PROTEIN INHIBITORS OF CLOSTRIDIUM DIFFICILE TOXIN B

20250312414 ยท 2025-10-09

Assignee

Inventors

Cpc classification

International classification

Abstract

In an embodiment, the present disclosure pertains to a method of treating or preventing C. difficile infections. In some embodiments, the method includes administering an anti-toxin to a subject in need thereof. In some embodiments, the anti-toxin includes a designed ankyrin repeat protein (DARPin). In an additional embodiments, the present disclosure pertains to a composition including an anti-toxin for treating or preventing C. difficile infections. In some embodiments, the anti-toxin includes a DARPin. In some embodiments, the anti-toxin is a monomeric or dimeric DARPin for the neutralization of Clostridium difficile toxin B (TcdB).

Claims

1. A composition comprising an anti-toxin for treating or protecting against Clostridium difficile (C. difficile) infections, wherein the anti-toxin comprises a designed ankyrin repeat protein (DARPin) dimer comprising a first DARPin monomer selected from U3 (SEQ ID NO: 13), 1.8H (SEQ ID NO:3) and 5.5A (SEQ ID NO:6) and a second DARPin monomer selected from 7.5A (SEQ ID NO:7), 1.2E (SEQ ID NO:1), 1.4E (SEQ ID NO:2) and 1.11E (SEQ ID NO: 4).

2. The composition of claim 1, wherein the composition is formulated to be administered via a mode selected from the group consisting of intravenously, orally, in situ, in situ via engineered commensal bacteria, in situ via engineered commensal yeast, and combinations thereof.

3. The composition of claim 1, wherein the anti-toxin is produced via Escherichia coli (E. coli) in a fermenter.

4. The composition of claim 1, wherein the DARPin dimer is DLD-1 (SEQ ID NO:34).

5. The composition of claim 1, wherein the DARPin dimer is DLD-2 (SEQ ID NO:35).

6. The composition of claim 1, wherein the DARPin dimer is DLD-4 (SEQ ID NO:37).

7. The composition of claim 1, wherein the DARPin dimer is DLD-12 (SEQ ID NO:43).

8. The composition of claim 1, wherein the DARPin monomers are connected by a linker.

9. The composition of claim 8, wherein the linker is (GGGGS)3 (SEQ ID NO. 48).

10. A method of treating C. difficile infection in a subject in need thereof, wherein the method comprises administering to the subject the composition of claim 1.

11. The method of claim 10, wherein the DARPin dimer neutralizes C. difficile secreted exotoxins.

12. The method of claim 11, wherein the C. difficile secreted exotoxins are toxin B (TcdB).

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0009] A more complete understanding of the subject matter of the present disclosure may be obtained by reference to the following Detailed Description when taken in conjunction with the accompanying Drawings wherein:

[0010] FIG. 1A shows a monomeric designed ankyrin repeat protein (DARPin) sequence in schematic form. FIG. 1B shows a dimeric designed ankyrin repeat protein (DARPin) sequence in schematic form. FIG. 1C shows a schematic of a DARPin in accordance with an embodiment of the invention.

[0011] FIG. 2A, FIG. 2B, and FIG. 2C illustrate characterization of monomeric DARPins.

[0012] FIG. 3A, FIG. 3B, and FIG. 3C illustrate characterization of dimeric DARPins.

[0013] FIG. 4 illustrates DARPin dimers exhibit superior toxin-neutralization potency relative to the constituent monomers.

[0014] FIG. 5 illustrates DARPins dimers demonstrate avidity in TcdB binding. Binding of selected DARPin monomers, pooled monomers or dimers to TcdB was determined using ELISA. Combinations of serially diluted DARPins were added to microtiter plates coated with 4 g/mL of TcdB. Results are representative of two independent experiments.

[0015] FIG. 6 illustrates that DARPin dimers offer superior protection to Vero cells against the toxicity of TcdB from C. difficile strains VPI 10463 (ribotype 087) and M68 (ribotype 017).

[0016] FIG. 7A, FIG. 7B, and FIG. 7C illustrate DARPins dimers offer superior inhibition of TcdB from C. difficile strain VPI 10463 (ribotype 087).

[0017] FIG. 8A and FIG. 8B show that DARPins strongly exhibit the ability to neutralize (A) and bind (B) the different TcdB toxins. FIG. 8C shows TcdB neutralization potency of different DARPins and bezlotoxumab.

[0018] FIG. 9A shows mice that were i.p. injected with TcdB (1.5 g/kg) alone (PBS, n=10), or together with DLD-4 (SEQ ID NO. 37) (0.25 or 2.5 mg/kg, n=10), or bezlotoxumab (10 mg/kg, n=10). Mouse survival rate was monitored, and data were analyzed by Kaplan-Meier survival analysis with Log rank test of significance. P=0.04 (DLD-4 (SEQ ID NO. 37) vs PBS). FIG. 9B shows DLD-4 (SEQ ID NO. 37) (5 mg/mouse) was mixed with TcdB (15 g/mouse) in 100 L PBS and injected immediately into the cecum of mice (n=7). The control group received the same dose of TcdB alone (n=10). Mouse survival was monitored for 3 days and the data were analyzed by Kaplan-Meier survival analysis. P=0.349 (TcdB only vs. TcdB+DLD-4 (SEQ ID NO. 37)).

[0019] FIG. 10A and FIG. 10B show DARPin dimer U3D16 (SEQ ID NO. 49) displaying enhanced neutralization ability against TcdB.sub.VPI (FIG. 10A) and TcdB.sub.M68 (FIG. 10B). FIG. 10C shows that U3 (SEQ ID NO. 13) lacks the ability to bind to TcdB.sub.UK1 as determined by ELISA.

[0020] FIG. 11A and FIG. 11B illustrate that DARPin DLD-4 (SEQ ID NO. 37) blocks the interaction between TcdB and its cellular receptors.

[0021] FIG. 12A and FIG. 12B show DARPin DLD-4 (SEQ ID NO. 37) inhibits TcdB from C. difficile strains VPI 10463 (ribotype 087) in Caco-2 and TZM cells.

[0022] FIG. 13A and FIG. 13B show that DARPin 1.4E T10-2 (SEQ ID NO. 32) and 1.4E C3 (SEQ ID NO. 33) exhibit enhanced stability against proteases.

DETAILED DESCRIPTION

[0023] It is to be understood that the following disclosure provides many different embodiments, or examples, for implementing different features of various embodiments. Specific examples of components and arrangements are described below to simplify the disclosure. These are, of course, merely examples and are not intended to be limiting. The section headings used herein are for organizational purposes and are not to be construed as limiting the subject matter described.

[0024] Clostridium difficile is a gram-positive spore-forming anaerobic bacterium. Colonization of the gut with pathogenic C. difficile can lead to C. difficile infection (CDI) with symptoms including diarrhea, pseudomembranous colitis, sepsis, multiple organ dysfunction syndrome and even death. In 2011 there were almost half a million reported cases of CDI and more than 29,000 CDI-associated deaths in the United States alone. C. difficile is considered a major nosocomial pathogen as a significant percentage (7%) patients acquire CDI after hospitalization. Broad-spectrum antibiotics are considered a major culprit of CDI, as they disrupt the patients' natural gut microflora that would otherwise keep the proliferation of C. difficile in check. The current standard-of-care for treating CDI is the administration of additional antibiotics, mainly vancomycin, metronidazole and fidaxomicin. Although this approach is generally effective against primary CDI, in recent decades, the rate of CDI recurrence has significantly increased due to the emergence of antibiotic-resistant and so-called hypervirulent strains (15-35% CDI recurrence in patients after cessation of antibiotic treatment).

[0025] CDI is the leading cause of hospital-acquired infectious diarrhea, claiming the lives of 30,000 people each year and >$6 billion in treatment-associated costs. The symptoms of CDI range from mild cases of diarrhea to fatal pseudomembranous colitis. Although primary CDI can generally be treated with antibiotics, over the past decades, the rate of CDI recurrence has greatly increased due to the emergence of antibiotic-resistant and so-called hyper-virulent strains many patients (20-25% relapses). C. difficile secreted toxins A (TcdA) and toxin B (TcdB) are the critical virulence factors that cause diseases associated with CDI. The pathology of CDI mainly stems from the two C. difficile secreted exotoxins, toxin A (TcdA) and toxin B (TcdB), that target small GTPases within the host cells, leading to disruption of the tight junctions and loss of colonic epithelial barrier function. The anti-TcdB monoclonal antibody bezlotoxumab (ZINPLAVA) was approved by the FDA in 2016 for treating recurrent CDI. The CDI recurrence rate in patients receiving antibiotics together with i.v. infusion of bezlotoxumab, although lower than those receiving antibiotics alone (26-28%), remains high at 15-17%.

[0026] Recently, ZINPLAVA (bezlotoxumab, an intravenously administered anti-TcdB monoclonal antibody to be used concurrent with antibiotics) was approved by the FDA for treating recurrent CDI. The market value of ZINPLAVA is predicted to reach over US $212 million by 2020. However, even with ZINPLAVA, the rate of recurrence remains high at 15-17%. Thus, more effective therapy against CDI is still urgently needed.

