sources of biomaterials used are wide, and any biomaterials that can be obtained without violating laws and ethics can be replaced and used according to the prompts in the embodiments.

(92) In the present invention, malic acid and succinic acid were purchased from Sigma reagent company.

Example 1 Construction of Pichia pastoris Dicarboxylic Acid Transporter Screening Platform

(93) I. Construction of Pichia pastoris Overexpressing Pyruvate Carboxylase and Malate Dehydrogenase Vectors:

(94) By using primers AvrII-F (SEQ ID NO: 44): (CCACCGCCCGTTACCGTCCGAAGGAAATTTTACTCTGCTGGAG) and AvrII-R (SEQ ID NO: 45): (CTCCAGCAGAGTAAAATTTCCTTCGGACGGTAACGGGCGGTGG), and using pGAPzA as the template system, PCR was conducted. The PCR reaction system were as follows: 5 PHUSION HF buffer 10 l, 10 mM dNTPs 1 l, AvrII-F1 l, AvrII-R 1 l, pGAPzA 1 l, PHUSION DNA polymerase 0.5 l, water 35.5 l. The PCR reaction conditions were: first 98 C. 30 s; then 98 C. 10 s, 60 C. 30 s, 72 C. 3 min, 30 cycles; finally 72 C. 10 min, 4 C. 10 min. After the PCR reaction was completed, the product was purified through a purification column. Into 1 g of plasmid was added 1 l of restriction enzyme DpnI to remove the template, and the mixture was then heat-inactivated at 85 C. for 5 min. 5 l of the product was transformed into E. coli competent cell DH5 and spread on 25 g/ml Zeocin's low-salt LB medium plate and was screened for positive clones and sequenced. The sequencing results showed that the AvrII cleavage site on pGAPzA had been successfully removed, and it was named pGAPzAm. Using primers PYC-F (SEQ ID NO: 46): (GGGTTCGAAACG ATGGCCGAAGAAGACTACTCCC)/PYC-R (SEQ ID NO: 47): (GGGGCGGCCGCTTACTCAGCCTTGACGATTTTGGCGATC), MDH-F (SEQ ID NO: 48): (GGGTTCGAAACGATGGTTAAAGTCACAGTTTGCGGAG)/MDH-R (SEQ ID NO: 49): (GGGGCGGCCGCTTAGTTGCCAGCAATGAAGGCAGTTCC), using Pichia pastoris GS115 genome as a template to amplify the pyruvate carboxylase PYC and malate dehydrogenase MDH genes by PCR. PCR reaction conditions were as follows: first 98 C. 30 s; Then 98 C. 10 s, 60 C. 30 s, 72 C. 3 min (PYC) or 1 min (MDH), 30 cycles; finally 72 C. 10 min, 4 C. 10 min. After PCR, product was purified by the purification column, double digestion was performed with BstBI and NotI. Plasmid pGAPzA and pGAPzAm were digested with the same enzymes, and then PYC and pGAPZA, MDH and pGAPzAm were connected by T4DNA ligase at 22 C. for 1 h, and 10 l was taken. The ligation product was transformed into E. coli competent cell DH5a, plated on 25 g/ml Zeocin low-salt LB medium plate and screened for positive clones, followed by sequencing. The sequencing results showed that plasmid pGAPzA-PYC (FIG. 1) and plasmid pGAPzAm-MDH (FIG. 2) were successfully constructed. Further, pGAPzAm-MDH was double-digested with BglII and BamHI to obtain the expression frame of MDH, which was connected into the plasmid pGAPzA-PYC digested with BamH1, and the ligation product was transformed into E. coli competent cell DH5a, which was inoculated on 25 g/ml Zeocin and the positive clones were selected on the low-salt LB medium plate and sequenced, thereby constructing the expression plasmid pGAPZA-PYC-pGAPzAm-MDH, whose schematic diagram is shown in FIG. 3.

(95) II. Construction of Pichia pastoris Strain Overexpressing Pyruvate Carboxylase and Malate Dehydrogenase:

(96) 1. Pichia pastoris GS115 strain stored at 80 C. was inoculated onto YPD (1% yeast extract, 2% peptone, 2% glucose, 2% agar) plate and incubated at 30 C. to grow single clones. 2. A single clone was taken in 250 ml of liquid YPD medium with a volume of 30 ml, cultured at 200 rpm, 30 C. and activated for 2 days. 3. The activated Pichia pastoris GS115 strain was transferred to the medium containing 30 ml of liquid YPD twice, wherein the inoculation amount was controlled at one-thousandth, and cultured at 200 rpm, 30 C. for about 16 h-20 h until OD600 reached 1.0. 4. After centrifugation at 3000 rpm, 4 C., the bacterial cells were collected, and washed twice with pre-cooled sterile water. 5. Then the bacterial cells were washed with pre-chilled 1M sorbitol once and the precipitate was collected after centrifugation. 6. About 400 l of 1M sorbitol was added to resuspend the cells, then it was divided each 80 l and added into a pre-chilled 1.5 ml centrifuge tube to make Pichia pastoris GS115 competent cells, and stored at 80 C. until use. 7. The pGAPzA-PYC-pGAPzAm-MDH plasmid was extracted, the plasmid was linearized with AvrII, and then transformed into Pichia pastoris GS115 competent cells by electroporation. Then 1 ml of pre-cooled 1M sorbitol was added and the mixture was left at 30 C. 2 h, and then was inoculated on the YPD plate containing 50 or 75 g/ml. After the growth of bacteria to be used for malic acid production, the strain was named as P0.
III. Determination of Malic Acid Synthesis Capacity

(97) Malate synthesis strain was first activated with YPD medium for 48 h, and then inoculated with initial OD 600=1.0 on malate-producing medium (100 g/L glucose, 1.24 g/L KNO.sub.3, 0.64 g/L KH.sub.2PO.sub.4, 0.04 g/L ZnSO.sub.4.Math.7H.sub.2O, 0.25 g/L MgSO.sub.4.Math.7H.sub.2O, 0.0005 g/L FeSO.sub.4.Math.7H.sub.2O 4 g/L peptone, 0.1 g/L CaCl.sub.2), 75 g/L CaCO.sub.3, 0.1 g/L histine), wherein 30 ml liquid medium was added into a 250 ml triangle bottle liquid, and cultured at 200 rpm, 30 C. incubation. Every 24 h, 1 ml was sampled, 1 ml 20% (V/V) H.sub.2SO.sub.4 was added, and acidification treatment was conducted at 80 C. for 30 min. A certain amount of water was added for dilution and after centrifugation, the supernatant was taken and HPLC AMINEX 87H chromatographic column was used to measure the content of malic acid. The HPLC parameter conditions were as follows: the column temperature was 35 C., the detector temperature was 40 C., the mobile phase was 5 mM H.sub.2SO.sub.4, the flow rate was 0.5 ml/min, and the malic acid standard was used for quantification. The results are shown in FIG. 7. Compared with the GS115 strain, the P0 strain produced 3.0 g/l malic acid and GS115 produced 1.0 g/L malic acid.

