Salicyl-adenosinemonosulfamate analogs and uses thereof

12435088 · 2025-10-07

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided herein are compounds of Formula (I), and pharmaceutically acceptable salts or tautomers thereof. Also provided are pharmaceutical compositions, kits, and methods involving the inventive compounds for the treatment and/or prevention of an infectious disease (e.g., bacterial infection (e.g., Mycobacterium infection (e.g., tuberculosis)). (I) ##STR00001##

Claims

1. A compound of Formula (I): ##STR00343## or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, wherein: R.sup.1 is optionally substituted alkyl, optionally substituted heteroalkyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted acyl; each or R.sup.2 and R.sup.3 is hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, NO.sub.2, CN, OR.sup.e, N(R.sup.e).sub.2, N.sub.3, SO.sub.2H, SO.sub.3H; SH, SR.sup.e, SSR.sup.e, OC(O)R.sup.e, OCO.sub.2R.sup.e, OC(O)N(R.sup.e).sub.2, C(O)N(R.sup.e).sub.2, NC(O)N(R.sup.e).sub.2, OC(O)O(R.sup.e).sub.2, SO.sub.2R.sup.e, SO.sub.2OR.sup.e, OSO.sub.2R.sup.e, S(O)R.sup.e, or OS(O)R.sup.e; each of R.sup.9, R.sup.10, R.sup.11 and R.sup.12 is hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, NO.sub.2, CN, OR.sup.4, OR.sup.5, OR.sup.e, N(R.sup.e).sub.2, N.sub.3, SO.sub.2H, SO.sub.3H; SH, SR.sup.e, SSR.sup.e, OC(O)R.sup.e, OCO.sub.2R.sup.e, OC(O)N(R.sup.e).sub.2, OC(O)N(R.sup.e).sub.2, C(O)N(R.sup.e).sub.2, NC(O)N(R.sup.e).sub.2, OC(O)O(R.sup.e).sub.2, SO.sub.2R.sup.e, SO.sub.2OR.sup.e, OSO.sub.2R.sup.e, S(O)R.sup.e, OS(O)R.sup.e, or two occurrences of any R.sup.9, R.sup.10, R.sup.11 and R.sup.12 are joined to form an optionally substituted carbocyclic ring or an optionally substituted heterocyclic ring; each of R.sup.4 and R.sup.5 is independently hydrogen, optionally substituted C.sub.1-6 alkyl, optionally substituted acyl, or an oxygen protecting group, or R.sup.4 and R.sup.5 are joined to form an optionally substituted heterocyclic ring; X.sup.1 is a bond, O, (C(R.sup.d).sub.2).sub.q, or NR.sup.e; each occurrence of R.sup.d is independently hydrogen, halogen, optionally substituted C.sub.1-6 alkyl, OR.sup.e, or N(R.sup.e).sub.2; each occurrence of R.sup.e is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, an oxygen protecting group when attached to an oxygen atom, a nitrogen protecting group when attached to a nitrogen atom, or two R.sup.e are joined to form an optionally substituted carbocyclic, an optionally substituted aryl, an optionally substituted heterocyclic or optionally substituted heteroaryl ring; q is 1, 2, or 3; each occurrence of R.sup.7 is independently halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, NO.sub.2, CN, OR.sup.e, or N(R.sup.e).sub.2, or two R.sup.7 are joined to form an optionally substituted aryl or optionally substituted heteroaryl ring; and n is 0, 1, 2, 3, 4, or 5.

2. The compound of claim 1, wherein the compound is of formula: ##STR00344## ##STR00345## ##STR00346## or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

3. A pharmaceutical composition comprising a compound of claim 1, and a pharmaceutically acceptable excipient.

4. A method of treating or preventing an infectious disease comprising administering an effective amount of a compound of claim 1 to a subject in need thereof.

5. A method of inhibiting siderophore biosynthesis in an infection in a subject, the method comprising administering to the subject a compound of claim 1.

6. A method of inhibiting siderophore biosynthesis in an infectious microorganism, the method comprising contacting the infectious microorganism with a compound of claim 1.

7. A method of inhibiting biosynthesis of a virulence factor in an infection in a subject, the method comprising administering to the subject a compound of claim 1.

8. A method of inhibiting biosynthesis of a virulence factor in an infectious microorganism, the method comprising contacting the infectious microorganism with a compound of claim 1.