[0027] Embodiments of the claimed invention are directed to the engineering of a panel of DARPins as potent anti-toxins against TcdB. DARPin is a small non-antibody binding scaffold protein that exhibits very high thermostability, resistance to proteases and denaturants, and very low immunogenicity. Unlike antibody that needs to be expressed in mammalian cells and is expensive to produce, DARPins can be expressed at very high levels in E. coli (multi-gram quantities per liter of culture in fermenters), enabling DARPins to be produced at low cost on a large scale. Using phage panning combined with high-throughput in vitro functional screening, several DARPins with picomolar neutralization potency against TcdB were engineered. One of the identified DARPins in accordance with embodiments of the disclosure, DLD-4 (SEQ ID NO. 37), inhibited TcdB with EC.sub.50 of 4 pM in vitro, which is >300-fold more potent than ZINPLAVA.

[0028] The anti-toxin DARPins of the claimed invention can potentially replace ZINPLAVA for the treatment of CDI. Since DARPins can be made at a fraction of the cost of ZINPLAVA (due to the different expression platform), antitoxin DARPins will have a significant price advantage over ZINPLAVA (currently at US $3,000/dose). Additionally, due to the high stability and ease of production, anti-toxin DARPins can potentially be formulated as oral therapeutics to directly neutralize the toxin in the gut. Since C. difficile and its secreted toxins reside in the gastrointestinal (GI) tract, a location not easily accessible by i.v. administered antibody, it is believed that an oral toxin-neutralizer should be more effective at preventing CDI pathogenesis.

[0029] As such, a goal of the present disclosure is to develop highly efficacious anti-toxin proteins as oral therapeutics that can directly neutralize the toxins in the gut for treating and/or preventing the recurrent of CDI. These anti-toxin proteins are based on a designed ankyrin repeat protein (DARPin), a small antibody-mimic binding scaffold that exhibits very high thermostability, resistance to proteases and denaturants, and a very low immunogenicity. DARPins that bind a wide range of molecules with pico- to nano-molar affinity have been identified. Furthermore, DARPins can be expressed at high levels in E. coli (multi-gram quantities per liter of culture in fermenters), enabling DARPins to be produced at potentially very low cost on a large scale.

[0030] Combining phage panning and functional screening, a panel of dimeric DARPins with picomolar in vitro TcdB neutralization potency were identified. An identified DARPin in accordance with an embodiment of the claimed invention, DLD-4 (SEQ ID NO. 37), exhibited an EC.sub.50 of 4 pM and 20 pM against TcdB from C. difficile strains VPI10463 (ribotype 087) and M68 (ribotype 120), respectively, which is 330-fold and 33-fold more potent than the FDA-approved anti-TcdB monoclonal antibody bezlotoxumab. DARPin DLD-4 (SEQ ID NO. 37) was also efficacious in vivo in two mouse models against TcdB challenge, pointing to its potential as a next-generation anti-toxin biologic for treating CDI and/or preventing its recurrence.

[0031] In view of the aforementioned, an aspect of the present disclosure relates generally to the treatment and prevention of C. difficile infections. In some embodiments, the toxin-neutralizing DARPins disclosed herein are easy to express and relatively resistance to environmental stress thus potentially delivered to intestines to block toxins' actions. In some embodiments, anti-toxin DARPin can be used in different types of products, such as, for example, anti-toxin DARPin solution to be administered intravenously, similar to that of ZINPLAVA, anti-toxin DARPin to be formulated in capsule or pills and be administered orally to directly neutralize the toxins in the GI tract, anti-toxin DARPins to be secreted by engineered commensal bacteria (e.g. Lactococcus lactis, Lactobacillus) or commensal yeast (e.g. Saccharomyces boulardii) to provide in situ delivery of toxin neutralizer in the gut, or combination thereof.

[0032] Additional embodiment of the present disclosure pertain to methods of treating or preventing C. difficile infections. In some embodiments, the method includes administering an anti-toxin to a subject in need thereof, where the anti-toxin includes a DARPin. In some embodiments, the DARPin neutralizes a C. difficile secreted exotoxins. In some embodiments, the C. difficile secreted exotoxin is TcdB. In some embodiments, the anti-toxin includes compositions comprising at least one of U3 (SEQ ID NO. 13), D2 (SEQ ID NO. 27), D3 (SEQ ID NO. 16), D8 (SEQ ID NO. 24), D16 (SEQ ID NO. 23), and combinations thereof. In some embodiments, the anti-toxin includes U3 (SEQ ID NO. 13) and D16 (SEQ ID NO. 23). In some embodiments, the anti-toxin neutralizes TcdB by blocking its interaction with the receptor chondroitin sulfate proteoglycan 4 (CSPG4). In some embodiments, the anti-toxin is adapted to be administered intravenously. In some embodiments, the anti-toxin is adapted to be administered orally. In some embodiments, the anti-toxin is adapted to be administered in situ. In some embodiments, the anti-toxin is a dimeric DARPin U3D16 (SEQ ID NO. 49) which pairs DARPin D16 (SEQ ID NO. 23) with DARPin U3 (SEQ ID NO. 13). In some embodiments, the dimeric DARPin U3D16 (SEQ ID NO. 49) disrupts interaction of TcdB with Frizzled 1/2/7 receptor.

[0033] In a further embodiment, the present disclosure pertains to compositions having an anti-toxin for treating or preventing C. difficile infections, where the anti-toxin includes a DARPin. In some embodiments, the DARPin neutralizes a C. difficile secreted exotoxins. In some embodiments, the C. difficile secreted exotoxin is TcdB. In some embodiments, the anti-toxin includes at least one of U3 (SEQ ID NO. 13), D2 (SEQ ID NO. 27), D3 (SEQ ID NO. 16), D8 (SEQ ID NO. 24), D16 (SEQ ID NO. 23), and combinations thereof. In some embodiments, the anti-toxin includes U3 (SEQ ID NO. 13) and D16 (SEQ ID NO. 23). In some embodiments, the anti-toxin neutralizes TcdB by blocking its interaction with the receptor CSPG4. In some embodiments, the anti-toxin is adapted to be administered intravenously. In some embodiments, the anti-toxin is adapted to be administered orally. In some embodiments, the anti-toxin is adapted to be administered in situ. In some embodiments, the anti-toxin is a dimeric DARPin U3D16 (SEQ ID NO. 49) which pairs DARPin D16 (SEQ ID NO. 23) with DARPin U3 (SEQ ID NO. 13). In some embodiments, the dimeric DARPin U3D16 (SEQ ID NO. 49) disrupts interaction of TcdB with Frizzled 1/2/7 receptor. In some embodiments, the anti-toxin is a DARPin monomer. In some embodiments, the anti-toxin is a DARPin dimer.

[0034] In some embodiments, the engineering of these ultra-potent TcdB-neutralizing DARPins involves three sequential steps: i) phage-panning of a DARPin library against purified TcdB; ii) functional screening for DARPins with TcdB-neutralization activity; iii) functional screening of dimeric DARPins with enhanced TcdB-neutralization activity. In some embodiments, anti-TcdB DARPin is produced from E. coli using standard molecular biology techniques. In some embodiments, large-scale protein expression can be done in a fermenter. In some embodiments, disclosed herein, are ways to improve stability against protease digestion and expand neutralization spectrum against TcdB from different strains of C. difficile.

WORKING EXAMPLES

[0035] Reference will now be made to more specific embodiments of the present disclosure and data that provides support for such embodiments. However, it should be noted that the disclosure below is for illustrative purposes only and is not intended to limit the scope of the claimed subject matter in any way.

[0036] The present disclosure aims to engineer a highly efficacious microbial-expression compatible antibody surrogate protein, a designed ankyrin repeat protein (DARPin), to neutralize C. difficile toxin TcdB. DARPins represent a versatile class of binding proteins that have been engineered to bind diverse targets with up to picomolar affinity. Furthermore, DARPins are also amenable to high-yield production in microbial expression hosts. Given these attractive properties of DARPins, the present disclosure seeks to create DARPin-based oral therapeutics against CDI infection.

[0037] The engineering of a panel of DARPins with superior in vitro toxin neutralization potency against C. difficile toxin TcdB than the FDA-approved anti-TcdB monoclonal antibody bezlotoxumab is disclosed herein. These highly potent DARPin-based anti-toxins possess the potential to be developed into therapeutics to treat CDI and/or prevent its recurrence. The present disclosure envisions making the molecules from this disclosure amenable to oral administration.

TcdB Expression and Purification

[0038] Plasmid DNA encoding a 6-His tagged-TcdB was transformed into Bacillus megaterium cells and the recombinant TcdB was purified via Ni-NitriloTriacetic Acid (NTA) affinity column. The column was washed with high-salt PBS (20 mM NaH.sub.2PO.sub.4, 20 mM Na.sub.2HPO.sub.4, 300 mM NaCl, pH 7.4) containing 25 mM imidazole and the bound protein was eluted using high-salt phosphate-buffered saline (PBS) containing 250 mM imidazole. Eluted protein was diluted in low-salt PBS (20 mM NaH.sub.2PO.sub.4, 20 mM Na.sub.2HPO.sub.4, 10 mM NaCl, pH 7.4) to obtain a final NaCl concentration of 30 mM and the mixture was loaded onto a Q HP anion exchange column (GE Healthcare). The column was washed with the same low-salt PBS buffer and bound protein was eluted using a salt gradient from 10 mM to 1 M NaCl. TcdB eluted at NaCl concentrations of 500 mM. Protein purity was confirmed using sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE).