Example 2 Construction and Screening of a Dicarboxylic Acid Transporter Mutation Library

(98) I. Construction of Expression Vectors for Binary Carboxylic Acid Transporters:

(99) The primers were as follows:

(100) TABLE-US-00003 Hph-BamH1 SEQIDNO:50 GGGGGATCCTGTACAGCTTGCCTCGTCCCC Hph-R SEQIDNO:51 GTCGACACTGGATGGCGGCGTTAG

(101) Using pAG34 plasmid as a template, PCR was conducted to amplify the hygromycin gene. The PCR reaction conditions were as follows: first 98 C. 30 s; then 98 C. 10 s, 60 C. 30 s, 72 C. 2 min, 30 cycles; last 72 C. 10 min, 4 C. for 10 min. After the PCR reaction was completed, the product was purified through a purification column, digested with BamH1, ligated into pGAPzA plasmid digested with BamH1 and EcoRV, and the ligated product was transformed into E. coli competent cell DH5a. The monoclonal sequence was confirmed by sequencing, and pGAP-hph was obtained.

(102) The primers were as follows:

(103) TABLE-US-00004 his-BglII SEQIDNO:52 GGGAGATCTGTTGTAACACTGGCAGAGCATTACG his-BamH1 SEQIDNO:53 GGGGGATCCGTCCCAGTTTCTCCATACGAACC)

(104) Using the pPIC9K plasmid as a template, PCR was conducted to amplify the his gene, and the PCR fragment was digested with BglII and BamH1 and ligated with pGAP-hph digested with BglII, thereby obtaining pGAP-hph-his.

(105) The primers were as follows:

(106) TABLE-US-00005 SpMae-ClaI SEQIDNO:54 GGGATCGATATGGGTGAACTCAAGGAAATCTTG SpMae-NotI SEQIDNO:55 GGGGCGGCCGCTTAAACGCTTTCATGTTCACTACTAGG

(107) Using Schizosaccharomyces pombe genomic DNA as a template, PCR was conducted to amplify SpMae gene.

(108) The primers were as follows:

(109) TABLE-US-00006 AoMae-BstBI SEQIDNO:56 GGGTTCGAAATGCTGACACCTCCCAAGTTTG AoMae-NotI SEQIDNO:57 GGGCGGCCGCCTAATCAGATACATCCTCATCTTTAC

(110) Using the cDNA of Aspergillus Oryzae DSM1863 (DSMZ, purchased from German Microbial and Cell Culture Co., Ltd.) as a template, PCR was conducted to amplify AoMae gene;

(111) The primers were as follows:

(112) TABLE-US-00007 Kljen2-EcoRI SEQIDNO:58 GGGGAATTCATGGCTGCAGAATCAATAGTGTCTC Kljen2-NotI SEQIDNO:59 GGGGCGGCCGCTTATGTTGAATTTCTTGCTTGAAATTTAGATC

(113) Kljen2 was obtained by PCR amplification by using Kluyveromyces lactis genomic DNA as a template. SpMae, AoMae and Kljen2 PCR products were digested and purified by ClaI/NotI, BstBI/NotI, and EcoRI/NotI, respectively, and connected into the vector pGAP-hph-his (digested with the corresponding enzymes (ClaI and BstBI were isocaudomer) The ligation product was transformed into E. coli competent cell DH5, the monoclonal sequence was confirmed by sequencing, thereby obtaining pGAP-hph-his-SpMae, pGAP-hph-his-AoMae and pGAP-hph-his-Kljen2 (FIG. 4).

(114) II. Comparison of Malic Acid Production Capacity of Candidate Protein of Dicarboxylic Acid Transporter:

(115) Vectors pGAP-hph-his-SpMae, pGAP-hph-his-AoMae and pGAP-hph-his-Kljen2 were linearized by AvrII, transformed into P0 strain electroporation, and inoculated on MD (YNB 13.4 g/L, biotin 4104 g/L, agar 2.0 g/L, glucose 2.0 g/L). The acid-producing medium was used for shake flask cultivation. The results are shown in FIG. 7. Among them, AoMae derived from A. oryzae was more favorable for the synthesis of organic acids such as malic acid. Using 100 g/L glucose as the substrate, 55 g/L malic acid could be synthesized. The strain was named P1 and used this strain as a starting protein for protein engineering.

(116) III. Construction of High-Throughput Screening Method Based on Hydrolysis Circle:

(117) Due to the soluble properties of 20-30 g/L calcium malate (found in the early stage of the present study), we established a high-throughput screening method based on hydrolysis circle. The specific method was as follows: when the transporter expression plasmid was transferred into P0 competent cells, after the growth of bacterial clone, the clone was pick with a sterile toothpick, and then punctured into the malic acid-producing solid medium (2.0 g/L agar was added to the liquid, and the concentration of CaCO.sub.3 was 3 g/L). The size of the hydrolysis circle was checked every day, the ratio of the diameter of the hydrolysis circle to the diameter of the clone was used as the screening criterion: the larger the value, the higher the malic acid production.

(118) IV. Construction of Aomae Mutation Library and Screening of Malate-Producing Mutants:

(119) AoMae derived from A. oryzae was subjected to protein engineering. Using AoMae-BstBI and AoMae-NotI as primers, random mutation kit of GeneMorph II Random Mutagenesis (Agilent) was used to perform random mutation amplification of AoMae. The PCR product was digested with BstBI and NotI and then ligated with pGAP-hph-his. The ligated product was transformed into E. coli competent cell DH5, which was inoculated on LB solid plate medium containing 125 g/ml hygromycin, and incubated overnight at 37 C. Twenty single clones were randomly selected for sequencing, and the mutation rate was analyzed. The results showed that the mutation rate was about 1%. The mutant library was eluted with LB liquid medium containing 125 g/ml hygromycin, and then recovered at 37 C. for 2 h, after which the mixed plasmid was extracted, transformed into P0 competent cells after linearization with AvrII, and spread on MD plates. After the single clones grew, single clone was punctured and inoculated in malate-producing solid medium. Using AoMae wild-type strain P1 as a control, strains with a larger hydrolysis circle in the mutation library than P1 (FIG. 8), was rescreened in shaking flask and malate content was determined by HPLC.

(120) V. Determination of Copy Number of AoMae Gene in Malate-Producing Mutants

(121) Genomic DNA of malate-producing mutants was extracted.

(122) The primers were as follows:

(123) TABLE-US-00008 Actin-RT1-F SEQIDNO:60 CTGCGATTCTTATTCTTCCGATTG Actin-RT1-R SEQIDNO:61 CAACCGAGGACAACCAACAG

(124) Actin gene was amplified as an internal reference.

(125) The primers were as follows:

(126) TABLE-US-00009 Aomae-RT1-F SEQIDNO:62 CATCATCTGCGGCTTGTC Aomae-RT1-R SEQIDNO:63 TGAGAAGACGAACGAGTATTG

(127) The AoMae gene was amplified, and the results showed that the obtained AoMae transformants all had a single copy.

(128) VI. Identification of Mutation Sites:

(129) For mutant strains with increased malate production, their genomic DNA was extracted, and then AoMae-BstB1 and AoMae-NotI were used as primers for PCR amplification. After the amplification product was recovered by purification columns, it was ligated with pJET1.2 blunt vector, transformed into E. coli competent cell DH5, inoculated on LB medium containing 100 g/ml ampicillin, and the monoclones were sequenced to obtain the mutation sites: I80F, V142D, R272P, EBG, 1109V, S123R, I301K, P163Q, F101H, L140N, F97G, A191C, Y115I, A214G, F201K, H.sub.227F, M251Y and E222H.