9. A kit comprising: a compound of claim 1; and instructions for administering to a subject the compound or composition.

10. The compound of claim 1, wherein the compound is of the Formula (III-B): ##STR00347## or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

11. The compound of claim 1, wherein the compound is of the Formula (III-C): ##STR00348## or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

12. The compound of claim 1, wherein the compound is of the Formula (III-D): ##STR00349## or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

13. The compound of claim 1, wherein the compound is of the Formula (III-E): ##STR00350## or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

14. The compound of claim 1, wherein the compound is of the Formula (IV-L): ##STR00351## or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, wherein: R.sup.8 is independently hydrogen, optionally substituted alkyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, oxygen protecting group, or a nitrogen a protecting group; and n is 0, 1, 2, 3, or 4.

15. The compound of claim 1, wherein the compound is of the Formula (IV-M) or Formula (IV-N): ##STR00352## or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, wherein: R.sup.8 is independently hydrogen, optionally substituted alkyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, oxygen protecting group, or a nitrogen a protecting group; and n is 0, 1, 2, 3, or 4.

16. The compound of claim 1, wherein the compound is of the Formula (IV-T): ##STR00353## or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, wherein: each occurrence of R.sup.8 is independently hydrogen, optionally substituted alkyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, oxygen protecting group, or a nitrogen a protecting group, or two R.sup.8 are joined to form an optionally a substituted heterocyclyl, or optionally substituted heteroaryl ring; and n is 0, 1, 2, 3, or 4.

17. The compound of claim 1, wherein the compound is of the Formula (IV-U) or Formula (IV-V): ##STR00354## or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, wherein: each occurrence of R.sup.8 is independently hydrogen, optionally substituted alkyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, oxygen protecting group, or a nitrogen a protecting group, or two R.sup.8 are joined to form an optionally a substituted heterocyclyl, or optionally substituted heteroaryl ring; and n is 0, 1, 2, 3, or 4.

18. The compound of claim 1, wherein R.sup.1 is selected from the group consisting of methyl, ethyl, propyl, isopropyl, cyclopropyl, and trifluoromethyl.

19. The compound of claim 1, wherein each occurrence of R.sup.e is hydrogen.

20. The compound of claim 1, wherein the phenyl ring bearing R.sup.7 is of formula: ##STR00355## ##STR00356##

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The accompanying drawings, which constitute a part of this application, illustrate several embodiments of the invention and together with the description, serve to explain the principles of the invention.

(2) FIG. 1A shows the nucleoside antibiotic salicyl-AMS (compound 1).

(3) FIG. 1B shows the salicyl-AMP intermediate synthesized by the salicylate adenylation enzyme activity of MbtA.sub.tb.

(4) FIG. 1C shows reactions catalyzed by MbtA.sub.tb during mycobactin (MBT) biosynthesis. MbtA.sub.tb catalyzes formation of the first covalent acyl-enzyme intermediate during MBT acyl-chain assembly through a mechanism involving two-half reactions. The first half reaction is the ATP-dependent adenylation of salicylic acid to generate a salicyl-AMP intermediate that remains non-covalently bound to the active site. The second half-reaction is the transfer of the salicyl moiety of the adenylate onto the phosphopantetheinyl group of the carrier protein domain of the peptide synthetase MbtB.

(5) FIG. 1D shows the compound 5-O-sulfamoyladenosine (AMS).

(6) FIG. 1E shows a representative genus of mycobactin siderophores of M. tuberculosis. R represents variable fatty acyl groups (mycobactin variants) or acyl substituents terminating in a carboxylate or a methyl ester (carboxymycobactin variants). All these variants are collectively referred herein to as MBTs.

(7) FIG. 2 shows nucleotide sequence alignment of MbtA.sub.tb and MbtA.sup.opt. Boxed nucleotides indicate changes in mbtA.sup.opt relative to the native MbtA.sub.tb. The native mbtAtb (Rv2384, Quadri, L. E., et al. (1998) Chem. Biol. 5, 631-645) was subjected to analysis for gene optimization for protein expression in E. coli. The analysis assigned a 0.41 Codon Adaptation Index (CAI) rating to MbtA.sub.tb (CAI=1.0 is considered ideal and CAI>0.8 is good for expression in E. coli). The analysis identified 36% and 14% of the codons in MbtA.sub.tb being used <70% and <10% of the time, respectively, by E. coli, at least five stretches of 60+ bp with suboptimal GC content (>70%), and potentially problematic direct, inverted, and dyad repeats. The analysis recommended 341 nucleotide changes (shown) that led to a CAI rating of 0.96. The changes were incorporated in MbtA.sup.opt.

(8) FIG. 3A shows different polyhistidine tag strategies evaluated with MbtA.sup.opt.