DARPin Library Creation and Phage Panning

[0039] FIG. 1A and FIG. 1B illustrate designed ankyrin repeat protein (DARPin) sequences in schematic form. In each DARPin construct there is an N-terminal hexa-His tag followed by a myc tag, shown in FIG. 1A. In the dimeric construct, DARPins are separated by a (GGGGS)3 (SEQ ID NO. 48) linker sequence, shown in FIG. 1B. FIG. 1C shows a schematic of a DARPin in accordance with an embodiment of the invention. DARPins are composed of repeat modules of natural ankyrin protein and comprise an N-terminal capping repeat (N-cap), three internal, contiguously arranged ankyrin repeats (ARs) and a C-terminal capping repeat (C-cap) as schematically depicted in FIG. 1C. In a DARPin library, each internal repeat contains six randomized positions, yielding a total of 18 randomized positions in each DARPin. Such a DARPin library was prepared using sequential ligation and polymerase chain reaction (PCR). This DARPin library was positioned downstream of a DsbAss cotranslational translocation signal peptide and fused to the N-terminus of the bacteriophage M13 gIII minor coat protein. A DARPin library consisting of 210.sup.9 unique clones was created by transforming 12 mL high-efficiency MC1061 electro-competent cells with 250 g of ligated and purified DNA.

[0040] Phage panning was carried out as follows. TcdB (from C. difficile VPI10463) was biotinylated via EZ-Link-Sulfo NHS-LC Biotin (Pierce) and used as the target protein. Four rounds of sequential phage panning were performed. The enrichment of TcdB-binding DARPin was confirmed by phage ELISA following a published protocol. A plateau in the level of TcdB binding was observed after round 3 of panning, indicative of successful phage panning.

[0041] Combining phage panning and functional screening, 12 DARPins that protected Vero cells against the TedB-induced cytopathic effect at nanomolar concentrations were identified. A secondary functional screening of dimeric DARPins yielded 10 dimers with >100-fold improved toxin neutralization potency relative to the constituent monomers. FIG. 4 illustrates DARPin dimers exhibit superior toxin-neutralization potency relative to the constituent monomers. IMAC-purified DARPin dimers or monomers were added to Vero cells (1.510.sup.3 cells/well) together with TcdB toxin (5 pg/mL). Cell viability was quantified 72 hours later by CellTiterGlo assay and normalized to nave Vero cells. Error bars represent the standard deviation of at least two independent experiments performed in duplicate. The best dimer DARPin, DLD-4 (SEQ ID NO. 37) (including U3 (SEQ ID NO. 13) and 1.4E (SEQ ID NO. 02), neutralized TcdB from VPI 10463 (ribotype 087) and M68 (ribotype 017) with EC.sub.50 values of 4 and 16 pM respectively, representing a 330-fold and 33-fold higher potency than the FDA-approved bezlotoxumab in the same assay (FIG. 6). DLD-4 (SEQ ID NO. 37) effectively protected mice from a lethal i.p. TcdB toxin challenge (FIG. 9A). However, due to the surprisingly poor resistance of DLD-4 (SEQ ID NO. 37) against digestion by trypsin and chymotrypsin, no significant protection was observed in the mouse toxin cecum injection model (FIG. 9B). As such, the present disclosure envisions improving the protease stability of DLD-4 (SEQ ID NO. 37).

Functional Screening of TedB-Neutralizing DARPins

[0042] Pooled DARPin variants from the 3rd round of phage panning were subcloned into the pET26b vector (between NdeI and HindIII) for high-level DARPin expression (FIG. 1A). 764 individual_clones of E. coli BL21 (DE3) cells transformed with the enriched library were picked and grown in eight 96-deep well plates (1 mL/well) at 37 C. for 8-10 h. Fifty L of the overnight culture were transferred to fresh plates containing 1 mL/well LB and grown to mid-log phase (OD.sub.6000.6) (3 hours) prior to the addition of isopropyl -d-1-thiogalactopyranoside (IPTG). The culture was shaken at 400 rpm and at 37 C. for 4 hours and was harvested by centrifugation at 1700g for 20 minutes. The cell pellets were resuspended in 100 L of PBS (1.8 mM KH.sub.2PO.sub.4, 10 mM Na.sub.2HPO.sub.4, 137 mM NaCl, 2.7 mM KCl, pH 7.4) supplemented with lysozyme (200 g/mL), incubated at 37 C. for 30 minutes, subjected to 3 cycles of freeze-thaw between 80 C. and 37 C., and centrifuged at 16,000g for 10 minutes. The soluble fraction was transferred to fresh 96-well deep plates and incubated at 70 C. for 20 minutes and centrifuged again, yielding highly enriched DARPin in the supernatant. The supernatant was transferred to fresh plates and stored at 80 C. until use.

[0043] The semi-purified DARPin (0.1-10 L lysate) was incubated with purified TcdB in growth medium (Dulbecco's Modified Eagle Medium (DMEM) supplemented with 10% fetal bovine serum (FBS), non-essential amino acids, penicillin (100 mg/mL) and 100 mM streptomycin) in 96-well plates for 2 hours at room temperature and then added to Vero cells seeded the night before in growth medium (final TcdB concentration 132 pg/mL). The concentration of TcdB was selected such that the viability of toxin-treated Vero cells was 10-20% that of nave Vero cells after 6 hours of toxin contact time. Cell supernatants were replaced with fresh growth medium six hours later, and the cell viability was quantified 72 hours post toxin addition using CellTiterGlo reagent (Promega) and normalized to Vero cells treated with the equivalent amount of lysate from untransformed BL21 (DE3) cells in the absence of TcdB.

[0044] To create a dimeric DARPin library, monomeric DARPin variants identified from the functional library screening were PCR-amplified using Taq DNA polymerase (NEB) with two sets of primers. Set 1 used primers Ran2-D-F (SEQ ID NO. 44) and Linker-BSAi-D-R (SEQ ID NO. 47) (Table 1) to generate DARPins with a 3 linker sequence ((GGGGS)3) (SEQ ID NO. 48), and Set 2 used primers Linker-BSAi-D-F (SEQ ID NO. 46) and Ran2-D-R (SEQ ID NO. 45) to generate DARPins with a 5 linker sequence. PCR products were digested with BsaI to generate sticky ends in the added linker region and ligated to form dimeric DARPins. This library was then inserted into the pET28a vector for expression in E. coli.

[0045] Table 1, shown below, illustrates primer sequences. Primers used to construct DARPin dimer library. Nucleotides binding to individual DARPins are indicated in lowercase. Primer Ran2-D-F (SEQ ID NO. 44) bound to the 5 end of each DARPin. Primer Ran2-D-R (SEQ ID NO. 45) binds to the 3 end of each DARPin. Primer Linker-BSAi-D-F (SEQ ID NO. 46) binds to the 5 end of each DARPin, adding a linker sequence and the BsaI restriction site to that end. Primer Linker-BSAi-D-R (SEQ ID NO. 47) binds to the 3 end of each DARPin, adding a linker sequence and the BsaI restriction site to that end. As such, primer Ran2-D-F (SEQ ID NO. 46) and a linker containing a Bsa I site were used to amplify a single DARPin, adding the linker and the BsaI site to the 3 end. Similarly, primer Ran2-D-R (SEQ ID NO. 45) and a linker containing a Bsa I site were used to amplify a single DARPin, adding the linker and the BsaI site to the 5 end.

TABLE-US-00001 TABLE1 PrimerName Sequence Ran2-D-F CATGTGCATTatctgggatccgacctgg (SEQIDNO.44) Ran2-D-R TAACAGGCCGCAAGCTTTTACGA (SEQIDNO.45) Linker-BSAi-D-F ttagctggtctct (SEQIDNO.46) ggagggagcggaggcggagggagcgctagc GACCTGGGTAAGAAACTGCTG Linker-BSAi-D-R GAAATCCTGCAATCGAGCTCG (SEQIDNO.47) gaattcggaggcggagggagcggaggc ggagtgagaccttagct

[0046] For the dimeric DARPin functional screen, the protocol was further simplified. 1504 individual clones of E. coli BL21 (DE3) cells transformed with the dimeric DARPin library were picked and grown in 16 deep 96-well plates (1 mL/well) at 37 C. and 400 rpm in LB overnight. The next day, the cultures were harvested by centrifugation at 1700g for 20 minutes. Each of the cell pellets was resuspended in 200 L PBS supplemented with lysozyme (200 g/mL) and incubated at 37 C. for 30 minutes. Next, the plates were subjected to 1 cycle of freeze-thaw between 80 C. and 37 C., and incubated at 70 C. for 20 minutes. The lysate was diluted in PBS and an equivalent of 0.2 L of the undiluted lysate was added to Vero cells together with TcdB toxin (10 pg/mL) in a final volume of 100 L. 72 hours later, the cell viability was quantified by CellTiterGlo assay and normalized to that of nave Vero cells.

