Methods and compositions
12415862 ยท 2025-09-16
Assignee
Inventors
Cpc classification
A61K39/395
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
C07K16/2878
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The present invention provides polypeptides capable of targeting antigens, such as neoantigens, to particular immune cells, and associated therapeutic methods. In particular embodiments, the polypeptides are antibodies or antibody-based polypeptides.
Claims
1. A complex comprising a polypeptide and a tagged antigen, wherein the polypeptide comprises at least one immune cell binding domain and at least one tag binding domain, wherein the at least one immune cell binding domain specifically binds to an immune cell target, and wherein the at least one tag binding domain specifically binds to a tag, and wherein the tagged antigen comprises the tag to which the tag binding domain of the polypeptide binds.
2. The complex of claim 1 wherein the antigen is a peptide, protein or fragment thereof that comprises an antigenic peptide or protein sequence.
3. The complex according to claim 2 wherein the antigenic peptide or protein sequence is a cancer antigen, optionally wherein the cancer antigen is a Human Papillomavirus (HPV)-associated cancer antigen.
4. The complex of claim 1 wherein the polypeptide comprises at least two tag binding domains capable of binding to at least two different tags, and wherein the complex comprises at least two tagged antigens.
5. The complex according to claim 1 wherein the antigen comprises an antigenic peptide or protein sequence that has been identified as a neoantigen that has arisen in a tumour or cell.
6. The complex according to claim 1 wherein the antigen comprises an antigenic peptide or protein sequence that is derived from a pathogen, optionally wherein the pathogen is a bacteria, fungus or virus, optionally wherein the virus is Human Papillomavirus (HPV).
7. The complex according to claim 1 wherein the tag is a peptide tag and wherein the peptide tag is not derived from tetanus toxin.
8. The complex according to claim 1, wherein the at least one tag binding domain is an Fc region of an antibody or antibody fragment or variant of an Fc region of an antibody or antibody fragment which specifically binds to a peptide tag.
9. The complex according to claim 1, wherein the tag binding domain binds to the Fc-binding peptide Z33 TABLE-US-00004 [SEQIDNO:51] (FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD).
10. A pharmaceutical composition comprising a complex according to claim 1.
11. The pharmaceutical composition according to claim 10 wherein the composition comprises more than one different complex, optionally wherein the antigen in each complex is different and the tag is the same, optionally wherein the antigens are antigenic peptides or proteins and wherein the antigenic sequences of the tagged antigen(s) of each complex are different and the tag is the same in each complex; or wherein the tag is different in each complex and the sequence of the antigenic peptides or proteins in each complex are different.
12. A method for the treatment or prevention of a disease wherein the method comprises administering a complex according to claim 1, optionally wherein said disease is cancer.
13. The method of claim 12 wherein said disease is pathogenic infection, optionally wherein the method is for the treatment or prevention of a bacterial, fungal or viral infection, wherein the antigen comprises an antigenic peptide or protein sequence derived from a bacteria, fungus or virus, optionally from Human Papillomavirus (HPV).
14. The method of claim 12 wherein the antigen comprises an antigenic peptide or protein sequence that has been identified as a neoantigen that has arisen in a cell, optionally a tumour cell; or a cancer protein or peptide antigen.
15. The method of claim 12, wherein a peptide or protein neoantigen has been identified as having arisen in the patient, and wherein the tagged antigen comprises the neoantigen peptide or protein sequence.
16. The method according to claim 15 wherein the method further comprises the initial step of identifying a neoantigen that has arisen in a patient.
17. A method of producing a complex according to claim 1, wherein the method comprises contacting the polypeptide with a tagged antigen in vitro.
18. An in vitro or ex vivo method of activating an immune cell, wherein the method comprises contacting the immune cell with a complex according to claim 1, wherein the immune cell comprises the immune cell target to which the immune cell binding domain of the polypeptide binds.
19. A polypeptide comprising at least one immune cell binding domain and at least one tag binding domain, wherein the at least one immune cell binding domain is capable of specifically binding to an immune cell target; and wherein the at least one tag binding domain is capable of specifically binding to a tag, optionally a peptide tag, wherein the peptide tag is not derived from tetanus toxin.