(130) VII. Site Saturation Mutations and Combination Mutations of AoMae Improved Malic Acid Synthesis:

(131) Saturated mutations were conducted at key amino acid positions obtained from random mutation sites and based on structural comparison. The method was as follows: the mutation sites was introduced in the middle of primers; then PCR was performed to amplify pGAP-hph-his-AoMae by PCR; the PCR product was digested with DpnI; the template plasmid was removed, and then 5 l of transformed E. coli competent cell DH5a was taken and inoculated on LB medium containing 125 g/ml of hygromycin. The mutant sites were obtained by sequencing the single clones. The obtained AoMae mutant expression plasmid was linearized with AvrII, transformed into the P0 strain, and then cultured in liquid malic acid production medium via shake flask cultivation and HPLC analysis was conducted.

(132) I80F mutation was obtained by using primers I80F (SEQ ID NO: 64): CCATGGCTATAAGGTTCTTCCTGCACGGCAACCTTCTG and 180-rev (SEQ ID NO: 65): GAACCTTATAGCCATGGTAGAG. For other 180X mutation (X represents 18 other amino acids except F), Primer 180X (SEQ ID NO: 66): CCATGGCTATAAGGTTCXXXCTGCACGGCAACCTTCTG (XXX was a codon corresponding to different amino acids) and 180-rev (SEQ ID NO: 65) were used to introduce mutation.

(133) V142D mutation was obtained by using primers V142D (SEQ ID NO: 67): GCGTCTGCACCTTACTCGACGCAATCATCCAATACTCG and V142-rev (SEQ ID NO: 68): GAGTAAGGTGCAGACGCAGTAG. For other V142X mutation (X represents 18 other amino acids except F), Primer V142X (SEQ ID NO: 69): GCGTCTGCACCTTACTCXXXGCAATCATCCAATACTCG (XXX was a codon corresponding to different amino acids) and V142-rev (SEQ ID NO: 68) were used to introduce mutation.

(134) R272P mutation was obtained by using primers R272P (SEQ ID NO: 69): CACGCCCTGGAAGATGGCCCAATCATCGAGCTGCTGGC and R272-rev (SEQ ID NO: 70): GCCATCTTCCAGGGCGTG. For other R272X mutation (X represents 18 other amino acids except F), Primer R272X (SEQ ID NO: 71): CACGCCCTGGAAGATGGCXXXATCATCGAGCTGCTGGC(XXX was a codon corresponding to different amino acids) and R272-rev (SEQ ID NO: 70) were used to introduce mutation.

(135) E8G mutation was obtained by using primers E8G (SEQ ID NO: 72): CTGACACCTCCCAAGTTTGGTGATGAGAAGCAGCTGGG and E8-rev (SEQ ID NO: 73): AAACTTGGGAGGTGTCAGC. For other E8X mutation (X represents 18 other amino acids except F), Primer E8X (SEQ ID NO: 74): CTGACACCTCCCAAGTTTXXXGATGAGAAGCAGCTGGG (XXX was a codon corresponding to different amino acids) and E8-rev (SEQ ID NO: 73) were used to introduce mutation.

(136) I109V mutation was obtained by using primers I109V (SEQ ID NO: 75): TCTCCGTCGCAACCATCGTCTGCGGCTTGTCTCGCTAC and I109-rev (SEQ ID NO: 76): GATGGTTGCGACGGAGAG. For other I109X mutation (X represents 18 other amino acids except F), Primer I109X (SEQ ID NO: 77): TCTCCGTCGCAACCATCXXXTGCGGCTTGTCTCGCTAC(XXX was a codon corresponding to different amino acids) and I109-rev (SEQ ID NO: 76) were used to introduce mutation.

(137) S123R mutation was obtained by using primers S123R (SEQ ID NO: 78): GTGAAGAATCGAATGAGAGATTCCAACTAGCCCTCGAAG and S123-rev (SEQ ID NO: 79): CTCATTCGATTCTTCACCG. For other S123X mutation (X represents 18 other amino acids except F), Primer S123X (SEQ ID NO: 80): GTGAAGAATCGAATGAGXXXTTCCAACTAGCCCTCGAAG (XXX was a codon corresponding to different amino acids) and S123-rev (SEQ ID NO: 79) were used to introduce mutation.

(138) I301K mutation was obtained by using primers I301K (SEQ ID NO: 81): CGCCATTGTCGCCGTCAAGCGCTCGCCCCCCGAGGCC and I301-rev (SEQ ID NO: 82): GACGGCGACAATGGCGATG. For other S123X mutation (X represents 18 other amino acids except F), Primers S123X (SEQ ID NO: 83): CGCCATTGTCGCCGTCXXXCGCTCGCCCCCCGAGGCC (XXX was a codon corresponding to different amino acids) and I301-rev (SEQ ID NO: 82) were used to introduce mutation.

(139) P163Q mutation was obtained by using primers P163Q (SEQ ID NO: 84): GCCTTCAAACCATGATGCAATCATGGATCCTTCCAGCC AND P163Q-rev (SEQ ID NO: 85): CATCATGGTTTGAAGGCC. For other P163X mutation (X represents 18 other amino acids except F), Primers P163X (SEQ ID NO: 86): GCCTTCAAACCATGATGXXXTCATGGATCCTTCCAGCC (XXX was a codon corresponding to different amino acids) and P163-rev (SEQ ID NO: 85) were used to introduce mutation.

(140) F101H mutation was obtained by using primers F101H (SEQ ID NO: 87): GGTCTCTTCTTCCCGACCCACTGGCTCTCCGTCGCAACC and F101-rev (SEQ ID NO: 88): GGTCGGGAAGAAGAGACCC. For other F101X mutation (X represents 18 other amino acids except F), Primers F101X (SEQ ID NO: 89): GGTCTCTTCTTCCCGACCXXXTGGCTCTCCGTCGCAACC (XXX was a codon corresponding to different amino acids) and F101-rev (SEQ ID NO: 88) were used to introduce mutation.

(141) L140N mutation was obtained by using primers L140N (SEQ ID NO: 90): TCTACTGCGTCTGCACCAACCTCGTCGCAATCATCC and L140-rev (SEQ ID NO: 91): GGTGCAGACGCAGTAGATC. For other L140X mutation (X represents 18 other amino acids except F), Primers L140X (SEQ ID NO: 92): TCTACTGCGTCTGCACCXXXCTCGTCGCAATCATCC (XXX was a codon corresponding to different amino acids) and L140-rev (SEQ ID NO: 91) were used to introduce mutation.

(142) F97G mutation was obtained by using primers F97G (SEQ ID NO: 93): CATGACCGCGAGGGTCTCGGGTTCCCGACCTTCTGGCTC and F97-rev (SEQ ID NO: 94): GAGACCCTCGCGGTCATG. For other F97X mutation (X represents 18 other amino acids except F), Primers F97X (SEQ ID NO: 95): CATGACCGCGAGGGTCTCXXXTTCCCGACCTTCTGGCTC(XXX was a codon corresponding to different amino acids) and F97-rev (SEQ ID NO: 94) were used to introduce mutation.