Protein Expression and Purification

[0047] E. coli BL21 (DE3) cells transformed with DARPin expression plasmid (in pET26b) were cultured overnight at 37 C. in auto-induction media (6 g/L Na.sub.2HPO.sub.4, 3 g/L KH.sub.2PO.sub.4, 20 g/L tryptone, 5 g/L yeast extract, 5 g/L NaCl, 0.6% glycerol, 0.1% glucose, 0.08% lactose) supplemented with 50 g/mL kanamycin. Cells were lysed by sonication. The lysate was clarified by centrifugation at 16,000g for 10 minutes, and the soluble lysate was filtered through a 0.45 m PES membrane and loaded onto a gravity Ni-NTA agarose column. The column was washed with PBS containing 15 mM imidazole and the bound proteins were eluted using PBS containing 150 mM imidazole. Protein purity was determined using SDS-PAGE.

[0048] DNA encoding bezlotoxumab VH and VL were synthesized and constructs encoded bezlotoxumab IgG1 light and heavy chains were transfected to CHO cells. The bezlotoxumab was purified from CHO supernatants using protein-A beads following a standard protocol.

In Vitro TcdB Neutralization Assay

[0049] Vero cells (1.5 or 2103 cells/well) in growth medium were seeded in 96-well plates. The next day, serial dilutions of IMAC-purified DARPins were added to the appropriate wells followed by the addition of TcdB (final concentration 5 pg/mL or 2.5 pg/mL). The concentration of TcdB was selected such that the viability of the toxin-treated cells was 10-20% that of nave Vero cells following 72 hours of toxin contact time. The plates were incubated at 37 C./5% CO2 for 72 hours. The cell viability was quantified using the CellTiter-Glo kit (Promega) following the manufacturer's instructions, or by quantifying the number of rounded cells. To quantify cell rounding, phase-contrast images were taken with an Olympus microscope. The numbers of normal and rounded cells in each image were determined by counting manually.

In Vivo TcdB Neutralization Activity of DARPins

[0050] Six to eight-week-old CD1 mice were purchased from Harlan Laboratories (MD, USA). All mice were housed in dedicated pathogen-free facilities in groups of 5 mice per cage under the same conditions. Food, water, bedding, and cages were autoclaved. All procedures involving mice were conducted under protocols approved by the Institutional Animal Care and Use Committees at the University of Maryland (IACUC #0517002). Mice judged to be in a moribund state were euthanized via carbon dioxide asphyxiation. DLD-4 (SEQ ID NO. 37) (2.5 mg/kg or 0.25 mg/kg), or bezlotoxumab (10 mg/kg) was mixed with TcdB (1.5 g/kg) in PBS and incubated at room temperature for 1 h before being injected intraperitoneally (i.p.) into mice in the appropriate treatment groups. The control group was i.p. injected with TcdB alone in PBS. Mouse survival was monitored for 4 days until the termination of the experiments and data were analyzed by Kaplan-Meier survival analysis with Log rank test of significance. The cecum injection experiment was carried. Mice were anesthetized with intramuscular injection of a mixture of ketamin (100 mg/kg) and xylazine (10 mg/kg). The cecum, ileum and colon were exposed upon a midline laparotomy. IMAC-purified TcdB.sub.VPI (15 g/mouse) or a mixture of TcdB.sub.VPI and DLD-4 (SEQ ID NO. 37) (5 mg/mouse) in PBS (100 L) were injected directly into the cecum of mice via insulin syringes (29G) inserted into the ileocecal junction. The gut was returned to the abdomen after injection and the incision was closed with silk sutures. Mice were allowed to recover, and mouse survival were closely monitored for 72 hours.

Selection of Monomeric TcdB-Neutralizing DARPins

[0051] A library of approximately 210.sup.9 DARPin variants was constructed via sequential PCR and ligation. Biotinylated TcdB (from C. difficile strain VPI10463) was used as the target protein to enrich DARPins that could bind the toxin via four rounds of phage panning. The enrich DARPin library pool from the 3rd round of phage panning were subcloned into the pET26b vector and transformed into E. coli BL21 (DE3) cells for high-level DARPin expression and functional screening for those with toxin-neutralization ability. About 40% of the clones (299 clones) were able to rescue Vero cells viability from TcdB toxicity by >50%. The top 40 hits were sequenced and of which 12 were determined to be unique clones (FIG. 2, Table 2). FIG. 2A, FIG. 2B, and FIG. 2C illustrate characterization of monomeric DARPin. (A) Monomeric DARPins are able to protect Vero cells from TcdB-induced cytopathic effect at nanomolar concentrations. IMAC-purified DARPins were added to Vero cells (210.sup.3 cells/well) together with TcdB toxin (5 pg/mL). Cell viability was quantified 72 hours later by the CellTiterGlo assay and normalized to nave Vero cells. Error bars represent the standard deviation of at least 2 independent experiments performed in duplicate. (B) Relative binding of DARPins to TcdB was determined using ELISA. Serially diluted DARPins were added to microtiter plates coated with 4 g/mL of TcdB. Results are representative of 2 independent experiments. (C) DARPin monomer TcdB-neutralization potency. Data are the averages of at least 2 independent experiments. DARPin, designed ankyrin repeat protein; EC.sub.50, half maximal effective concentration; ELISA, enzyme-linked immunosorbent assay; IMAC, Immobilized metal affinity chromatography; TcdB, C. difficile toxin B.

[0052] Most clones exhibited EC.sub.50 values of 10 nM, and the 2 best clones, 1.2E (SEQ ID NO. 01) and 1.4E (SEQ ID NO. 02), displayed EC.sub.50 values of 2.4 nM and 3 nM, respectively. The relative affinity of each of the top 9 DARPins for TcdB was assessed by ELISA (FIG. 4B) and was found to not directly correlate with their in vitro neutralization potency. For example, although 1.2E (SEQ ID NO. 01) and 1.4E (SEQ ID NO. 02) neutralized TcdB with similar potency, 1.4E (SEQ ID NO. 02) appeared to be among the strongest toxin binders while 1.2E (SEQ ID NO. 01) was one of the weaker binders. The discrepancy between binding affinity and neutralization potency likely stems from the different epitopes engaged by the different DARPins. That is, a DARPin that weakly binds a region critical for toxin activity might exhibit a higher toxin-neutralization potency than another DARPin that binds strongly to a region of less importance.

Selection of Dimeric TcdB-Neutralizing DARPins

[0053] Fusion of multiple DARPins significantly enhances the target-binding affinity via avidity effects. It was hypothesized that fusion of two DARPins that bind non-overlapping epitopes on the toxin should yield enhanced binding affinity and thus a higher toxin-neutralization potency. A combinatorial library of DARPin dimers was created by joining individual monomeric DARPins (12 total) via a flexible linker (GGGGS3) (SEQ ID NO. 48). A total of 1504 individual clones were screened using a Vero cell toxin challenge assay and 12 hits were identified. Of which, 10 were determined to be unique clones. The in vitro neutralization potencies of these 10 DARPins and their relative TcdB binding affinities are shown in FIG. 3. FIG. 3A, FIG. 3B, and FIG. 3C illustrate characterization of dimeric DARPins. FIG. 3A shows dimeric DARPins protect Vero cells from the TedB-induced cytopathic effect at picomolar concentrations. IMAC-purified DARPin dimers were added to Vero cells (1.510.sup.3 cells/well) together with TcdB toxin (5 pg/mL). Cell viability was quantified 72 hours later by the CellTiterGlo assay and normalized to nave Vero cells. Error bars represent the standard deviation of two independent experiments performed in duplicate. FIG. 3B shows relative binding of DARPins dimers to TcdB was determined using enzyme-linked immunosorbent assay (ELISA). Serially diluted DARPins were added to microtiter plates coated with 4 g/mL of TcdB. Results are representative of two independent experiments and the error bars represent mean deviation from duplicate samples. FIG. 3C shows TcdB neutralization potency of DARPin dimers. Data are the averages of at least two independent experiments. The best DARPin dimer, DLD-4 (SEQ ID NO. 37), exhibited a toxin-neutralization EC.sub.50 of 4+1 M, which is 600-fold lower than the best monomeric DARPin, 1.2E (SEQ ID NO. 01) (EC.sub.50 2.4+0.5 nM). As seen with the DARPin monomers, the relative TcdB binding affinities of the DARPin dimers were found to not directly correlate with their neutralization potency. Sequencing results also revealed that many of the dimers contained a new DARPin, U3 (SEQ ID NO. 13) or U5 (SEQ ID NO. 14), that was not present amongst the original 12 monomers (FIG. 3C, Table 2). U5 (SEQ ID NO. 14) is identical to U3 (SEQ ID NO. 13) except that it lacks the third randomized ankyrin repeat domain. U3 (SEQ ID NO. 13) alone exhibits weak, but detectable, toxin-neutralization activity (EC.sub.50>25 nM, FIG. 4) in Vero cells and toxin-binding ability (FIG. 5). FIG. 5 illustrates DARPins dimers demonstrate avidity in TcdB binding. Binding of selected DARPin monomers, pooled monomers or dimers to TcdB was determined using ELISA. Combinations of serially diluted DARPins were added to microtiter plates coated with 4 g/mL of TcdB. Results are representative of two independent experiments. U3 (SEQ ID NO. 13) and U5 (SEQ ID NO. 14) likely represent a minor constituent of the initial pool used to create the dimer DARPin library and their discovery is highly serendipitous because 1) they bind to a neutralizing epitope and 2) the U3/U5 (SEQ ID NO. 13)/(SEQ ID NO. 14) neutralization epitope is adjacent to the epitope targeted by the other DARPin hits such that the linker used is of sufficient length to accommodate simultaneous binding to both epitopes.