20. A complex formed by contacting a polypeptide with a tagged antigen in vitro, wherein the polypeptide comprises at least one immune cell binding domain and at least one tag binding domain, wherein the at least one immune cell binding domain specifically binds to an immune cell target, and wherein the at least one tag binding domain specifically binds to a tag, and wherein the tagged antigen comprises the tag to which the tag binding domain of the polypeptide binds, optionally wherein the tag is a peptide tag.
Description
FIGURE LEGENDS
(1)
(2)
(3)
(4)
(5) The invention is also defined by reference to the following numbered embodiment paragraphs:
(6) 1. A polypeptide comprising at least one immune cell binding domain and at least one tag binding domain, wherein the at least one immune cell binding domain is capable of specifically binding to an immune cell target; and wherein the at least one tag binding domain is capable of specifically binding to a peptide tag, wherein the peptide tag is not derived from tetanus toxin.
(7) 2. The polypeptide according to embodiment 1 wherein the polypeptide comprises more than one immune cell binding domain, optionally comprises 2, 3, or 4 immune cell binding domains.
(8) 3. The polypeptide according to any one of embodiments 1 or 2 wherein the polypeptide comprises more than one peptide tag binding domain, optionally comprises 2, 3, or 4 peptide tag binding domains.
(9) 4. The polypeptide according to embodiment 3 wherein each of the peptide tag binding domains binds to the same peptide tag.
(10) 5. The polypeptide according to embodiment 3 wherein one or more of the more than one peptide tag binding domains binds to a different peptide tag.
(11) 6. The polypeptide according to any one of embodiments 1-5 wherein the immune cell is an antigen presenting cell, such as a dendritic cell (DC), B cell and/or macrophage (preferably DC).
(12) 7. The polypeptide according to any one of embodiments 1-6 wherein the immune cell binding domain is an agonist of the immune cell target.
(13) 8. The polypeptide according to any one of embodiments 1-7 wherein the immune cell target is capable of mediating: activation of the immune cell; and/or internalisation of the polypeptide; and/or recruitment of conventional type I dendritic cells (cDC1).
(14) 9. The polypeptide according to any one of embodiments 1-8 wherein the immune cell binding domain binds to an immune cell receptor, optionally wherein the immune cell receptor is CD40, CLEC9A, DEC-205, XCR1 or TLR3.
(15) 10. The polypeptide according to embodiment 9 wherein the at least one immune cell binding domain binds to CD40.
(16) 11. The polypeptide according to any one of embodiments 1-10 wherein the immune cell binding domain is an antibody selected from: ADC-1013; clones 1132/1133, 1140/1135, 1150/1151 and 1107/1108 from WO 2015/091853; CP-870,893, APX005M, ChiLob 7/4, SEA-CD40;
(17) wherein: ADC-1013 comprises one or more sequences selected from SEQ ID NO: 41-48; 1132/1133 comprises one or more sequences selected from SEQ ID NO: 1-8; 1140/1135 comprises one or more sequences selected from SEQ ID NO: 11-18; 1150/1151 comprises one or more sequences selected from SEQ ID NO: 21-28; 1107/1108 comprises one or more sequences selected from SEQ ID NO: 31-38.
(18) 12. The polypeptide according to any one of embodiments 1-11 wherein the peptide tag binding domain is capable of binding to a FLAG tag (DYKDDDDK) or a peptide probe sequence, optionally wherein the peptide probe sequence is a coiled-coil peptide tag E3 comprising the amino acid sequence (EIAALEK)3.
(19) 13. The polypeptide according to any one of embodiments 1-12 wherein the peptide tag is a non-human peptide.
(20) 14. The polypeptide according to any one of embodiments 1-13 wherein the immune cell binding domain is selected from the group consisting of: antibodies or antigen binding fragments thereof.
(21) 15. The polypeptide according to any one of embodiments 1-14 wherein the peptide tag binding domain is: a) selected from group consisting of: antibodies or antigen binding fragments thereof; and/or b) is not an Fc region.
(22) 16. The polypeptide according to any one of embodiments 14 or 15 wherein the antigen-binding fragment is selected from the group consisting of: an Fv fragment (such as a single chain Fv fragment, or a disulphide-bonded Fv fragment); a Fab-like fragment (such as a Fab fragment; a Fab fragment; or a F(ab)2 fragment); and domain antibodies.
(23) 17. The polypeptide according to any one of embodiments 1-14 and 16 wherein the peptide tag binding domain is an Fc region of an antibody having the ability to specifically bind to the peptide tag.