(143) A191C mutation was obtained by using primers A191C (SEQ ID NO: 96): CAACAACCCGCTCGCGCATGTCTCCCCATCATCGGCGC and A191-rev (SEQ ID NO: 97): TGCGCGAGCGGGTTGTTG. For other A191X mutation (X represents 18 other amino acids except F), Primers F97X (SEQ ID NO: 98): CAACAACCCGCTCGCGCATGTCTCCCCATCATCGGCGC (XXX was a codon corresponding to different amino acids) and A191-rev (SEQ ID NO: 97) were used to introduce mutation.

(144) Y115I mutation was obtained by using primers Y115I (SEQ ID NO: 99): TCTGCGGCTTGTCTCGCATCTTCGGTGAAGAATCGAATG and Y115-rev (SEQ ID NO: 100): GCGAGACAAGCCGCAGATG. For other Y115X mutation (X represents 18 other amino acids except F), Primers F97X (SEQ ID NO: 101): TCTGCGGCTTGTCTCGCXXXTTCGGTGAAGAATCGAATG (XXX was a codon corresponding to different amino acids) and Y115-rev (SEQ ID NO: 100 were used to introduce mutation.

(145) A214G mutation was obtained by using primers A214G (SEQ ID NO: 102): TCAGCTTCATGATGTACGGGCACTACATCGGCCGACTG and A214-rev (SEQ ID NO: 103): GTACATCATGAAGCTGATG. For other A214X mutation (X represents 18 other amino acids except F), Primers A214X (SEQ ID NO: 104): TCAGCTTCATGATGTACXXXCACTACATCGGCCGACTG (XXX was a codon corresponding to different amino acids) and A214X-rev (SEQ ID NO: 103) were used to introduce mutation.

(146) F201K mutation was obtained by using primers F201K (SEQ ID NO: 105): CGGCGCCGGCGTCACCAAGCAGGGCCTCGGCTTCTCC and F201-rev (SEQ ID NO: 106): GGTGACGCCGGCGCCGATG. For other F201X mutation (X represents 18 other amino acids except F), Primers A214X (SEQ ID NO: 107): CGGCGCCGGCGTCACCXXXCAGGGCCTCGGCTTCTCC (XXX was a codon corresponding to different amino acids) and F201-rev (SEQ ID NO: 106) were used to introduce mutation.

(147) H227F mutation was obtained by using primers H.sub.227F (SEQ ID NO: 108): ATGGAGTCCGGCCTCCCCTTCAGCGACCACAGACCAGGC and H.sub.227-rev (SEQ ID NO: 109): GGGGAGGCCGGACTCCATC. For other H.sub.227X mutation (X represents 18 other amino acids except F), Primers A214X (SEQ ID NO: 110): ATGGAGTCCGGCCTCCCCXXXAGCGACCACAGACCAGGC (XXX was a codon corresponding to different amino acids) and H.sub.227-rev (SEQ ID NO: 109) were used to introduce mutation.

(148) M251Y mutation was obtained by using primers M251Y (SEQ ID NO: 111): CCCTCGCCCTCGTCGGCTACAGCAAAGGCCTCCCCGAAG and M251-rev (SEQ ID NO: 112): GCCGACGAGGGCGAGGGC. For other M251X mutation (X represents 18 other amino acids except F), Primers M251X (SEQ ID NO: 113): CCCTCGCCCTCGTCGGCXXXAGCAAAGGCCTCCCCGAAG (XXX was a codon corresponding to different amino acids) and M251-rev (SEQ ID NO: 112) were used to introduce mutation.

(149) E222H mutation was obtained by using primers E222Y (SEQ ID NO: 114): TACATCGGCCGACTGATGCACTCCGGCCTCCCCCAC and E222-rev (SEQ ID NO: 115): CATCAGTCGGCCGATGTAG. For other E222X mutation (X represents 18 other amino acids except F), Primers M251X (SEQ ID NO: 116): TACATCGGCCGACTGATGXXXTCCGGCCTCCCCCAC (XXX was a codon corresponding to different amino acids) and E222-rev (SEQ ID NO: 115) were used to introduce mutation.

(150) After each mutant was transformed into P0 strain, the results of screening malic acid were shown in FIGS. 9-26: 4 optimal points E8Q, I80K, V142I and R272A, which could improve malate synthesis capacity by 15%, 14%, 21% and 21% respectively, were selected for combined mutation by using the same method as saturation mutation. Further, for the combination mutation transformation of the P0 strain, the malate production results were shown in FIG. 27, of which the I80K/R272A (corresponding plasmid pGAP-hph-his-AoMaeKA) mutation had the best ability to synthesize malate, which was 30% higher than the starting strain and reached 71.5 g/L.

Example 3 Pyruvate Carboxylase Screening Platform Strain Construction

(151) I. Dicarboxylic Acid Transporter Expression Vector Construction.

(152) The primers were as follows:

(153) TABLE-US-00010 Hph-BamH1 SEQIDNO:117 GGGGGATCCTGTACAGCTTGCCTCGTCCCC Hph-R SEQIDNO:118 GTCGACACTGGATGGCGGCGTTAG

(154) Using the pAG34 plasmid as a template, PCR was conducted to amplify the hygromycin gene. The PCR reaction conditions were as follows: first 98 C. 30 s; then 98 C. 10 s, 60 C. 30 s, 72 C. 2 min, 30 cycles; last 72 C. 10 min, 4 C. for 10 min. After the PCR reaction was completed, the product was purified through a purification column, digested with BamH1, ligated into pGAPzA plasmid digested with BamH1 and EcoRV. The ligated product was transformed into E. coli competent cell DH5, the sequence of single clone was confirmed correct by sequencing, thereby obtaining pGAP-hph. AoMae from Aspergillus oryzae was directly amplified via PCR from genomic DNA. AoMae was digested with BstBI and NotI and ligated with the vector pGAP-hph. The ligation product was transformed into E. coli competent cell DH5. The sequence of single clone was confirmed correct by sequencing and pGAP-hph-AoMae was obtained (FIG. 5).