[0054] To understand the reason for the dramatic improvement in activity, the five dimer DARPins with the strongest toxin neutralization potency were further characterized. The in vitro TcdB-neutralization potency of the DARPin dimers were first compared with their constituent monomers (FIG. 4). All these DARPin dimers significantly out-performed their individual constituent monomers as well as the combination of both monomers, indicative of synergistic activity. The relative binding affinity of DARPin dimers and monomers were further compared using ELISA. As shown in FIG. 5, except for DLD-6 (SEQ ID NO. 39), all the dimeric DARPins yielded an increase in the ELISA signal relative to the constitute monomers. This observation is consistent with the binding of non-overlapping epitopes on the toxin by the monomeric DARPins via an avidity effect. An exception is DLD-6 (SEQ ID NO. 39), which appeared to bind the toxin more weakly than its constituent DARPin 3.5B (SEQ ID NO. 10) at concentrations <25 nM. This result is somewhat unexpected, considering that the toxin-neutralization potency of DLD-6 (SEQ ID NO. 39) is >100 fold higher than that of 3.5B (SEQ ID NO. 10) (EC.sub.50: 12.5 pM for DLD-6 (SEQ ID NO. 39) vs. 13.3 nM for 3.5B (SEQ ID NO. 10)). A sandwich ELISA assay confirmed that DLD-6 (SEQ ID NO. 39) lacks the ability to crosslink two different TcdB molecules, which would have been responsible for the difference between neutralization potency and binding result. Without being bound by theory, it is posited that the most possible cause of this discrepancy is that TcdB protein may exhibit less flexibility when immobilized on an ELISA plate, thus hindering the simultaneous interaction with both U3 (SEQ ID NO. 13) and 3.5B (SEQ ID NO. 10).

Characterization of TcdB Neutralization Potency of DARPins

[0055] Protein engineering work was conducted using TcdB from the laboratory strain of C. difficile VPI10463 (ribotype 087). Since there is a significant amount of amino acid sequence heterogeneity between different strains of C. difficile there is a need to develop broadly neutralizing DARPins. As a first step to address this need, the activity of selected DARPin dimers (DLD-4 (SEQ ID NO. 37), DLD-7 (SEQ ID NO. 40), DLD-11 (SEQ ID NO. 42), DLD-12 (SEQ ID NO. 43)) against TcdB from three different strains of C. difficile: VPI10463, M68 (ribotype 012) and UK1 (ribotype 027) was evaluated. All DARPins were effective against toxins from VPI10463 and M68 (FIG. 6). FIG. 6A and FIG. 6B illustrate DARPin dimers offer superior protection to Vero cells against the toxicity of TcdB from C. difficile strains VPI 10463 (ribotype 087) and M68 (ribotype 017). FIG. 6A shows IMAC-purified DARPins were added to Vero cells (1.510.sup.3 cells/well) together with TcdB toxin (2.5 pg/mL). Cell viability was quantified 72 hours later by the CellTiterGlo assay and normalized to nave Vero cells. Error bars represent the standard deviation of at least two independent experiments done in duplicate. Bezlotoxumab is the FDA-approved monoclonal antibody for treating recurrent C. difficile infection. a-GFP is a GFP-binding DARPin and was used here as a negative control. FIG. 6B shows DARPin dimer TcdB neutralization potency. Data are the averages of at least two independent experiments. The best DARPin, DLD-4 (SEQ ID NO. 37), was found to be 330- and 33-fold more efficacious than bezlotoxumab at inhibiting TcdB from VPI 10463 and M68, respectively, as quantified using the CellTiter-Glo assay (FIG. 6B). The EC.sub.50s of DLD-4 (SEQ ID NO. 37) and bezlotoxumab were further measured using the conventional cell rounding assay, and were found to be similar to that determined using CTG assay (FIG. 7). FIG. 7A, FIG. 7B, and FIG. 7C illustrate DARPins dimers offer superior inhibition of TcdB from C. difficile strain VPI 10463 (ribotype 087). IMAC-purified DARPin dimer DLD-4 (SEQ ID NO. 37) or bezlotoxumab at were added to (1.5103 cells/well) Vero cells (1.5103 cells/well) together with TcdB (5 pg/mL). Cell viability was quantified 72 hours later using a cell rounding assay (FIG. 7A) or the CellTiterGlo assay (FIG. 7B) and normalized to nave Vero cells. FIG. 7C shows TcdB neutralization potency. Error bars represent the standard deviation of duplicate wells. Data presented is representative of two independent experiments.

[0056] FIG. 8A and FIG. 8B illustrate in vivo studies. FIG. 8 (A and B) DARPins strongly exhibited the ability to neutralize (A) and bind (B) the different TcdB toxins. conc., concentration. (C) TcdB neutralization potency of different DARPins and bezlotoxumab. For neutralization assays, serially diluted immobilized-metal affinity chromatography (IMAC)-purified DARPins were mixed with the appropriate toxin and then added to Vero cells seeded the night before in 96-well plates. The cell viability was quantified by the CellTiterGlo assay 72 h later and normalized to naive Vero cells. For ELISAs, the MaxiSorp plates were coated with the appropriate toxin followed by treatment with serially diluted DARPins. The amounts of plate-bound DARPins (containing Myc tags) were quantified using an anti-c-Myc antibody. Data in panel A represent averages of results from at least 2 independent experiments. Data presented in panel B are representative of results from two independent experiments performed in duplicate. FIG. 8A shows mice were i.p. injected with TcdB (1.5 g/kg) alone (phosphate-buffered saline (PBS), n=10), or together with DLD-4 (SEQ ID NO. 37) (0.25 or 2.5 mg/kg, n=10), or bezlotoxumab (10 mg/kg, n=10). Mouse survival rate was monitored, and data were analyzed by Kaplan-Meier survival analysis with Log rank test of significance. P=0.04 (DLD-4 (SEQ ID NO. 37) vs PBS). FIG. 8B shows DLD-4 (SEQ ID NO. 37) (5 mg/mouse) was mixed with TcdB (15 g/mouse) in 100 L PBS and injected immediately into the cecum of mice (n=7). The control group received the same dose of TcdB alone (n=10). Mouse survival was monitored for 3 days and the data were analyzed by Kaplan-Meier survival analysis. P=0.349 (TcdB only vs. TcdB+DLD-4 (SEQ ID NO. 37)).

[0057] However, these DARPins showed negligible activity against TcdB from the UK1 strain, which belongs to the hypervirulent 027 ribotype. Bezlotoxumab also showed significantly weaker, albeit detectable, neutralization activity against this toxin (EC.sub.50>25 nM). All the other DARPins were tested and it was found that five of them (i.e. 3.9G (SEQ ID NO. 12), 1.2E (SEQ ID NO. 01), 8.1B (SEQ ID NO. 11), 1.8H (SEQ ID NO. 03) and 1.4E (SEQ ID NO. 02)) showed weak but detectable neutralization against TcdB.sub.UK1.

[0058] The ability of the most potent anti-toxin DARPin, DLD-4 (SEQ ID NO. 37), to protect mice from systemic toxin challenge in vivo using two murine TcdB challenge models was further evaluated. In the first model, a lethal dose of TcdB (1.5 g/kg) was mixed with DLD-4 (SEQ ID NO. 37) (0.25 or 2.5 mg/kg), bezlotoxumab (10 mg/kg) or PBS and then injected intraperitoneally (i.p.) into CD1 mice (5-10 mice/group). 40% of the mice survived after injection with the mixture containing the toxin mixed with 2.5 mg/kg DLD-4 (SEQ ID NO. 37) (p=0.04) (FIG. 9A). These results suggest that DLD-4 (SEQ ID NO. 37) possesses significant toxin-neutralization ability in vivo. Bezlotoxumab at 10 mg/kg dose did not show any protection against TcdB in this experiment nor in experiments where lower dosages of TcdB were used. This result is not particularly surprising considering that, in the phase III clinical trial, bezlotoxumab did not increase the initial clinical cure rate of CDI and was only approved by the FDA for reducing the recurrence of CDI, not as a treatment. The spore challenge model was not attempted because it was desired to de-couple in vivo anti-toxin activity from half-life and, unlike antibodies, unmodified DARPins suffer from a very short circulation half-life in vivo due to their small size.