(24) 18. The polypeptide according to any one of embodiments 1-17 wherein the polypeptide comprises at least 2 peptide tag binding domains, wherein at least one peptide tag binding domain is selected from the group consisting of: antibodies or antigen binding fragments thereof; and wherein at least one peptide tag binding domain is an Fc region of an antibody having the ability to specifically bind to the peptide tag.
(25) 19. The polypeptide according to any one of embodiments 1-18 wherein the polypeptide comprises: a) at least one immune cell binding domain that comprises or consists of an IgG antibody and at least one peptide tag binding domain that comprises or consists of an IgG antibody; b) at least one immune cell binding domain that comprises or consists of an IgG antibody and at least one peptide tag binding domain that comprises or consists of an Fv fragment; c) at least one immune cell binding domain that comprises or consists of an IgG antibody and at least one peptide tag binding domain that comprises or consists of a Fab-like fragment; d) at least one immune cell binding domain that comprises or consists of an IgG antibody and at least one peptide tag binding domain that comprises or consists of a domain antibody; e) at least one immune cell binding domain that comprises or consists of an IgG antibody and at least one peptide tag binding domain that comprises or consists of a coiled-coil peptide tag (such as E3 ((EIAALEK)3)) that binds to a probe (such as K3 ((KIAALKE)3) or K4 ((KIAALKE)4), wherein the probe is connected to the neoantigen; f) at least one immune cell binding domain that comprises or consists of an Fv fragment and at least one peptide tag binding domain that comprises or consists of an IgG antibody; g) at least one immune cell binding domain that comprises or consists of a Fab-like fragment and at least one peptide tag binding domain that comprises or consists of an IgG antibody; h) at least one immune cell binding domain that comprises or consists of a domain antibody and at least one peptide tag binding domain that comprises or consists of an IgG antibody; i) at least one immune cell binding domain that comprises or consists of an IgG antibody and at least one peptide tag binding domain that comprises or consists of an Fc region of an antibody having the ability to specifically bind to the peptide tag; j) at least one immune cell binding domain that comprises or consists of an Fv fragment and at least one peptide tag binding domain that comprises or consists of an Fc region of an antibody having the ability to specifically bind to the peptide tag; k) at least one immune cell binding domain that comprises or consists of a Fab-like fragment and at least one peptide tag binding domain that comprises or consists of an Fc region of an antibody having the ability to specifically bind to the peptide tag; l) at least one immune cell binding domain that comprises or consists of a domain antibody and at least one peptide tag binding domain that comprises or consists of an Fc region of an antibody having the ability to specifically bind to the peptide tag; m) at least two immune cell binding domains that comprise or consist of an IgG antibody wherein the at least two dendritic cell binding domains bind to the same dendritic cell target, and at least one peptide tag binding domain that comprises or consists of an Fc region of an antibody having the ability to specifically bind to the peptide tag; n) at least two immune cell binding domains that comprise or consist of an IgG antibody wherein the at least two dendritic cell binding domains bind to the same dendritic cell target, and at least one peptide tag binding domain that comprises or consists of a coiled-coil peptide tag (such as E3 ((EIAALEK)3)) that binds to a probe (such as K3 ((KIAALKE)3) or K4 ((KIAALKE)4), wherein the probe is connected to the neoantigen, optionally wherein the IgG antibody is an IgG1, IgG2, IgG3 or IgG4 antibody.
(26) 20. The polypeptide according any one of embodiments 1-19 wherein the polypeptide is a bispecific polypeptide, and optionally comprises or consists of a format selected from the group consisting of: a) IgG-scFv bispecific antibodies; b) monovalent bispecific antibodies; c) scFv2-Fc bispecific antibodies; d) BiTE/scFv2 bispecific antibodies; e) DVD-Ig bispecific antibodies; f) DART-based bispecific antibodies; g) DNL-Fab3 bispecific antibodies; and h) scFv-HSA-scFv bispecific antibodies i) RUBY format antibodies, wherein the antibody comprises: (i) two copies of a first heavy chain polypeptide and two copies of a first light chain polypeptide, and (ii) two Fab fragments, the Fab fragments comprising a second heavy chain polypeptide and a second light chain polypeptide and wherein the first Fab fragment is fused to the C-terminus of the first copy of the first heavy chain polypeptide via the light chain polypeptide of the Fab fragment; and the second Fab fragment is fused to the C-terminus of the second copy of the first heavy chain polypeptide via the light chain polypeptide of the Fab fragment, and wherein a) the two copies of a first heavy chain polypeptide and two copies of a first light chain polypeptide form two immune cell binding domains and the two Fab fragments form a first and second tag binding domain; or b) the two copies of a first heavy chain polypeptide and two copies of a first light chain polypeptide form a first and a second tag binding domain, and the two Fab fragments form two immune cell binding domains.