(155) II. Construction of Pichia pastoris Strain Over-Expressing Dicarboxylic Acid Transporter

(156) 1. Pichia pastoris GS115 strain stored at 80 C. was inoculated onto YPD (1% yeast extract, 2% peptone, 2% glucose, 2% agar) plate and incubated at 30 C. to grow single clones. 2. A single clone was taken in 250 ml of liquid YPD medium with a volume of 30 ml, cultured at 200 rpm, 30 C. and activated for 2 days. 3. The activated Pichia pastoris GS115 strain was transferred to the medium containing 30 ml of liquid YPD twice, wherein the inoculation amount was controlled at one-thousandth, and cultured at 200 rpm, 30 C. for about 16 h-20 h until OD600 reached 1.0. 4. After centrifugation at 3000 rpm, 4 C., the bacterial cells were collected, and washed twice with pre-cooled sterile water. 5. Then the bacterial cells were washed with pre-chilled 1M sorbitol once and the precipitate was collected after centrifugation. 6. About 400 l of 1M sorbitol was added to resuspend the cells, then it was divided each 80 l and added into a pre-chilled 1.5 ml centrifuge tube to make Pichia pastoris GS115 competent cells, and stored at 80 C. until use. 7. The pGAP-hph-AoMae plasmid was extracted, the plasmid was linearized with AvrII, and then transformed into Pichia pastoris GS115 competent cells by electroporation. Then 1 ml of pre-cooled 1M sorbitol was added and the mixture was left at 30 C. 2 h, and then was inoculated on the YPD plate containing 300 g/ml. After the growth of bacteria to be used for malic acid production, the strain was named as P2.
III. Determination of Malic Acid Synthesis Capacity

(157) Malate synthesis strain was first activated with YPD medium for 48 h, and then inoculated with initial OD 600=1.0 on malate-producing medium (100 g/L glucose, 1.24 g/L KNO.sub.3, 0.64 g/L KH.sub.2PO.sub.4, 0.04 g/L ZnSO.sub.4.7H.sub.2O, 0.25 g/L MgSO.sub.4.7H.sub.2O, 0.0005 g/L FeSO.sub.4.7H.sub.2O 4 g/L peptone, 0.1 g/L CaCl.sub.2, 75 g/L CaCO.sub.3, 0.1 g/L histine, biotin 410.sup.4 g/L), wherein 30 ml liquid medium was added into a 250 ml triangle bottle liquid, and cultured at 200 rpm, 30 C. incubation. Every 24 h, 1 ml was sampled, 1 ml 20% (V/V) H.sub.2SO.sub.4 was added, and acidification treatment was conducted at 80 C. for 30 min. A certain amount of water was added for dilution and after centrifugation, the supernatant was taken and HPLC Aminex 87H chromatographic column was used to measure the content of malic acid. The HPLC parameter conditions were as follows: the column temperature was 35 C., the detector temperature was 40 C., the mobile phase was 5 mM H.sub.2SO.sub.4, the flow rate was 0.5 ml/min, and the malic acid standard was used for quantification. Compared with the GS115 strain, the P2 strain produced 5.0 g/l malic acid and GS115 produced 1.0 g/L malic acid.

Example 4 Construction and Screening of Pyruvate Carboxylase Mutation Library

(158) I. Construction of Pyruvate Carboxylase Expression Vector. The Primers were as Follows:

(159) TABLE-US-00011 his-BglII SEQIDNO:119 GGGAGATCTGTTGTAACACTGGCAGAGCATTACG his-BamH1 SEQIDNO:120 GGGGGATCCGTCCCAGTTTCTCCATACGAACC

(160) Using the pPIC9K plasmid as a template, PCR was conducted to amplify his gene, and the PCR fragment was digested with BglII and BamH1 and ligated with pGAPzA digested with BglII to obtain pGAPzA-his. Pyruvate carboxylase derived from Penicillium and Rhizobium was synthesized by Jin Weizhi Company. The primers were as follows:

(161) TABLE-US-00012 PyPyc-F SEQIDNO:121 GGGTTCGAAATGGCCGCGCCGCAACGCCAACCCG PyPyc-R SEQIDNO:122 GGGGCGGCCGCTCATCAGGCCTTGCCGATCTTAC RePyc-F SEQIDNO:123 GGGTTCGAAATGCCCATTAGCAAGATCCTCGTGGC RePyc-R SEQIDNO:124 GGGGCGGCCGCTCAGCCGCCGTAGACCGCGAGGAG

(162) Then, the gene was digested with BstBI and NotI and ligated with the same digested pGAPzA-his, and transformed into E. coli DH5. The sequences of transformants were confirmed correct by sequencing, and plasmids were named as pGAPzA-his-PvPyc and pGAPzA-his-RePyc (FIG. 6)). As for the pyruvate carboxylase from Aspergillus, Rhizopus oryzae, Corynebacterium glutamicum and Pichia pastoris, the primers were as follows:

(163) TABLE-US-00013 AoPyc-F SEQIDNO:125 GGGTTCGAAATGGCGGCTCCGTTTCGTCAGCC AoPyc-R SEQIDNO:126 GGGGCGGCCGCCTATTACGCTTTGACGATCTTGC RoPyc-F SEQIDNO:127 AATTGAACAACTATTTCGAAATGCCTGCTGCACC RoPyc-R SEQIDNO:128 AGAAAGCTGGCGGCCGCTTAGGCTTCCTCTTTGAC CgPyc-F SEQIDNO:129 CAATTGAACAACTATTTCGAAATGTCGACTCACAC CgPyc-R SEQIDNO:130 CTAGAAAGCTGGCGGCCGCCTATTAGGAAACGAC PpPyc-F SEQIDNO:131 GGGTTCGAAATGGCCGAAGAAGACTACTCCCCGC PpPyc-R SEQIDNO:132 GGGGCGGCCGCTTACTCAGCCTTGACGATTTTGGC

(164) PCR amplification was conducted by using the respective genomic DNA as a template, and the PCR reaction system was as follows: 5 phusion HF buffer 10 l 10 mM dNTPs 1 l, AvrII-F 1 l, AvrII-R 1 l, pGAPzA 1 l, Phusion DNA polymerase 0.5 l, Water 35.5 l. The PCR reaction conditions were as follows: first 98 C. 30 s; then 98 C. 10 s, 60 C. 30 s, 72 C. 3 min, 30 cycles; finally 72 C. 10 min, 4 C. 10 min. After the PCR product was purified by the purification column, it was digested with BstBI and NotI (the cleavage site contained in the gene was eliminated by mutation), and ligated with the vector pGAPzA-his, transformed into E. coli DH5. The sequences of transformants were confirmed correct by sequencing, and plasmids were named as pGAPzA-his-AoPyc, pGAPzA-his-RoPyc, pGAPzA-his-CgPyc and pGAPzA-his-PpPyc (FIG. 6).

(165) II. Comparison of Candidate Genes for Pyruvate Carboxylase

(166) After digesting 6 pyruvate carboxylase expression vectors constructed above with AvrII, the candidate genes were transferred via electroporation into Pichia pastoris P2 strain containing the dicarboxylic acid transporter AoMae, inoculated on MD plates. After the bacteria grew out, a single clone was picked, activated in YPD liquid medium for 48 h, and the acid-generating medium was used to perform shake flask cultivation. The results were shown in FIG. 28, in which pyruvate carboxylase derived from Corynebacterium glutamicum was more favorable for the synthesis of organic acids such as malic acid. Using 100 g/L glucose as the substrate, 53.2 g/L malic acid could be synthesized so that this protein was used as a starting protein for protein engineering.

(167) III. Construction of High-Throughput Screening Method Based on Hydrolysis Circle:

(168) Due to the soluble properties of 20-30 g/L calcium malate (found in the early stage of the present study), we established a high-throughput screening method based on hydrolysis circle. The specific method was as follows: when pyruvate carboxylase was transformed into P2 competent cells, after the growth of bacterial clone, the clone was pick with a sterile toothpick, and then was punctured into the malic acid-producing solid medium (2.0 g/L agar was added to the liquid, and the concentration of CaCO.sub.3 was 3 g/L). The size of the hydrolysis circle was checked every day, the ratio of the diameter of the hydrolysis circle to the diameter of the clone was used as the screening criterion: the larger the value, the higher the malic acid production (FIG. 29).