(9) FIG. 3B shows sodium dodecyl sulfate polyacrylamide gel electrophoresis analysis. Lane 1, molecular marker standards. Lane 2, purified H.sub.10MbtA.sup.opt (77 g loaded). The gel (12.5%) was stained with GelCode Blue Stain Reagent (Thermo Fisher Scientific) for protein visualization.

(10) FIG. 4A shows a preliminary dose-response experiment (v.sub.i/v.sub.o vs. log[inhibitor]) demonstrating inhibition of H.sub.10MbtA.sup.opt by compound 1 wherein IC.sub.50=117 nM.

(11) FIG. 4B shows preliminary dose-response experiment (v.sub.i/v.sub.o vs. log [inhibitor]) demonstrating inhibition of H.sub.10MbtA.sup.opt by compound 4b wherein IC.sub.50=179 nM.

(12) FIG. 4C shows preliminary dose-response experiment (v.sub.i/v.sub.o vs. log [inhibitor]) demonstrating inhibition of H.sub.10MbtA.sup.opt by compound 6 wherein IC.sub.50=273 nM.

(13) FIG. 5A shows a Progress curve for MbtA.sub.tb inhibition at different concentrations of compound 1 (0 nM, 1041 nM, 1458 nM, 2041 nM, 2857 nM, and 4000 nM).

(14) FIG. 5B shows a Progress curve for MbtA.sub.tb inhibition at different concentrations of compound 4b (0 nM, 1041 nM, 1458 nM, 2041 nM, 2857 nM, and 400 nM).

(15) FIG. 5C shows a Progress curve for MbtA.sub.tb inhibition at different concentrations of compound 6 (0 nM, 1041 nM, 1458 nM, 2041 nM, 2857 nM, and 4000 nM).

(16) FIG. 6A shows the dependence of the k.sub.obs on the concentration of compound 1.

(17) FIG. 6B shows the dependence of the k.sub.obs on the concentration of compound 4b.

(18) FIG. 6C shows the dependence of the k.sub.obs on the concentration of compound 6.

(19) FIG. 7 shows phenotypes and salicyl-AMS susceptibility of Msm strains via radio-thin layer chromatography (TLC) analysis of .sup.14C-labeled MBTs. Lanes: 1=Msm wild-type; 2=Msm M; 3=Msm E; 4=Msm EM; 5=Msm EM-pMbtA.sub.sm: 6=Msm EM-pMbtA.sub.tb; 7, Msm EM-pMbtA.sub.tb with DMSO treatment (control); 8, Msm EM-pMbtA.sub.tb with inhibitor compound 1 treatment. The Msm M strain represents a no MBT production control (Chavadi. S. S., et al. (2011) J. Bacteriol. 193, 5905-5913). The image shows the entire TLC plate wherein Ori refers to origin and SF refers to solvent front. The solvent system used was 2:3:3 petroleum ether:n-butanol:ethyl acetate.

(20) FIG. 8 shows a representative plot of post-antibiotic effect (PAE) for salicyl-AMS (1). The growth vs. time datasets were analyzed to determine the time at which cultures reached an exponential growth phase threshold of OD.sub.600 nm=0.05 (dotted line). The time-to-threshold data were used to calculate PAE as the difference between the time-to-threshold values of the inhibitor-exposed culture and the control cultures.

DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS

(21) Provided herein are compounds for the treatment and/or prevention of diseases including bacterial infections. The compounds may inhibit a particular enzyme (e.g., MbtA.sub.tb) of an organism (e.g., Mycobacterium tuberculosis) responsible for a bacterial infection (e.g., Mycobacterium tuberculosis infection). Further, the compounds may treat or prevent a disease (e.g., tuberculosis) caused by a bacterial infection. The compounds may interact with an enzyme so as to inhibit the activity of the enzyme in performing key transformations in the synthesis of siderophores (e.g., salicylic acid to MBT (FIG. 1C)) or virulence factors. In some embodiments, a provided compound affects the ability of an enzyme to react with ATP, i.e., inhibits the first transformation (e.g., formation of salicyl-AMP (FIG. 1B)). In some embodiments, a provided compound inhibits the ability of an enzyme to form the final product, i.e., inhibits a second transformation (e.g., salicyl-MbtB (FIG. 1C)). In some embodiments, the compound inhibits both the first and second transformations.

(22) Salicyl-MbtB is a precursor in the biosynthesis of mycobactin (MBT). Thus, a compound of the disclosure may inhibit MBT biosynthesis. In some embodiments, a compound provided herein inhibits MBT biosynthesis by inhibiting MbtA.sub.tb. In some embodiments, a compound provided herein inhibits siderophore biosynthesis.