(27) 21. The polypeptide according to any one of embodiments 1-20 wherein the polypeptide comprises an Fc region or a variant of said region, optionally wherein the region is an IgG1, IgG2, IgG3 or IgG4 region, optionally IgG1 or IgG2.
(28) 22. The polypeptide according to any of embodiments 1-21 wherein the polypeptide is a monospecific antibody directed towards the immune cell target, and wherein the Fc region has been modified to be capable of binding to the peptide tag; a bispecific antibody wherein one paratope comprises the immune cell binding domain and the second paratope comprises the peptide tag binding domain, and optionally wherein the Fc region of the antibody has been modified to be capable of binding to a peptide tag.
(29) 23. A complex comprising a polypeptide according to any one of embodiments 1-22 and a tagged peptide antigen, wherein the tagged peptide antigen comprises the peptide tag to which the tag binding domain of the polypeptide binds.
(30) 24. The complex of embodiment 23 wherein the polypeptide comprises at least two peptide tag binding domains capable of binding to at least two different peptide tags, and wherein the complex comprises at least two tagged peptide antigens.
(31) 25. The complex according to any one of embodiments 23 or 24 wherein the tagged peptide antigen comprises an antigenic sequence that has been identified as a neoantigen that has arisen in a tumour or cell.
(32) 26. The complex according to any one of embodiments 23 and 24 wherein the tagged peptide antigen comprises an antigenic peptide sequence that is a cancer antigen, optionally wherein the cancer antigen is a Human Papillomavirus (HPV)-associated cancer antigen.
(33) 27. The complex according to any one of embodiments 23 or 24 wherein the tagged peptide antigen comprises an antigenic sequence that is derived from a pathogen, optionally wherein the pathogen is a bacteria, fungus or virus, optionally wherein the virus is Human Papillomavirus (HPV).
(34) 28. A complex formed by contacting a polypeptide according to any of embodiments 1-22 with a tagged peptide antigen in vitro, wherein the tagged peptide antigen comprises the peptide tag to which the tag binding domain of the polypeptide binds.
(35) 29. A pharmaceutical composition comprising a complex according to any of embodiments 23 and 28.
(36) 30. The pharmaceutical composition according to embodiment 29 wherein the composition comprises more than one different complex according to any of embodiments 23-28, and wherein the sequence of the tagged peptide antigen(s) of each complex are different, optionally wherein the sequence of the tag is the same and the sequence of the peptide antigen is different; or wherein the sequence of the tag is different and the sequence of the peptide is different.
(37) 31. A complex according to any one of embodiments 23-28 or a pharmaceutical composition according to any one of embodiments 29 or 30 for use in medicine.
(38) 32. A complex according to any one of embodiments 23-28 or a pharmaceutical composition according to any one of embodiments 29 or 30 for use in a method of treating or preventing cancer, optionally wherein the tagged peptide antigen comprises an antigenic sequence that has been identified as a neoantigen that has arisen in a tumour or cell; or a cancer antigen.
(39) 33. A complex according to any one of embodiments 23-28 or a pharmaceutical composition according to any one of embodiments 29 or 30 for use in a method of treating or preventing a pathogenic infection, optionally for treating or preventing a bacterial, fungal or viral infection, wherein the tagged peptide antigen comprises an antigenic sequence derived from a bacteria, fungus or virus, optionally from Human Papillomavirus (HPV).
(40) 34. A complex according to any one of embodiments 23-28 or a pharmaceutical composition according to any one of embodiments 29 or 30 for use in a method of personalised therapy, wherein a neoantigen has been identified as having arisen in a patient, and wherein the tagged antigenic peptide comprises the neoantigen.
(41) 35. The complex for use according to embodiment 34 wherein the personalised therapy is for the treatment or prevention of cancer.
(42) 36. The complex for use according to any of embodiments 34 or 35 wherein the method of personalised therapy involves the initial step of identifying a neoantigen that has arisen in a patient.