(169) IV. Construction of PYC Mutation Library and Screening of Malate-Producing Mutants:

(170) Protein engineering of pyruvate carboxylase CgPyc derived from Corynebacterium glutamicum. First, BstBI and NotI sites contained in CgPyc were mutated by using the following primers:

(171) TABLE-US-00014 BstBI-mut-F SEQIDNO:133 TGGGCCTTGCGGATCGTTTCGAGCTC BstBI-mut-R SEQIDNO:134 ACGATCCGCAAGGCCCAGTGCGGTGGC NotI-mut-F SEQIDNO:135 TGCTGCTTCGCGGTCGCAAC NotI-mut-R SEQIDNO:136 CGAAGCAGCATCTGAATGTTTAC

(172) Using the same site-directed mutation as in Example 2, the obtained plasmid pGAPZA-his-CgPyc (BstBI NotImut) was used as a template for random CgPyc mutations and site-directed mutations. The primers were as follows:

(173) TABLE-US-00015 CgPyc-ep-F SEQIDNO:137 GGGTTCGAAATGTCGACTCACACATCTTC CgPyc-ep-R SEQIDNO:138 GGGGCGGCCGCTTAGGAAACGACGACGATCAAG

(174) The random mutation kit GeneMorph II Random Mutagenesis (Agilent) was used to perform random mutation amplification of CgPyc. The PCR product was digested with BstB1 and NotI and then ligated with pGAPzA-his, and the ligated product was transformed into E. coli competent cell DH5, inoculated on LB solid plate medium containing 25 g/ml Zeocin, and cultured overnight at 37 C. 20 single clones were randomly picked for sequencing, and the mutation rate was analyzed. The results showed that the mutation rate was about 1%. The mutant library was eluted with LB liquid medium containing 25 g/ml Zeocin, and then recovered at 37 C. for 2 h. Then the mixed plasmid was extracted, transformed into P2 competent cells after linearization with AvrII, and spread on MD plates. After the single clones grew, single clone was punctured and inoculated in malate-producing solid medium. Using CgPyc wild-type strain as a control, strains with a larger hydrolysis circle than the wild-type CgPyc in the mutation library were rescreened in shaking flask and malate content was determined by HPLC.

(175) V. Identification of Mutation Sites:

(176) For mutant strains with increased malic acid production, their genomic DNA was extracted, and then CgPyc-F and CgPyc-R were used as primers for PCR amplification. After the amplification product was recovered by purification columns, is was ligated with pJET1.2 blunt vector, transformed into E. coli competent cell DH5, inoculated on LB medium containing 100 g/ml ampicillin, and the monoclones were sequenced to obtain the mutation sites: H.sub.51E, F453Q, A254N, G837M, A762T, P824L, P826T, P1031S.

(177) VI. Site Saturation Mutations and Combination Mutations of CgPyc Improved Malic Acid Synthesis:

(178) Saturated mutations were conducted at key amino acid positions obtained from random mutation sites. The method was as follows: the mutation sites was introduced in the middle of primers; then PCR was performed to amplify pGAPzA-his-CgPyc; the PCR product was digested with DpnI; the template plasmid was removed, and then 5 l of transformed E. coli competent cell DH5a was taken and inoculated on LB medium containing 25 g/ml Zeocin. The mutant sites were obtained by sequencing the single clones. After the obtained CgPyc mutant expression plasmid was linearized with AvrII, the P2 strain was transformed, and then subjected to liquid malate production medium for shake flask cultivation and HPLC analysis was conducted. The introduction of the mutation was as follows:

(179) H51E mutation was obtained by using primers H.sub.51E (SEQ ID NO: 139): GAAGATCGGGGATCATTCGAGCGCTCTTTTGCTTCTG and H.sub.51-rev (SEQ ID NO: 140): GAATGATCCCCGATCTTC. For other H.sub.51X mutation (X represents 18 other amino acids except F), Primers H.sub.51X (SEQ ID NO: 141): GAAGATCGGGGATCATTCXXXCGCTCTTTTGCTTCTG (XXX was a codon corresponding to different amino acids) and H.sub.51-rev (SEQ ID NO: 140) were used to introduce mutation.

(180) F453Q mutation was obtained by using primers F453Q (SEQ ID NO: 142): AGCGCATCGCCACCGGACAAATTGCCGATCACCCGCAC and F453-rev (SEQ ID NO: 143): TCCGGTGGCGATGCGCTTG. For other F453X mutation (X represents 18 other amino acids except F), Primers F453X (SEQ ID NO: 144): AGCGCATCGCCACCGGAXXXATTGCCGATCACCCGCAC (XXX was a codon corresponding to different amino acids) and F453-rev (SEQ ID NO: 143) were used to introduce mutation.

(181) A254N mutation was obtained by using primers A254N (SEQ ID NO: 145): AGTTGTCGAAATTGCGCCAAACCAGCATTTGGATCCAG and A254-rev (SEQ ID NO: 146): TGGCGCAATTTCGACAAC. For other A254X mutation (X represents 18 other amino acids except F), Primers A254X (SEQ ID NO: 147): AGTTGTCGAAATTGCGCCAAACCAGCATTTGGATCCAG (XXX was a codon corresponding to different amino acids) and A254X-rev (SEQ ID NO: 146) were used to introduce mutation.

(182) G837M mutation was obtained by using primers G837M (SEQ ID NO: 148): TACCGCCACGAAATCCCAATGGGACAGTTGTCCAACCTG and G837-rev (SEQ ID NO: 149): TGGGATTTCGTGGCGGTAG. For other G837X mutation (X represents 18 other amino acids except F), Primers G837X (SEQ ID NO: 150): TACCGCCACGAAATCCCAXXXGGACAGTTGTCCAACCTG (XXX was a codon corresponding to different amino acids) and G837-rev (SEQ ID NO: 149) were used to introduce mutation.

(183) A762T mutation was obtained by using primers A762T (SEQ ID NO: 151): GCTCAAGCTGGTACCGATGCTGTTGACGGTGCTTC and A762-rev (SEQ ID NO: 152): ACCAGCTTGAGCTGCAGC. For other A762X mutation (X represents 18 other amino acids except F), Primers A762X (SEQ ID NO: 153): GCTCAAGCTGGTXXXGATGCTGTTGACGGTGCTTC (XXX was a codon corresponding to different amino acids) and A762-rev (SEQ ID NO: 152) were used to introduce mutation.

(184) P824L mutation was obtained by using primers P824L (SEQ ID NO: 154): TTGAGTCTGGAACCTTGGGCCCAACCGGTCGC and P824-rev (SEQ ID NO: 155): GGTTCCAGACTCAAATGGCAGG. For other P824X mutation (X represents 18 other amino acids except F), Primers P824X (SEQ ID NO: 156): TTGAGTCTGGAACCXXXGGCCCAACCGGTCGC (XXX was a codon corresponding to different amino acids) and P824-rev (SEQ ID NO: 155) were used to introduce mutation.