(23) Anthranilyl-CoA is a precursor in the biosynthesis of 2-heptyl-3,4-dihydroxyquinoline (PQS) and 2-heptyl-4-hydroxyquinoline (HHQ). Thus, a compound of the disclosure may inhibit PQS and/or HHQ biosynthesis. In some embodiments, a compound provided herein inhibits PQS biosynthesis by inhibiting PqsA. In some embodiments, a compound provided herein inhibits HHQ biosynthesis by inhibiting PqsA. In some embodiments, a compound provided herein inhibits PQS and HHQ biosynthesis by inhibiting PqsA.

(24) The present disclosure provides compounds, pharmaceutical compositions, methods of treatment, and kits useful for treating or preventing an infectious disease. In certain aspects, the infectious disease is a bacterial infection, a viral infection, a fungal infection, or a parasitic infection. In some aspects, the infectious disease is pneumonic plague, septicemic plague, bubonic plague, gastroenteritis, urinary tract infections, neonatal meningitis, hemorrhagic colitis, Crohn's disease, pneumonia, septic shock, gastrointestinal infection, necrotizing enterocolitis, or anthrax. In certain embodiments, the infectious disease is tuberculosis.

(25) In some aspects, compounds of the present disclosure are of Formula (I):

(26) ##STR00007##
or a pharmaceutically acceptable salt or tautomer thereof, wherein: V.sup.1 is CR.sup.3 or =N: V.sup.2 is CH or N; R.sup.1 is optionally substituted alkyl, optionally substituted heteroalkyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted acyl; each or R.sup.2 and R.sup.3 is hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, NO.sub.2, CN, OR.sup.e, N(R.sup.e).sub.2, N.sub.3, SO.sub.2H, SO.sub.3H, SR.sup.e, SSR.sup.e, OC(O)R.sup.e, OCO.sub.2R.sup.e, OC(O)N(R.sup.e).sub.2, C(O)N(R.sup.e).sub.2, NC(O)N(R.sup.e).sub.2, OC(O)O(R.sup.e).sub.2, SO.sub.2R.sup.e, SO.sub.2OR.sup.e, OSO.sub.2R.sup.e, S(O)R.sup.e, or OS(O)R.sup.e; W.sup.1 is O, CR.sup.e.sub.2, NR.sup.e, or S; each of R.sup.9. R.sup.10, R.sup.11, and R.sup.12 is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, NO.sub.2, CN, OR.sup.4, OR.sup.5, OR.sup.e, N(R.sup.e).sub.2, N.sub.3, SO.sub.2H, SO.sub.3H; SH, SR.sup.e, SSR.sup.e, OC(O)R.sup.e, OCO.sub.2R.sup.e, OC(O)N(R.sup.e).sub.2, C(O)N(R.sup.e).sub.2, NC(O)N(R.sup.e).sub.2, OC(O)O(R.sup.e).sub.2, SO.sub.2R.sup.e, SO.sub.2OR.sup.e, OSO.sub.2R.sup.e, S(C)R.sup.e, OS(O)R.sup.e, or two occurrences of any R.sup.9. R.sup.10, R.sup.11, and R.sup.12 are joined to form an optionally substituted carbocyclic ring or an optionally substituted heterocyclic ring; each of R.sup.4 and R.sup.5 is independently hydrogen, optionally substituted C.sub.1-6 alkyl, optionally substituted acyl, or an oxygen protecting group, or R.sup.4 and R.sup.5 are joined to form an optionally substituted heterocyclic ring; each of R.sup.a and R.sup.b is independently hydrogen, halogen, optionally substituted C.sub.1-6 alkyl, OR.sup.e, or N(R.sup.e).sub.2; X.sup.1 is a bond, O, (C(R.sup.d).sub.2).sub.q, or NR.sup.e, X.sup.2 is a bond, O, (C(R.sup.d).sub.2).sub.t, or NR.sup.e; each occurrence of R.sup.d is independently hydrogen, halogen, optionally substituted C.sub.1-6 alkyl, OR.sup.e, or N(R.sup.e).sub.2; R.sup.6 is of the formula:

(27) ##STR00008## each of Y and Z is independently optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted heteroalkyl, optionally substituted heteroalkenyl, optionally substituted heteroalkynyl, optionally substituted alkoxy, optionally substituted amino, OR.sup.e, N(R.sup.e).sub.2, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl; each of R.sup.6a, R.sup.6b, and R.sup.6c is independently hydrogen, halogen, optionally substituted C.sub.1-6 alkyl, OR.sup.e, or N(R.sup.e).sub.2; each occurrence of R.sup.e is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, an oxygen protecting group when attached to an oxygen atom, a nitrogen protecting group when attached to a nitrogen atom, or two R.sup.e are joined to form an optionally substituted carbocyclic, an optionally substituted aryl, an optionally substituted heterocyclic or optionally substituted heteroaryl ring; each of q and t is independently 1, 2, or 3; and custom character is a single or double bond.