(43) 37. A method for the treatment or prevention of a disease wherein the method comprises administering a complex according to any one of embodiments 23-28 or a pharmaceutical composition according to any one of embodiments 29 or 30.
(44) 38. A method for the treatment or prevention of cancer, wherein the method comprises administering a complex according to any one of embodiments 23-28 or a pharmaceutical composition according to any one of embodiments 29 or 30, optionally wherein the tagged peptide antigen comprises an antigenic sequence that has been identified as a neoantigen that has arisen in a cell, optionally a tumour cell; or a cancer antigen.
(45) 39. A method for the treatment or prevention of a pathogenic infection, wherein the method comprises administering a complex according to any one of embodiments 23-28 or a pharmaceutical composition according to any one of embodiments 29 or 30, optionally wherein the method is for the treatment of prevention of a bacterial, fungal or viral infection, wherein the tagged peptide antigen comprises an antigenic sequence derived from a bacteria, fungus or virus, optionally from Human Papillomavirus (HPV).
(46) 40. A method for the personalised treatment or prevention of a disease in a patient, wherein the method comprises administering a complex according to any one of embodiments 23-28 or a pharmaceutical composition according to any one of embodiments 29 or 30, optionally wherein the tagged peptide antigen comprises an antigenic sequence that has been identified as a neoantigen that has arisen in a cell, optionally a tumour cell; or a cancer antigen.
(47) 41. A method for personalised therapy, comprising administering a complex according to any of embodiments 23-28 or a pharmaceutical composition according to any of embodiments 29 or 30 to a patient, wherein a neoantigen has been identified as having arisen in the patient, and wherein the tagged antigenic peptide comprises the neoantigen.
(48) 42. The method according to embodiment 41 wherein the personalised therapy is for the treatment or prevention of cancer.
(49) 43. The method according to any one of embodiments 41 or 42 wherein the method of personalised therapy involves the initial step of identifying a neoantigen that has arisen in a patient.
(50) 44. A method of producing a complex comprising a polypeptide according to any one of embodiments 1-22 and a tagged peptide antigen, wherein the tagged peptide antigen comprises the peptide tag to which the tag binding domain of the polypeptide binds, wherein the method comprises contacting the polypeptide according to any of embodiments 1-22 with a tagged peptide antigen in vitro.
(51) 45. An in vitro or ex vivo method of activating an immune cell, wherein the method comprises contacting the immune cell with a complex according to any of embodiments 23-28 or a pharmaceutical composition according to any of embodiments 29 or 30, wherein the immune cell comprises the immune cell target to which the immune cell binding domain of the polypeptide binds.
(52) 46. A nucleic acid encoding the polypeptide according to any of embodiments 1-22.
(53) 47. A vector comprising the nucleic acid according to embodiment 46.
(54) 48. A cell comprising the nucleic acid according to embodiment 46 or the vector according to embodiment 47.
(55) 49. A kit for the in vitro preparation of a complex according to any of embodiments 23-28 wherein the kit comprises a polypeptide according to any of embodiments 1-22 and a tagged peptide antigen.
(56) 50. The kit according to embodiment 49 wherein the kit comprises a buffer suitable for the in vitro formation of the complex.
(57) Features of the invention are as illustrated below in the following Examples.
Example 1: Priming of Ovalbumin-specific CD8+ T Cells by Anti-CD40-Fc(OVA) Antibody
(58) Background and Aim
(59) The OVA peptide SIINFEKL [SEQ ID NO: 70] was conjugated to the Fc of an anti-CD40 antibody (bivalent, monospecific) by use of Z33, a 33 amino acid long Fc-binding peptide, which binds between the CH2 and CH3 region of the Fc domain. The SIINFEKL peptide was in turn covalently linked to the Z33 peptide via a GSSSS linker. The purpose with this anti-CD40-Fc(OVA) antibody is to evaluate a concept wherein a peptide is conjugated to an anti-CD40 agonist and how such conjugation impacts T cell responses to the peptide. Ultimately, the OVA peptide can be exchanged to one or more tumor antigens to induce an immune response directed against tumor cells expressing such antigen(s).
(60) Thus, the aim of this experiment was to evaluate the effect of the anti-CD40-Fc(OVA) antibody on the priming of OVA-specific CD8+ T cells, compared to an anti-CD40 antibody and OVA peptide administered separately.