(185) P826T mutation was obtained by using primers P826T (SEQ ID NO: 157): CTGGAACCCCAGGCACCACCGGTCGCGTCTAC and P826-rev (SEQ ID NO: 158): GCCTGGGGTTCCAGACTC. For other P826X mutation (X represents 18 other amino acids except F), Primers G837X (SEQ ID NO: 159): CTGGAACCCCAGGCXXXACCGGTCGCGTCTAC (XXX was a codon corresponding to different amino acids) and P826-rev (SEQ ID NO: 158) were used to introduce mutation.

(186) P1031S mutation was obtained by using primers P1031S (SEQ ID NO: 160): TGCGATCTCTGAGTCCGACGATAAGGGTATGC and P1031-rev (SEQ ID NO: 161): CTCAGAGATCGCATCCAGGC. For other P1031X mutation (X represents 18 other amino acids except F), Primers P1031X (SEQ ID NO: 162): TGCGATCTCTGAGXXXGACGATAAGGGTATGC (XXX was a codon corresponding to different amino acids) and P1031-rev (SEQ ID NO: 161) were used to introduce mutation.

(187) All mutants were transformed into P2 competent cells, and the results of screening malic acid were shown in FIGS. 30-37. For the mutation points where the positive mutation effect was better, A762D, P824V, P826E and P1031E (these four points could increase malic acid by 35.7%, 29.4%, 28.3%, and 34.2%, respectively) were selected for Combination mutation. Using the same method as saturation mutation, and the combination mutation was used to transform P2 strain, and the malate production results were shown in FIG. 38, wherein A726D/P826E and A762D/P824E/P1031E could increase malic acid by 41.4% and 42.3%, respectively, and the final malic acid synthesis capacity reached 75.2 g/L and 75.5 g/L.

Example 5 Application of Aomae in Saccharomyces cerevisiae to Synthesize Malic Acid

(188) I. Construction of Pyc, Mdh and AoMae Co-Expression Plasmid Vectors.

(189) The primers were as follows:

(190) TABLE-US-00016 Prs426-ScPYC2- SEQID CAACTAGTGGATCCCCCGGGCTGCAGG gibson-F NO:163 AATTCATGAGCAGTAGCAAGAAATTGG CCG T2A1-ScPYC2- SEQID CTCAACGTCACCGCAAGTAAGCAAAGA gibson-R NO:164 ACCTCTACCCTCAGCTCTCTTTTTTTG GGATGGGGGTAGGG T2A1-Aomae- SEQID CTTTGCTTACTTGCGGTGACGTTGAGG gibson-F NO:165 AAAACCCAGGTCCAATGCTGACACCTC CCAAGTTTGAGG T2A2-Aomae- SEQID CATCTCCGCAGGTCAAAAGGGATCCAC gibson-R NO:166 GTCCTTCGGCACGATCAGATACATCCT CATCTTTACC T2A2-ScMDH3 SEQID GACGTGGATCCCTTTTGACCTGCGGAG SKL-gibosn-F NO:167 ATGTCGAAGAGAATCCTGGACCTATGG TCAAAGTCGCAATTCTTGGCGC ScMDH3 SEQID CCCCTCGAGGTCGACGGTATCGATAAG SKL-gibson-R NO:168 CTTTCAAGAGTCTAGGATGAAACTCTT GCC

(191) Using S. cerevisiae CENPK.2-1C DNA and Aspergillus oryzae cDNA as templates, PCR was conducted to amplify ScPYC2, AoMae and MDH3 (removing mitochondrial localization sequence SKL). Three gene fragments were ligated into EcoRI and HindIII site of Prs426-pgk-CYCtt vector via Gibson method, and the three genes constituted a single cistron via 2A peptide (raegrgslltcgdveenpg), and the expression plasmid Prs426-PGK-ScPYC2-Aomae-MDH3ASKL was obtained.

(192) II. Construction of Saccharomyces cerevisiae Producing Malic Acid

(193) The plasmid Prs426-PGK-ScPYC2-Aomae-MDH3ASKL was transformed into S. cerevisiae CEN.PK2-1C by LiAc/SS Carrier DNA method (Methods Mol Biol. 2014; 1205: 1-12.) Malic acid synthesis was carried out on the same medium as Pichia pastoris to produce malic acid. The results were shown in FIG. 39. The results showed that 100 g/l glucose could produce 22 g/l malic acid.

Example 6 Modification of C4-Dicarboxylic Acid Transporter Encoding Gene Mae Improves Myceliophthora thermophila Malate Synthesis Capacity

(194) I. Construction of Mae Overexpression Vector

(195) C4-dicarboxylic acid transporter encoding gene mae (XM_001820829.2, SEQ ID NO: 1) and the mutant gene maeKA were amplified from the cDNA and plasmid pGAP-hph-his-AoMaeKA of Aspergillus oryzae DSM1863 (DSMZ, purchased from German Microbial and Cell Culture Co., Ltd.), digested with BglII, ligated into the linearized vector pAN52-hph digested with BglII and EcoRV. The ligation product was confirmed by digestion with restriction enzyme, thereby resulting in an overexpression vectors, named pAN52-Wtmae and pAN52-maeKA. The primers were as follows:

(196) TABLE-US-00017 mae-F SEQIDNO:169 GGAAGATCTTAATTAACTCGAGCGGCCGCGTTTAAAC ACTAGTATGCTGACACCTCCCAAGTTTG mae-R SEQIDNO:170 ATCCTAATCAGATACATCCTCATCTTTA

(197) Using the gene of the starting strain Myceliophthora thermophila ATCC42464 (purchased from American type culture collection) as a template, a 1.4 kb promoter (named Ptef promoter) upstream of the reading extension factor encoding reading frame (MYCTH_2298136) was amplified by PCR, and the primers were as follows:

(198) TABLE-US-00018 tef-F SEQIDNO:171 CCTTAATTAACATGTACCTTGACGTCCTCCGAG tef-R SEQIDNO:172 GGACTAGTTCTGAAGAACGAAACTGGCGACT

(199) After the PCR reaction was completed, the product was digested by PacI and SpeI, and ligated into the linearized vector pAN52-hph-mae which was double-digested by the same enzymes, and the ligated product was digested and identified with restriction enzymes. The mae gene expression vector under the control of promoter tef was named pAN52-Ptef-Wtmae and pAN52-Ptef-maeKA.

(200) II. Introduction of the Expression Vector into Myceliophthora thermophila

(201) A. Myceliophthora thermophila ATCC42464 was inoculated in MM slant medium [50 Vogel's salt 20 ml, sucrose 20 g, agar 15 g, histidine (50 mg/ml) 20 ml, adding water to 1 L, and sterilized with high pressure; 50 Vogel's salt (1 L): Trisodium citrate (H.sub.2O) 150 g, anhydrous KH.sub.2PO.sub.4 250 g, anhydrous NH.sub.4NO.sub.3 100 g, MgSO.sub.4.7H.sub.2O 10 g, CaCl.sub.2.2H.sub.2O 5 g, trace element salt solution 5 mL, biotin (0.1 mg/ml) 2.5 mL, adding water to 1 L]. B. Myceliophthora thermophila Protoplast Transformation
1) Mycelium Preparation

(202) The mature Myceliophthora thermophila spores were collected with 0.05% Tween 80 sterilized water, filtered off mycelia through lens-cleaning paper, inoculated on MM plates covered with cellophane, and incubated at 45 C. for 14 hours.