(28) In certain embodiments, the compound is of the formula:

(29) ##STR00009##
or a pharmaceutically acceptable salt or tautomer thereof.

(30) In some embodiments, V.sup.1 is CR.sup.3. In some embodiments, V.sup.1 is CH. In certain embodiments, V.sup.1 is N. In some embodiments, V.sup.1 is CR.sup.3 wherein R.sup.3 is F. In certain embodiments, R.sup.3 is Cl, Br, or F. In certain embodiments, In some embodiments, V.sup.1 is CR.sup.3 wherein R.sup.3 is OR.sup.e (e.g. OH, OMe, O(C.sub.1-6 alkyl)). In certain embodiments, In some embodiments, V.sup.1 is CR.sup.3 wherein R.sup.3 is N(R.sup.e).sub.2 (e.g., NH.sub.2, NMe.sub.2, NH(C.sub.1-6 alkyl)). In certain embodiments, V.sup.1 is CR.sup.3 wherein R.sup.3 is optionally substituted C.sub.1-6 alkyl. In certain embodiments, V.sup.1 is CR.sup.3 wherein R.sup.3 is optionally substituted methyl. In certain embodiments, V.sup.1 is CR.sup.3 wherein R.sup.3 is optionally substituted ethyl, propyl, or butyl.

(31) In certain embodiments, R.sup.3 is optionally substituted carbocyclyl

(32) In certain embodiments, R.sup.3 is optionally substituted aryl

(33) In some embodiments, V.sup.2 is CH. In certain embodiments, V.sup.2 is N.

(34) In some embodiments, R.sup.1 is an optionally substituted C.sub.1-4 alkyl. In certain embodiments, R.sup.1 is unsubstituted methyl. In some embodiments, R.sup.1 is unsubstituted ethyl. In some embodiments, R.sup.1 is unsubstituted propyl. In certain embodiments, R.sup.1 is unsubstituted isopropyl. In some embodiments, R.sup.1 is unsubstituted propyl. In some embodiments, R.sup.1 is unsubstituted butyl, sec-butyl, iso-butyl, or tert-butyl. In certain embodiments, R.sup.1 is substituted methyl. In some embodiments, R.sup.1 is substituted ethyl. In some embodiments, R.sup.1 is substituted propyl. In certain embodiments, R.sup.1 is substituted isopropyl. In some embodiments, R.sup.1 is substituted propyl. In some embodiments, R.sup.1 is substituted butyl, sec-butyl, iso-butyl, or tert-butyl. In some embodiments, R.sup.1 is an optionally substituted C.sub.5-8 alkyl. In certain embodiments, R.sup.1 is a halogen-substituted alkyl (e.g., trifluoromethyl, difluoromethyl, monofluoromethyl, CH.sub.2CH.sub.2F). In certain embodiments R.sup.1 is halogen. In certain embodiments, R.sup.1 is an alkyl substituted with one or more instances of NO.sub.2, CN, OR.sup.e, N(R.sup.e).sub.2, SR.sup.e, C(O)R.sup.e, C(O)OR.sup.e, or C(O)NR.sup.e. In some embodiments, R.sup.1 is CH.sub.2CH.sub.2NH.sub.2. In some embodiments, R.sup.1 is CH.sub.2CH.sub.2OH. In some embodiments, R.sup.1 is an optionally substituted C.sub.3-6 carbocyclyl (e.g., cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl). In some embodiments, R.sup.1 is a C.sub.7-14 carbocyclyl. In certain embodiments, R.sup.1 is a monocyclic carbocyclyl. In some embodiments, R.sup.1 is a bicyclic carbocyclyl. In certain embodiments, R.sup.1 is an optionally substituted C.sub.5-6 heterocyclyl (e.g., tetrahydrofuranyl, tetrahydropyranyl, pyrrolidinyl, piperidinyl, piperazinyl, morpholinyl). In some embodiments, R.sup.1 is an optionally substituted C.sub.7-14 heterocyclyl. In some embodiments, R.sup.1 is an optionally substituted aryl. In certain embodiments, R.sup.1 is an optionally substituted phenyl. In certain embodiments, R.sup.1 is an optionally substituted naphthyl. In some embodiments, R.sup.1 is optionally substituted monocyclic heteroaryl (e.g., pyridinyl, pyrimidinyl, pyrazinyl, pyrrolyl, furanyl, thiophenyl, imidaolyl). In certain embodiments, R.sup.1 is optionally substituted bicyclic heteroaryl (e.g., indenyl, indolyl, quinolinyl, isoquinolinyl). In some embodiments, R.sup.1 is optionally substituted acyl (e.g., formyl, acetyl, propionyl, benzoyl, acryloyl, trifluoroacetyl).