[0059] The second model is the murine cecum injection model. A minor survival advantage (not statistically significant) was observed for mice receiving TcdB and DLD-4 (SEQ ID NO. 37) compared to TcdB alone (FIG. 9B). Further studies revealed that the less-than-expected in vivo efficacy of DLD-4 (SEQ ID NO. 37) in this cecum injection model was most likely due to its poor protease stability. Specifically, DARPin DLD-4 (SEQ ID NO. 37) is sensitive to digestion by trypsin and chymotrypsin, the most abundant protease in the gastrointestinal tract.

Dimeric DARPins with Enhanced Potency Against TedB.SUB.VPI .and TcdB.SUB.M68

[0060] Fusion of multiple binders to non-overlapping epitopes has been reported to significantly enhance the overall target-binding affinity via the avidity effect. DARPin U3 (SEQ ID NO. 13) which interferes with the interaction between TcdB and its receptor FZD1/2/7 was identified. Dimer DARPinDLD-4 (SEQ ID NO. 37)containing U3 (SEQ ID NO. 13) and 1.4E (SEQ ID NO. 02) joined by a 3GGGGS (SEQ ID NO. 48) linker exhibited >100-fold higher neutralization potency against TcdB.sub.VPI than either constituent monomer. Since both D16 (SEQ ID NO. 23) and 1.4E (SEQ ID NO. 02) interfere TcdB-CSPG4 interaction, it was reasoned that a dimeric DARPin having U3 (SEQ ID NO. 13) and D16 (SEQ ID NO. 23) joined by the same linker should exhibit stronger toxin-neutralization potency than D16 (SEQ ID NO. 23) alone. Indeed, the dimeric DARPin U3D16 (SEQ ID NO. 49) showed 10-20-fold higher activity toward TcdB.sub.VPI and TcdB.sub.M68 than D16 (SEQ ID NO. 21) alone (FIG. 10A and FIG. 10B). In addition, subsequent ELISA studies confirmed that U3 (SEQ ID NO. 13) lacks the ability to bind TcdB.sub.UK1 (FIG. 10C). FIG. 10A and FIG. 10B show DARPin dimer U3D16 (SEQ ID NO. 49) showed enhanced neutralization ability against TcdB.sub.VPI (FIG. 10A) and TcdB.sub.M68 (FIG. 10B). The error bars represent mean deviation from 2 independent experiments. The data is representative of two independent experiments performed in duplicate. FIG. 10C shows U3 (SEQ ID NO. 13) lacks the ability to bind to TcdB.sub.UK1 as determined by ELISA. The ELISA plates were coated with TcdB.sub.UK1 or TcdB.sub.VPI and blocked with bovine serum albumin (BSA). The data is representative of two independent experiments performed in duplicate.

DARPin Interactions

[0061] DARPin DLD-4 (SEQ ID NO. 37) blocks the interaction between TcdB and its cellular receptors (FIG. 11). ELISA plates were coated with TcdB.sub.VPI followed by treatment with the 1 nM of the extracellular domains of Chondroitin Sulfate Proteoglycan 4 (CSPG4) (FIG. 10A), or Frizzled Class Receptor 2 (FZD2) (FIG. 11B) alone or in mixture with 250 nM of the indicated DARPins. The amount of TcdB-bound CSPG4 and FZD2 was detected using the respective antibodies. Data was normalized to each receptor binding to TcdB in the absence of DARPins (No DARPin). Both 1.4E (SEQ ID NO. 02) and DLD-4 (SEQ ID NO. 37) blocked the interaction between CSPG4 and TcdB, while U3 (SEQ ID NO. 13) had no significant effect on the TcdB-CSPG4 interaction. Similarly, U3 (SEQ ID NO. 13) and DLD-4 (SEQ ID NO. 37) significantly blocked the interaction between FZD2 and TcdB, but not 1.4E (SEQ ID NO. 02). FIG. 11A and FIG. 11B illustrate DARPin DLD-4 (SEQ ID NO. 37) blocks the interaction between TcdB and its cellular receptors. ELISA plates were coated with TcdB.sub.VPI followed by treatment with the 1 nM of the extracellular domains of Chondroitin Sulfate Proteoglycan 4 (CSPG4) (FIG. 11A), or Frizzled Class Receptor 2 (FZD2) (FIG. 11B) alone or in mixture with 250 nM of the indicated DARPins. The amount of TcdB-bound CSPG4 and FZD2 was detected using the respective antibodies. Data was normalized to each receptor binding to TcdB in the absence of DARPins (No DARPin). Both 1.4E (SEQ ID NO. 02) and DLD-4 (SEQ ID NO. 37) blocked the interaction between CSPG4 and TcdB, while U3 (SEQ ID NO. 13) had no significant effect on the TcdB-CSPG4 interaction. Similarly, U3 (SEQ ID NO. 13) and DLD-4 (SEQ ID NO. 37) significantly blocked the interaction between FZD2 and TcdB, but not 1.4E (SEQ ID NO. 02). Error bars represent the standard deviation of three independent experiments done in duplicate. *: p<0.005, t-test.

[0062] DARPin DLD-4 (SEQ ID NO. 37) inhibits TcdB from C. difficile strains VPI 10463 (ribotype 087) in Caco-2 and TZM cells (FIG. 12). IMAC-purified DARPins were added to Caco-2 cells (1.5103 cells/well) together with 10 pg/mL TcdB. Cell viability was quantified 72 hours later by the CellTiterGlo assay and normalized to nave Caco-2 cells. Only U3 (SEQ ID NO. 13) and DLD-4 (SEQ ID NO. 37) inhibited TedB cytotoxicity in these cells (FIG. 14A). IMAC-purified DARPins were added to TZM cells (1.5103 cells/well) together with 5 pg/mL TcdB. Cell viability was quantified 72 hours later by the CellTiterGlo assay and normalized to nave TZM cells. U3 (SEQ ID NO. 13) and 1.4E (SEQ ID NO. 02) showed partial inhibition of TcdB in TZM cells (FIG. 12B). FIG. 12A and FIG. 12B show DARPin DLD-4 (SEQ ID NO. 37) inhibits TcdB from C. difficile strains VPI 10463 (ribotype 087) in Caco-2 and TZM cells. FIG. 12A shows IMAC-purified DARPins were added to Caco-2 cells (1.5103 cells/well) together with 10 pg/mL TcdB. Cell viability was quantified 72 hours later by the CellTiterGlo assay and normalized to nave Caco-2 cells. Only U3 (SEQ ID NO. 13) and DLD-4 (SEQ ID NO. 37) inhibited TcdB cytotoxicity in these cells. Error bars represent the standard deviation of two independent experiments done in duplicate. FIG. 12B shows IMAC-purified DARPins were added to TZM cells (1.510.sup.3 cells/well) together with 5 pg/mL TcdB. Cell viability was quantified 72 hours later by the CellTiterGlo assay and normalized to nave TZM cells. U3 (SEQ ID NO. 13) and 1.4E (SEQ ID NO. 02) showed partial inhibition of TcdB in TZM cells. Error bars represent the standard deviation of two independent experiments done in duplicate.

Enhanced Stability Against Proteases

[0063] FIG. 13A and FIG. 13B show that DARPin 1.4E T10-2 (SEQ ID NO. 32) and 1.4E C3 (SEQ ID NO. 33) exhibit enhanced stability against proteases. Purified 1.4E T10-2 (SEQ ID NO. 32) (FIG. 13A) and 1.4E C3 (SEQ ID NO. 33) (FIG. 13B) were incubated with 1 mg/ml trypsin, 0.5 mg/ml chymotrypsin, an equal volume of intestinal fluid (IF) from mouse or hamster, or PBS at 37 C for one hour before being serially diluted and added to Vero cells together with TcdB (5 pg/mL). Cell viability was quantified 72 hours later and normalized to nave Vero cells. DARPin 1.4E T10-2 (SEQ ID NO. 32) and 1.4E C3 (SEQ ID NO. 33) exhibit enhanced stability against proteases (FIG. 13). Purified 1.4E T10-2 (SEQ ID NO. 32) (FIG. 13A) and 1.4E C3 (SEQ ID NO. 33) (FIG. 13B) were incubated with 1 mg/ml trypsin, 0.5 mg/ml chymotrypsin, an equal volume of intestinal fluid (IF) from mouse or hamster, or PBS at 37 C for one hour before being serially diluted and added to Vero cells together with TcdB (5 pg/mL). Cell viability was quantified 72 hours later and normalized to nave Vero cells.

[0064] Table 2, shown below, illustrates the monomer, dimer, primer, and linker sequence listings of the present disclosure.