(203) 2) Protoplast Preparation

(204) Place cellophane with mycelium in 30 mL lysate (formulation: 0.15 g lyase, 30 mL solution A was added aseptically, and sterilized via filtration; Solution A: 1.0361 g KH.sub.2PO.sub.4, 21.864 g sorbitol, Dissolved in 90 ml deionized water, adjusted to pH 5.6 with potassium hydroxide, quantitative to 100 ml, high temperature sterilization), pyrolysis at 28 C. for 2 h, shaking gently every 20 min.

(205) After filtering through cellophane, centrifuge at 2000 rpm and 4 C. for 10 min, discard the supernatant, add 4 mL of solution B (0,735 g calcium chloride, 18, 22 g sorbitol, 1 ml TrisHCl 1M pH7.5, dissolved in 90 ml deionized. Adjust the pH to 7.6 with water and hydrochloric acid, quantify to 100 ml, and sterilize at high temperature), centrifuge at 2000 rpm and 4 C. for 10 min; discard the supernatant and add a certain volume of solution B according to 200 l/plasmid.

(206) 3) Protoplast Transformation

(207) Into a pre-chilled 15 ml centrifuge tube, 50 l pre-chilled PEG (12.5 g PEG6000, 0.368 g calcium chloride, 500 l Tris HCl 1M pH 7.5), 100 plasmid linearized with HindIII, and 2000 protoplast were added. After placing on ice for 20 min, 2 ml of pre-chilled PEG was added, placed at room temperature for 5 min, 4 mL of solution B was added, and mixed gently. 3 ml of the above solution was taken into 12 ml of melted MM medium containing the corresponding antibiotics, placed in a plate, and culture at 45 C. After 2 d-4 d, a single mycelium was picked under a stereomicroscope and allowed to grow on the corresponding resistant plate, and then PCR verification was conducted.

(208) III. Determination of Malic Acid Production Ability of Myceliophthora thermophila Transformants

(209) All the above verified transformants were inoculated into 50 mL medium in a 250 ml triangular flask with crystalline cellulose (Avicel) as the carbon source (formula: carbon source 75 g/l, peptone 6.0 g/l, 0.15 g/l KH.sub.2PO.sub.4, 0.15 g/l K2HPO.sub.4, 0.10 g/l CaCl.sub.2.2H.sub.2O, 0.10 g/l MgSO.sub.4.7H.sub.2O, calcium carbonate 80.0 g/l, 1 mL/L 0.5 g/l biotin, 1 ml/1 trace element solution; trace element formula (100 ml): 5 g C6H.sub.8O.Math.7H.sub.2O, 5 g ZnSO.sub.4.Math.7H.sub.2O, 1 g Fe(NH.sub.4).sub.2(SO.sub.4).Math.6H.sub.2O, 0.25 g CuSO.sub.4.Math.5H.sub.2O, 0.05 g MnSO.sub.4.Math.H.sub.2O, 0.05 g H.sub.3BO.sub.3, 0.05 g NaMoO.sub.4.Math.2H.sub.2O, dissolved in water, and water was added to 100 ml). The inoculation volume was 2.510.sup.5/ml (45 C., 150 rpm cultivation). Sample was taken on the eighth day to determine the malic acid content.

(210) 1) Sample Processing:

(211) Take 1 ml of fermentation broth in a 15 ml centrifuge tube, and add 1 ml of 1M H.sub.2SO.sub.4, then place at 80 C. for 30 min, and shake thoroughly every 10 min. Then add 2 ml of double-distilled water into the centrifuge tube, shake it well, take 1 ml of liquid in a 1.5 ml centrifuge tube, centrifuge at 12000 rpm for 10 min, and take the supernatant to measure the malic acid content.

(212) 2) Determination of Malic Acid Content

(213) The processed samples were determined by high performance liquid chromatography, where the detector was a UV detector, 5 mM H.sub.2SO.sub.4 was the mobile phase, and the flow rate was 0.5 ml/min. The results showed that the malate transporter, after mutation, could significantly promote malate production as compared to the wild-type transporter. On the eighth day, the malic acid production of the transformant MaeKA was 46 g/l, which was an increase of 9.5% compared with the control strain WtMae (42 g/l). The experiment showed that the mutated C4-dicarboxylic acid transporter could significantly increase the production capacity of malate in the thermophilic fungus such as Myceliophthora thermophila.

Example 7 Modified TCA Key Enzyme Pyruvate Carboxylase Improves Myceliophthora thermophila Malate Synthesis Capacity

(214) I. Construction of Overexpression Vector

(215) The pyruvate carboxylase gene Cgpyc and its mutated gene CgpycA726D/P826E were amplified from the Corynebacterium glutamicum ATCC13032 genome and the plasmid pGAPzA-his-CgPycDE, respectively, and digested by SpeI and EcoRV, and then ligated into linearized vector pAN52-C1pgdA-neo digested with the same endonuclease, and the ligation product was identified by digestion with restriction enzyme, thereby obtaining the overexpression vectors, named pAN52-Wtpyc and pAN52-pycA726D/P826E. The primers were as follows:

(216) TABLE-US-00019 CgPYC-F SEQIDNO:173 GGACTAGTATGTCGACTCACACATCTTCA CgPYC-R SEQIDNO:174 AAAAAGATATCTTAGGAAACGACGACGATCAAG
II. Determination of Malic Acid Production Ability of Myceliophthora thermophila Transformants

(217) The overexpression vectors pAN52-Wtpyc and pAN52-pycA726D/P826E were linearized by BglII and integrated into the genome of Myceliophthora thermophila WtMae strain. The 100 g/ml G418 was used as a final concentration of screening antibiotic, and the method was shown in step II of Example 1. Using primers CgPYC-F and CgPYC-R, it was confirmed that the transformants were obtained, named as WtPYC and PYCA726D/P826E.

(218) All the verified transformants were inoculated into 50 ml in a 250 ml triangular flask with crystalline cellulose (Avicel) as the carbon source medium (for formula, see step III in Example 1). The inoculation amount was 2.510.sup.5/ml (cultured at 45 C., 150 rpm), and sample was taken on the eighth day. After the sample was processed by the method described in Step 3.2 of Example 1, the malic acid content in the fermentation broth was determined.

(219) The results showed that compared with wild-type pyruvate carboxylase, the mutation can significantly increase the malate production of transformants. On the eighth day, the maltate production of the transformant WtPYC was 49.9 g/l, while the malate production of the transformant overexpressing the mutant pyc reached 57.9 g/l with an increase of 16%. The experiment shows that after protein modification to increase the activity of pyruvate, the ability to synthesize malic acid in Myceliophthora thermophila can be significantly improved.

(220) All documents mentioned in the present invention are incorporated herein by reference, as if each document were individually recited for reference. It should be understood that those skilled in the art will be able to make various changes or modifications to the present invention after reading the teachings of the present invention, which also fall within the scope of the invention defined by the appended claims of the application.