Materials and Methods
(61) Human CD40 transgenic (hCD40tg) mice, 8-9 weeks of age, were given a mixture of 33 g anti-CD40 antibody and 18.9 g Z33-OVA complex s.c. on two occasions, 7 days between. Additional cohorts of mice were instead given 33 g anti-CD40 antibody and 3.3 g OVA peptide separately or vehicle (PBS) control.
(62) Seven days after the second treatment, mice were sacrificed and inguinal lymph nodes collected. The lymph nodes were mashed through cell strainers to obtain single cell suspensions and the cells were subsequently Fc blocked and stained with an antibody cocktail containing fluorescently-labelled anti-mouse antibodies for CD11b, CD19, MHCII, NK1.1 (dump channel), and CD45, CD3, CD4 and CD8, as well as OVA (SIINFEKL) MHCI tetramer. The cells were also stained with Fixable Viability Stain 780 (BD Biosciences) to assess the cell viability. Samples were analysed by flow cytometry in order to determine the frequency of viable CD45+ CD3+ CD8+ OVA-MHCI tetramer+ T cells.
Results and Conclusions
(63) The data (shown in
Example 2: Effect on Priming of OVA-specific T Cells in Vivo
(64) Background and Aim
(65) The OVA peptide-linked Fc-binding peptide Z33 is capable of binding to antibodies, thereby forming an antibody-antigenic peptide complex. By using Z33-OVA in combination with a CD40 agonistic antibody, the antigenic peptide is targeted to CD40-expressing antigen-presenting cells such as dendritic cells (DC), which enhances cross-presentation of the antigen and increases priming of antigen-specific T cells. The purpose with this Fc-binding peptide is to generate a concept where T cell priming is improved when the Fc-binding peptide is combined with a DC-targeting and activating antibody. The aim of this experiment was to evaluate the effect on T cell priming when Z33-OVA or free OVA peptide is combined with either a CD40 agonistic antibody, an isotype control antibody, or an adjuvant to which Z33 does not bind.
Materials and Methods
(66) Human CD40 transgenic (hCD40tg) mice, 12-14 weeks of age, were given a mixture of 18.9 g Z33-OVA peptide or a molar equivalent dose of 3.3 g free OVA peptide (SIINFEKL) and either 33 g anti-CD40 antibody, 33 g isotype control antibody, or 50 g Poly I:C (a TLR3 ligand used as adjuvant) s.c. on two occasions, 7 days between. An additional cohort of mice were instead given vehicle (PBS) control.
(67) Seven days after the second treatment, mice were sacrificed and inguinal lymph nodes collected. The lymph nodes were mashed through cell strainers to obtain single cell suspensions and the cells were subsequently Fc blocked and stained with an antibody cocktail containing fluorescently-labelled anti-mouse antibodies for CD11 b, CD19, MHCII, NK1.1 (dump channel), and CD45, CD3, CD4 and CD8, as well as OVA (SIINFEKL) MHCI tetramer. The cells were also stained with Fixable Viability Stain 780 (BD Biosciences) to assess the cell viability. Samples were analysed by flow cytometry in order to determine the frequency of viable CD45+ CD3+ CD8+ OVA-MHCI tetramer+ T cells.
Results and Conclusions
(68) The data (shown in
Example 3: Anti-tumor Efficacy of an OVA-expressing Tumor Model, Comparing Anti-CD40-Fc(OVA) to Vehicle Control
(69) Background and Aim
(70) By treating mice subcutaneously with the anti-CD40-Fc(OVA) antibody (i.e. anti-CD40 antibody complexed with the Z33-OVA peptide), an OVA-specific T cell response was induced in draining lymph nodes. Ultimately, the OVA peptide can be exchanged for tumor antigen peptides to induce a tumor-specific immune response against tumors expressing such antigens. This tumor-targeting immune response would be expected to reduce the growth of an established tumor.
(71) Thus, the aim of this experiment was to evaluate the effect of the anti-CD40-Fc(OVA) antibody on the growth of the OVA-expressing tumor EG7-OVA in a therapeutic vaccination setting.