TABLE-US-00002 TABLE2 MonomerSequences 1.2E (SEQIDNO.01) GSDLGKKLLEAARAGQDDEVRILMANGADVNAYDARGVTPLHLAAFSGHL EIVEVLLKNGADVNAIDVIGMTPLHLAAWIGHLEIVEVLLKHGADVNAVD RSGNTPLHLAAWLGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 1.4E (SEQIDNO.02) GSDLGKKLLEAARAGQDDEVRILMANGADVNATDHLGVTPLHLAAVLGHL EIVEVLLKHGADVNAYDILGRTPLHLAAWRGHLEIVEVLLKYGADVNADD TSGTTPLHLAAGEGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 1.8H (SEQIDNO.03) GSDLGKKLLEAARAGQDDEVRILMANGADVNAIDALGVTPLHLAAWVGHL EIVEVLLKNGADVNAVDVLGWTPLHLAAWKGHLEIVEVLLKHGADVNAMD NRGPTPLHLAAVDGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 1.11E (SEQIDNO.04) GSDLGKKLLEAARAGQDDEVRILMANGADVNATDHLGVTPLHLAAVLGHL EIVEVLLKHGADVNAYDILGRTPLHLAAWRGHLEIVEVLLKYGADVNAVD TMGETPLHLAAGMGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 5.8B (SEQIDNO.05) GSDLGKKLLEAARAGQDDEVRILMANGADVNALDTHGVTPLHLAAWRGHL EIVEVLLKNGADVNAGDVLGRTPLHLAATFGHLEIVEVLLKHGADINAVD TVGVTPLHLAAGQGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 5.5A (SEQIDNO.06) GSDLGKKLLEAARAGQDDEVRILMANGADVNAVDRAGTTPLHLAAHGGHL EIVEVLLKYGADVNARDLLGRTPLHLAAWRGHLEIVEVLLKHGADVNASD PLGITPLHLAAATGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 7.5A (SEQIDNO.07) GSDLGKKLLEAARAGQDDEVRILMANGADVNALDTHGVTPLHLAAWRGHL EIVEVLLKNGADVNAGDVLGRTPLHLAATFGHLEIVEVLLKHGADVNAVD TVGVTPLHLAAGQGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 5.9C (SEQIDNO.08) GSDLGKKLLEAARAGQDDEVRILMANGADVNAQDYYGSTPLHLAAWLGHL EIVEVLLKNGADVNAGDLLGRTPLHLAAWFGHLEIVEVLLKHGADVNAVD TMGETPLHLAAGMGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 3.11H (SEQIDNO.09) GSDLGKKLLEAARTGQDDEVRILMANGADVNAKDEGGPTPLHLAAVGGHL EIVEVLLKHGADVNAVDALGRTPLHLAAWQGHLEIVEVLLKHGADVNARD KNGYTPLHLAAGMGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 3.5B (SEQIDNO.10) GSDLGKKLLEAARAGQDDEVRILMANGADVNAKDTFGETPLHLAAWKGHL EIVEVLLKYGADVNASDLLGRTPLHLAAWRGHLEIVEVLLKNGADVNASD TGGYTPLHLAAALGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 8.1B (SEQIDNO.11) GSDLGKKLLEAARAGQDDEVRILMANGADVNAKDGSGVTPLHLAAVAGHL EIVEVLLKNGADVNARDRLGRTPLHLAAWRGHLEIVEVLLKNGADVNAKD LGGDTPLHLAAALGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 3.9G (SEQIDNO.12) GSDLGKLLEAARAGQDDEVRILMANGADVNANDRRGITPLHLAAINGHLE IVEVLLKNGADVNAVDVLGFTPLHLAAWRGHLEIVEVLLKNGADVNAFDK SGSTPLHLAAHFGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDL AEILQSSS U3 (SEQIDNO.13) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLHGADVNAPDRW GRTPLHLAAHHGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDSGNEDLA EILQSSS U5 (SEQIDNO.14) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLLKNGADVNAQD KFGKTAFDISIDNGNEDLAEILQSSS TEMP (SEQIDNO.15) GSDLGKKLLEAARAGQDDEVRILMANGADVNANDRRGITPLHLAAINGHL EIVEVLLKNGADVNAVDVLGFTPLHLAAWRGHLEIVEVLLKNGADVNAFD KSGSTPLHLAAHFGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D3 (SEQIDNO.16) GSDLGKKLLEAARAGQDDEVRILMANGADVNAADRYGPTPLHLAAYRGHL EIVEVLLKHGADVNAKDVLGWTPLHLAAWIGHLEIVEVLLKNGADVNAVD VTGETPLHLAAVMGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D10 (SEQIDNO.17) GSDLGKKLLEAARAGQDDEVRILMANGADVNAADRYGPTPLHLAAYRGHL EIVEVLLKHGADVNAKDVLGWTPLHLAAWIGHLEIVEVLLKNGADVNAVD VTGETPLHLAAVMGHLEIAEVLLKHGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D13 (SEQIDNO.18) GSDLGKKLLEAARAGQDDEVRILVANGADVNAADRYGPTPLHLAAYRGHL EIVEVLLKHGADVNAKDVLGWTPLHLAAWIGHLEIVEVLLKNGADVNAVD VTGETPLHLAAVMGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D7 (SEQIDNO.19) GSDLGKKLLEAARAGQDDEVRILMANGADVNAADRYGPTPLHLAAYRGHL EIVEVLLKHGADVNAKDVLGWTPLHLAAWIGHPEIVEVLLKNGADVNAVD VTGETPLHLAAVMGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D9 (SEQIDNO.20) GSDLGKKLLEAARAGQDDEVRILMANGADVNAADRYGPTPLHLAAYRGHL EIAEVLLKHGADVNAKDVLGWTPLHLAAWIGHLEIVEVLLKNGADVNAVD VTGETPLHLAAVMGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D6 (SEQIDNO.21) GSDLGKKLLEAARAGQDDEVRILMANGADVNAADRYGPTPLHLAAYRGHL EIVEVLLKHGADVNAKDVLGWTPLHLAAWIGHLEIVEVLPKNGADVNAVD VTGETPLHLAAVMGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D15 (SEQIDNO.22) GSDLGKKLLEAARAGQDDEVRILMANGADVNAADRYGPTPLHLAAYRGHL EIVEVLLKHGADVNAKDVLGWTPLHLAAWIGHLEIVEVLLKNGADVNAVD VTGETPLHLAAVMGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D16 (SEQIDNO.23) GSDLGKKLLEAARAGQDDEVRILMANGADVNAADRYGPTPLHLAAYRGHL EIVEVLLKHGADVNAKDVLGWTPLHLAAWIGHLEIVEVLLKNGADVNARD RTGETPLHLAAAIGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D8 (SEQIDNO.24) GSDLGKKLLEAARAGQDDEVRILMANGADVNAADRYGPTPLHLAAYRGHL EIVEVLLKHGADVNAKDLLGFTPVHLAAWLGHLEIVEVLLKNGADVNARD RTGETPLHLAAAIGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D14 (SEQIDNO.25) GSDLGKKLLEAARAGQDDEVRILMANGADVNALDVRGSTPLHLAAFKGHL EIVEVLLKNGADVNAKDLLGFTPVHLAAWLGHLEIVEVLLKNGADVNAGD RTGETPLHLAAAIGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D1 (SEQIDNO.26) GSDLGKKLLEAARAGQDDEVRILMANGADVNALDVRGSTPLHLAAFKGHL EIVEVLLKNGADVNAKDLLGFTPVHLAAWLGHLEIVEVLPKNGADVNARD RTGETPLHLAAAIGHLEIVEILLKYGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D2 (SEQIDNO.27) GSDLGKKLLEAARAGQDDEVRILMANGADVNALDVRGSTPLHLAAFKGHL EIVEVLLKNGADVNAKDLLGFTPVHLAAWLGHLEIVEVLLKNGADVNARD RTGETPLHLAAAIGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D4 (SEQIDNO.28) GSDLGKKLLEAARAGQDGEVRILMANGADVNALDVRGSTPLHLAAFKGHL EIVEVLLKNGADVNAKDLLGFTPVHLAAWLGHLEIVEVLLKNGADVNARD RTGETPLHLAAAIGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D12 (SEQIDNO.29) GSDLGKKLLEAARAGQDDEVHILMANGADVNALDVRGSTPLHLAAFKGHL EIVEVLLKNGADVNAKDLLGFTPVHLAAWLGHLEIVEVLLKNGADVNARD RTGETPLHLAAAIGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS D5 (SEQIDNO.30) GSDLGKKLLEAARAGQDDEVRILMANGADVNALDVRGSTPLHLAAFKGHL EIVEVLLKNGADVDAKDLLGFTPVHLAAWLGHLEIVEVLLKNGADVNARD RTGETPLHLAAAIGHLEIVEVLLKNGADVNAQDKFGKTASDISIDNGNED LAEILQSSS D11 (SEQIDNO.31) GSDLGKKLLEAGRAGQDDEVRILMANGADVNALDVRGSTPLHLAAFKGHL EIVEVLLKNGADVNAKDLLGFTPVHLAAWLGHLEIVEVLLRNGADVNARD RTGETPLHLAAAIGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSS 1.4ET10-2 (SEQIDNO.32) GSDLGGLLLEAAQAGQDDEVHILMANGADVNTTDHLGVTPLHLAAVLGHL EIVEVLLQHGADVNAYDILGRTPLHLAAWKGHLEIVEVLLQYGADVNADD TSGTTPLHLAAAEGHLEIVEVLLQYGADVNAQDIFGTTASDISIDNGNED LAEILQSSS 1.4EC3 (SEQIDNO.33) GSDLGELLLEAAQAGQDDEVHILMANGADVNATNHLGVTPLHLAAVLGHL EIVEVLLQHGADVNAIDILGRTPLHLAAWKGHLEIVEVLLQHGADVNADD TSGTTPLHLAAGEGHLEIVEVLLQHGADVNAQDINGTTASDISIDNGNED LAEILQSSS DimerSequences DLD-1 (SEQIDNO.34) GSDLGKKLLEAARAGQDDEVRILMANGADVNAVDRAGTTPLHLAAHGGHL EIVEVLLKYGADVNARDLLGRTPLHLAAWRGHLEIVEVLLKHGADVNASD PLGITPLHLAAATGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSSEFGGGGSGGGGSGGGGSASDLGKKLLEAARAGQDDGVRILM ANGADVNALDTHGVTPLHLAAWRGHLEIVEVLLKNGADVNAGDVLGRTPL HLAATFGHLEIVEVLLKHGADVNAVDTVGVTPLHLAAGQGHLEIVEVLLK YGADVNAQDKFGKTAFDISIDNGNEDLAEILQSSS DLD-2 (SEQIDNO.35) GSDLGKKLLEAARAGQDDEVRILMANGADVNAIDALGVTPLHLAAWVGHL EIVEVLLKNGADVNAVDVLGWTPLHLAAWKGHLEIVEVLLKHGADVNAMD NRGPTPLHLAAVDGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNED LAEILQSSSEFGGGGSGGGGSGGGGSASDLGKKLLEAARAGQDDEVRILM ANGADVNAYDARGVTPLHLAAFSGHLEIVEVLLKNGADVNAIDVIGMTPL HLAAWIGHLEIVEVLLKHGADVNAVDRSGNTPLHLAAWLGHLEIVEVLLK YGADVNAQDKFGKTAFDISIDNGNEDLAEILQSSS DLD-3 (SEQIDNO.36) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLHGADVNAPDRW GRTPLHLAAHHGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDSGNEDLA EILQSSSEFGGGGSGGGGSGGGGSASDLGKKLLEAARAGQDDEVRILMAN GADVNAQDYYGSTPLHLAAWLGHLEIVEVLLKNGADVNAGDLLGRTPLHL AAWFGHLEIVEVLLKHGADVNAVDTMGETPLHLAAGMGHLEIVEVLLKHG ADVNAQDKFGKTAFDISIDNGNEDLAEILQSSS DLD-4 (SEQIDNO.37) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLHGADVNAPDRW GRTPLHLAAHHGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLA EILQSSSEFGGGGSGGGGSGGGGSASDLGKKLLEAARAGQDDEVRILMAN GADVNATDHLGVTPLHLAAVLGHLEIVEVLLKHGADVNAYDILGRTPLHL AAWRGHLEIVEVLLKYGADVNADDTSGTTPLHLAAGEGHLEIVEVLLKYG ADVNAQDKFGKTAFDISIDNGNEDLAEILQSSS DLD-5 (SEQIDNO.38) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLLKNGADVNAQD KFGKTAFDISIDNGNEDLAEILQSSSEFGGGGSGGGGSGGGGSASDLGKK LLEAARAGQDDEVRILMANGADVNALDTHGVTPLHLAAWRGHLEIVEVLL KNGADVNAGDVLGRTPLHLAATFGHLEIVEVLLKHGADINAVDTVGVTPL HLAAGQGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQS SS DLD-6 (SEQIDNO.39) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLHGADVNAPDRW GRTPLHLAAHHGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLA EILQSSSEFGGGGSGGGGSGGGGSASDLGKKLLEAARAGQDDEVRILMAN GADVNAKDTFGETPLHLAAWKGHLEIVEVLLKYGADVNASDLLGRTPLHL AAWRGHLEIVEVLLKNGADVNASDTGGYTPLHLAAALGHLEIVEVLLKHG ADVNAQDKFGKTAFDISIDNGNEDLAEILQSSS DLD-7 (SEQIDNO.40) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLHGADVNAPDRW GRTPLHLAAHHGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLA EILQSSSEFGGGGSGGGGSGGGGSGSDLGKKLLEAARAGQDDEVRILMAN GADVNAVDRAGTTPLHLAAHGGHLEIVEVLLKYGADVNARDLLGRTPLHL AAWRGHLEIVEVLLKHGADVNASDPLGITPLHLAAATGHLEIVEVLLKNG ADVNAQDKFGKTAFDISIDNGNEDLAEILQSSS DLD-10 (SEQIDNO.41) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLHGADVNAPDRW GRTPLHLAAHHGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLA EILQSSSEFGGGGSGGGGSGGGGSGSDLGKKLLEAARAGQDDEVRILMAN GADVNALDTHGVTPLHLAAWRGHLEIVEVLLKNGADVNAGDVLGRTPLHL AATFGHLEIVEVLLKHGADINAVDTVGVTPLHLAAGQGHLEIVEVLLKYG ADVNAQDKFGKTAFDISIDNGNEDLAEILQSSS DLD-11 (SEQIDNO.42) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLHGADVNAPDRW GRTPLHLAAHHGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLA EILQSSSEFGGGGSGGGGSGGGGSASDLGKKLLEAARAGQDDEVRILMAN GADVNAYDARGVTPLHLAAFSGHLEIVEVLLKNGADVNAIDVIGMTPLHL AAWIGHLEIVEVLLKHGADVNAVDRSGNTPLHLAAWLGHLEIVEVLLKYG ADVNAQDKFGKTAFDISIDNGNEDLAEILQSSS DLD-12 (SEQIDNO.43) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLHGADVNAPDRW GRTPLHLAAHHGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLA EILQSSSEFGGGGSGGGGSGGGGSASDLGKKLLEAARAGQDDEVRILMAN GADVNATDHLGVTPLHLAAVLGHLEIVEVLLKHGADVNAYDILGRTPLHL AAWRGHLEIVEVLLKYGADVNAVDTMGETPLHLAAGMGHLEIVEVLLKHG ADVNAQDKFGKTAFDISIDNGNEDLAEILQSSS U3D16 (SEQIDNO.49) GSDLGKKLLEAARAGQDDEVRILMANGADVNADDRIGMTPLHLAAIGGHL EIVEVLLKNGADVNADDVHGRTPLHLAAGRGHLEIVEVLHGADVNAPDRW GRTPLHLAAHHGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDSGNEDLA EILQSSSGGGGSGGGGSGGGGSGSDLGKKLLEAARAGQDDEVRILMANGA DVNAADRYGPTPLHLAAYRGHLEIVEVLLKHGADVNAKDVLGWTPLHLAA WIGHLEIVEVLLKNGADVNARDRTGETPLHLAAAIGHLEIVEVLLKNGAD VNAQDKFGKTAFDISIDNGNEDLAEILQSSS PrimerSequences Ran2-D-F (SEQIDNO.44) CATGTGCATTATCTGGGATCCGACCTGG Ran2-D-R (SEQIDNO.45) TAACAGGCCGCAAGCTTTTACGA Linker-BSAi-D-F (SEQIDNO.46) TTAGCTGGTCTCTGGAGGGAGCGGAGGCGGAGGGAGCGCTAGCGACCTGG GTAAGAAACTGCTG Linker-BSAi-D-R (SEQIDNO.47)# GAAATCCTGCAATCGAGCTCGGAATTCGGAGGCGGAGGGAGCGGAGGCGG AGTGAGACCTTAGCT# LinkerSequence (GGGGS)x3Linker (SEQIDNO.48) GGGGSGGGGSGGGGS