(35) In certain embodiments, R.sup.2 is hydrogen. In certain embodiments, R.sup.2 is halogen. In certain embodiments, R.sup.2 is F. In certain embodiments, R.sup.2 is Cl, Br, or F. In certain embodiments, R.sup.2 is NO.sub.2. In certain embodiments, R.sup.2 is CN. In certain embodiments, R.sup.2 is OR.sup.e (e.g. OH, OMe, O(C.sub.1-6 alkyl)) In certain embodiments, R.sup.2 is OR.sup.e, and R.sup.e is an oxygen protecting group. In certain embodiments, R.sup.2 is N(R.sup.e).sub.2 (e.g., NH.sub.2, NMe.sub.2, NH(C.sub.1-6 alkyl)). In certain embodiments, R.sup.2 is NHR.sup.e, and R.sup.e is a nitrogen protecting group. In certain embodiments, R.sup.2 is optionally substituted acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In some embodiments, R.sup.2 is C(O)OMe. In some embodiments, R.sup.2 is C(O)OH.

(36) In certain embodiments, R.sup.2 is optionally substituted alkyl, e.g., optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.1-2 alkyl, optionally substituted C.sub.2-3 alkyl, optionally substituted C.sub.3-4 alkyl, optionally substituted C.sub.4-5 alkyl, or optionally substituted C.sub.5-6 alkyl. In certain embodiments, R.sup.2 is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.2 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.2 is unsubstituted methyl. In certain embodiments, R.sup.2 is unsubstituted ethyl, propyl, or butyl. In certain embodiments, R.sup.2 is substituted methyl. In certain embodiments, R.sup.2 is substituted ethyl, propyl, or butyl. In certain embodiments, R.sup.2 is optionally substituted alkenyl, e.g., optionally substituted C.sub.2-6 alkenyl. In certain embodiments, R.sup.2 is vinyl, allyl, or prenyl. In certain embodiments, R.sup.2 is optionally substituted alkynyl, e.g., C.sub.2-6 alkynyl.

(37) In certain embodiments, R.sup.2 is optionally substituted carbocyclyl, e.g., optionally substituted C.sub.3-6 carbocyclyl, optionally substituted C.sub.3-4 carbocyclyl, optionally substituted C.sub.4-5 carbocyclyl, or optionally substituted C.sub.5-6 carbocyclyl. In certain embodiments R.sup.2 is optionally substituted heterocyclyl, e.g., optionally substituted 3-6 membered heterocyclyl, optionally substituted 3-4 membered heterocyclyl, optionally substituted 4-5 membered heterocyclyl, or optionally substituted 5-6 membered heterocyclyl.

(38) In certain embodiments, R.sup.2 is optionally substituted aryl, e.g., optionally substituted phenyl. In certain embodiments, R.sup.2 is optionally substituted heteroaryl, e.g., optionally substituted 5-6 membered heteroaryl, or optionally substituted 9-10 membered bicyclic heteroaryl. In certain embodiments, R.sup.2 is optionally substituted aralkyl, e.g., optionally substituted benzyl. In certain embodiments, R.sup.2 is optionally substituted heteroaralkyl, e.g., methyl substituted with a 5-6-membered heteroaryl ring.

(39) In certain embodiments, R.sup.2 is

(40) ##STR00010##
In some embodiments, R.sup.2 is

(41) ##STR00011##
In some embodiments, R.sup.2 is

(42) ##STR00012##
In certain embodiments, R.sup.2 is

(43) ##STR00013##
In some embodiments, R.sup.2 is

(44) ##STR00014##
In certain embodiments, R.sup.2 is

(45) ##STR00015##

(46) In certain embodiments, R.sup.3 is hydrogen. In certain embodiments, R.sup.3 is halogen. In certain embodiments, R.sup.3 is F. In certain embodiments, R.sup.3 is Cl, Br, or F. In certain embodiments, R.sup.1 is NO.sub.2. In certain embodiments, R.sup.3 is CN. In certain embodiments, R.sup.3 is OR.sup.e (e.g. OH, OMe, O(C.sub.1-6 alkyl)) In certain embodiments, R.sup.3 is OR.sup.e, and R.sup.e is an oxygen protecting group. In certain embodiments, R.sup.3 is N(R.sup.e).sub.2 (e.g., NH.sub.2, NMe.sub.2, NH(C.sub.1-6 alkyl)). In certain embodiments, R.sup.3 is NHR.sup.e, and R.sup.e is a nitrogen protecting group. In certain embodiments, R.sup.3 is optionally substituted acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In some embodiments, R.sup.3 is C(O)OMe. In some embodiments, R.sup.3 is C(O)OH.