Materials and Methods
(72) Human CD40 transgenic (hCD40tg) female mice, 10-12 weeks of age, were inoculated with 1.010.sup.6 EG7-OVA cells s.c. on the right flank on day 0. On day 1 and 8, mice were given either a mixture of 100 g anti-CD40 antibody and 57 g Z33-OVA peptide (anti-CD40-Fc(OVA) antibody) (which were mixed together prior to administration to allow complexes between the antibody and tagged antigen to form prior to administration to the mice) or vehicle control (Dextrose) s.c. on the left flank. Tumor volume and survival was monitored.
Results and Conclusions
(73) The data (shown in
Example 4: Comparison of the Anti-tumor Efficacy of CD40-Fc(OVA) (Pre-mixed Combination of Anti-CD40 and Z33-OVA) and Separate Administration of Anti-CD40 and OVA in an OVA-expressing Tumor Model
(74) Background and Aim
(75) Treatment with anti-CD40-Fc(OVA) antibody was shown to result in a significantly reduced tumor volume (p=0.0022 on day 14, 17 and 21) compared to vehicle control (Example 3).
(76) The aim of this experiment was to evaluate the effect of the anti-CD40-Fc(OVA) antibody (i.e. the pre-mixed complex of the anti-CD40 antibody and the Z33-OVA peptide) on the growth of the OVA-expressing tumor EG7-OVA in a therapeutic vaccination setting, compared to the separate administration of the anti-CD40 and OVA peptide (SIINFEKL).
Materials and Methods
(77) Human CD40 transgenic (hCD40tg) female mice, 9-11 weeks of age, were inoculated with 1.010.sup.6 EG7-OVA cells s.c. on the right flank on day 0. On day 1 and 8, mice were given either a mixture of 100 g anti-CD40 antibody and 19 g Z33-OVA peptide (anti-CD40-Fc(OVA) antibody) (which were mixed together prior to administration to allow complexes between the antibody and tagged antigen to form prior to administration to the mice) or anti-CD40 and 3.3 g OVA peptide (a molar equivalent dose to Z33-OVA peptide) s.c. on the left flank. Tumor volume and survival was monitored.
Results and Conclusions
(78) The data (shown in
(79) This data validates the hypothesis that targeting antigens to particular immune cells is beneficial over administration of the antigen in the absence of targeting. It will be clear that the OVA antigen used here, the Z33 tag used here, and the CD40 binding domains used here can be replaced with any antigen, tag, or immune cell binding domain.
REFERENCES
(80) 1. Sharma, P. and J. P. Allison, The future of immune checkpoint therapy. Science, 2015. 348(6230): p. 56-61. 2. Picco, G., et al., Targeting DNGR-1 (CLEC9A) with antibody/MUC1 peptide conjugates as a vaccine for carcinomas. Eur J Immunol, 2014. 44(7): p. 1947-55. 3. Zom, G. G., et al., Two in one: improving synthetic long peptide vaccines by combining antigen and adjuvant in one molecule. Oncoimmunology, 2014. 3(7): p. e947892. 4. Sanchez-Paulete, A. R., et al., Cancer Immunotherapy with Immunomodulatory Anti-CD137 and Anti-PD-1 Monoclonal Antibodies Requires BATF3-Dependent Dendritic Cells. Cancer Discov, 2016. 6(1): p. 71-9. 5. Reuter, A., et al., Criteria for dendritic cell receptor selection for efficient antibody-targeted vaccination. J Immunol, 2015. 194(6): p. 2696-705. 6. Chatterjee, B., et al., Internalization and endosomal degradation of receptor-bound antigens regulate the efficiency of cross presentation by human dendritic cells. Blood, 2012. 120(10): p. 2011-20. 7. Wang, W. W., et al., Antigen targeting to dendritic cells with bispecific antibodies. J Immunol Methods, 2005. 306(1-2): p. 80-92. 8. Yin, W., et al., Functional Specialty of CD40 and Dendritic Cell Surface Lectins for Exogenous Antigen Presentation to CD8(+) and CD4(+) T Cells. EBioMedicine, 2016. 5: p. 46-58. 9. Geert A. Daudey, Harshal R. Zope, Jens Voskuhl, Alexander Kros, and Aimee L. Boyle, Membrane-Fusogen Distance Is Critical for Efficient Coiled-Coil-Peptide-Mediated Liposome Fusion, Langmuir, 2017, 33, 12443-12452 10. Y. Yano, A. Yano, S. Oishi, Y. Sugimoto, G. Tsujimoto, N. Fujii and K. Matsuzaki, ACS Chem. Biol., 2008, 3, 341-345