[0065] Although various embodiments of the present disclosure have been illustrated in the accompanying Drawings and described in the foregoing Detailed Description, it will be understood that the present disclosure is not limited to the embodiments disclosed herein, but is capable of numerous rearrangements, modifications, and substitutions without departing from the spirit of the disclosure as set forth herein.

[0066] The term substantially is defined as largely but not necessarily wholly what is specified, as understood by a person of ordinary skill in the art. In any disclosed embodiment, the terms substantially, approximately, generally, and about may be substituted with within [a percentage] of what is specified, where the percentage includes 0.1, 1, 5, and 10 percent. .sub.#

[0067] The foregoing outlines features of several embodiments so that those skilled in the art may better understand the aspects of the disclosure. Those skilled in the art should appreciate that they may readily use the disclosure as a basis for designing or modifying other processes and structures for carrying out the same purposes and/or achieving the same advantages of the embodiments introduced herein. Those skilled in the art should also realize that such equivalent constructions do not depart from the spirit and scope of the disclosure, and that they may make various changes, substitutions, and alterations herein without departing from the spirit and scope of the disclosure. The scope of the invention should be determined only by the language of the claims that follow. The term comprising within the claims is intended to mean including at least such that the recited listing of elements in a claim are an open group. The terms a, an, and other singular terms are intended to include the plural forms thereof unless specifically excluded. #