(47) In certain embodiments, R.sup.3 is optionally substituted alkyl, e.g., optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.1-2 alkyl, optionally substituted C.sub.2-3 alkyl, optionally substituted C.sub.3-4 alkyl, optionally substituted C.sub.4-5 alkyl, or optionally substituted C.sub.5-6 alkyl. In certain embodiments, R.sup.3 is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.3 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.3 is unsubstituted methyl. In certain embodiments, R.sup.3 is unsubstituted ethyl, propyl, or butyl. In certain embodiments, R.sup.3 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.3 is substituted methyl. In certain embodiments, R.sup.3 is substituted ethyl, propyl, or butyl. In certain embodiments, R.sup.3 is optionally substituted alkenyl, e.g., optionally substituted C.sub.2-6 alkenyl. In certain embodiments, R.sup.3 is vinyl, allyl, or prenyl. In certain embodiments, R.sup.3 is optionally substituted alkynyl, e.g., C.sub.2-6 alkynyl.

(48) In certain embodiments, R.sup.3 is optionally substituted carbocyclyl, e.g., optionally substituted C.sub.3-6 carbocyclyl, optionally substituted Cis carbocyclyl, optionally substituted C.sub.4-5 carbocyclyl, or optionally substituted C.sub.5-6 carbocyclyl. In certain embodiments R.sup.3 is optionally substituted heterocyclyl, e.g., optionally substituted 3-6 membered heterocyclyl, optionally substituted 3-4 membered heterocyclyl, optionally substituted 4-5 membered heterocyclyl, or optionally substituted 5-6 membered heterocyclyl.

(49) In certain embodiments, R.sup.3 is optionally substituted aryl, e.g., optionally substituted phenyl. In certain embodiments, R.sup.3 is optionally substituted heteroaryl, e.g., optionally substituted 5-6 membered heteroaryl, or optionally substituted 9-10 membered bicyclic heteroaryl. In certain embodiments, R.sup.3 is optionally substituted aralkyl, e.g., optionally substituted benzyl. In certain embodiments, R.sup.3 is optionally substituted heteroaralkyl, e.g., methyl substituted with a 5-6-membered heteroaryl ring.

(50) In some embodiments, W.sup.1 is O. In certain embodiments, W.sup.1 is CR.sup.e.sub.2. In certain embodiments, W.sup.1 is CH.sub.2. In certain embodiments, W.sup.1 is CF.sub.2. In some embodiments, W.sup.1 is NR.sup.e. In some embodiments, W.sup.1 is NR.sup.e, and R.sup.e is H. In some embodiments, W.sup.1 is NR.sup.e, and R.sup.e is CH.sub.3. In certain embodiments, W.sup.1 is S.

(51) In certain embodiments, R.sup.9 is hydrogen. In certain embodiments, R.sup.9 is halogen. In certain embodiments, R.sup.9 is F. In certain embodiments, R.sup.9 is Cl, Br, or F. In certain embodiments, R.sup.9 is NO.sub.2. In certain embodiments, R.sup.9 is CN. In certain embodiments, R.sup.9 is OR.sup.e (e.g. OH, OMe, O(C.sub.1-6 alkyl)). In certain embodiments, R.sup.9 is OH. In certain embodiments, R.sup.9 is OR.sup.4. In certain embodiments, R.sup.9 is OR.sup.5. In certain embodiments, R.sup.9 is OR.sup.e, and R.sup.e is an oxygen protecting group. In certain embodiments, R.sup.9 is N(R.sup.e).sub.2 (e.g., NH.sub.2, NMe.sub.2, NH(C.sub.1-6 alkyl)). In certain embodiments, R.sup.9 is NHR.sup.e, and R.sup.e is a nitrogen protecting group. In certain embodiments, R.sup.9 is optionally substituted acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In some embodiments, R.sup.9 is C(O)OMe. In some embodiments, R.sup.9 is C(O)OH.

(52) In certain embodiments, R.sup.9 is optionally substituted alkyl, e.g., optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.1-2 alkyl, optionally substituted C.sub.2-3 alkyl, optionally substituted C.sub.3-4 alkyl, optionally substituted C.sub.4-5 alkyl, or optionally substituted C.sub.5-6 alkyl. In certain embodiments, R.sup.9 is optionally unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.9 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.9 is unsubstituted methyl. In certain embodiments, R.sup.9 is unsubstituted ethyl, propyl, or butyl. In certain embodiments, R.sup.9 is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.9 is substituted methyl. In certain embodiments, R.sup.9 is substituted ethyl, propyl, or butyl. In certain embodiments, R.sup.9 is optionally substituted alkenyl, e.g., optionally substituted C.sub.2-6 alkenyl. In certain embodiments, R.sup.9 is vinyl, allyl, or prenyl. In certain embodiments, R.sup.9 is optionally substituted alkynyl, e.g., C.sub.2-6 alkynyl.

(53) In certain embodiments, R.sup.9 is optionally substituted carbocyclyl, e.g., optionally substituted C.sub.3-6 carbocyclyl, optionally substituted C.sub.3-4 carbocyclyl, optionally substituted C.sub.4-5 carbocyclyl, or optionally substituted C.sub.5-6 carbocyclyl. In certain embodiments R.sup.9 is optionally substituted heterocyclyl, e.g., optionally substituted 3-6 membered heterocyclyl, optionally substituted 3-4 membered heterocyclyl, optionally substituted 4-5 membered heterocyclyl, or optionally substituted 5-6 membered heterocyclyl.

(54) In certain embodiments, R.sup.9 is optionally substituted aryl, e.g., optionally substituted phenyl. In certain embodiments, R.sup.9 is optionally substituted heteroaryl, e.g., optionally substituted 5-6 membered heteroaryl, or optionally substituted 9-10 membered bicyclic heteroaryl. In certain embodiments, R.sup.9 is optionally substituted aralkyl, e.g., optionally substituted benzyl. In certain embodiments, R.sup.9 is optionally substituted heteroaralkyl, e.g., methyl substituted with a 5-6-membered heteroaryl ring.

(55) In certain embodiments, R.sup.10 is hydrogen. In certain embodiments, R.sup.10 is halogen. In certain embodiments, R.sup.10 is F. In certain embodiments, R.sup.10 is Cl, Br, or F. In certain embodiments, R.sup.10 is NO.sub.2. In certain embodiments, R.sup.10 is CN. In certain embodiments, R.sup.10 is OR.sup.e (e.g. OH, OMe, O(C.sub.1-6 alkyl)). In certain embodiments, R.sup.10 is OH. In certain embodiments, R.sup.10 is OR.sup.4. In certain embodiments, R.sup.10 is OR.sup.5. In certain embodiments, R.sup.10 is OR.sup.e, and R.sup.e is an oxygen protecting group. In certain embodiments, R.sup.10 is N(R.sup.e).sub.2 (e.g., NH.sub.2, NMe.sub.2, NH(C.sub.1-6 alkyl)). In certain embodiments, R.sup.10 is NHR.sup.e, and R.sup.e is a nitrogen protecting group. In certain embodiments, R.sup.10 is optionally substituted acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In some embodiments, R.sup.10 is C(O)OMe. In some embodiments, R.sup.10 is C(O)OH.

(56) In certain embodiments, R.sup.10 is optionally substituted alkyl, e.g., optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.1-2 alkyl, optionally substituted C.sub.2-3 alkyl, optionally substituted C.sub.3-4 alkyl, optionally substituted C.sub.4-5 alkyl, or optionally substituted C.sub.5-6 alkyl. In certain embodiments, R.sup.10 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.10 is unsubstituted methyl. In certain embodiments, R.sup.10 is unsubstituted ethyl, propyl, or butyl. In certain embodiments, R.sup.10 is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.10 is substituted methyl. In certain embodiments, R.sup.10 is substituted ethyl, propyl, or butyl. In certain embodiments, R.sup.10 is optionally substituted alkenyl, e.g., optionally substituted C.sub.2-6 alkenyl. In certain embodiments, R.sup.10 is vinyl, allyl, or prenyl. In certain embodiments, R.sup.10 is optionally substituted alkynyl, e.g., C.sub.2-6 alkynyl.

(57) In certain embodiments, R.sup.10 is optionally substituted carbocyclyl, e.g., optionally substituted C.sub.3-6 carbocyclyl, optionally substituted C.sub.3-4 carbocyclyl, optionally substituted C.sub.4-5 carbocyclyl, or optionally substituted C.sub.5-6 carbocyclyl. In certain embodiments R.sup.10 is optionally substituted heterocyclyl, e.g., optionally substituted 3-6 membered heterocyclyl, optionally substituted 3-4 membered heterocyclyl, optionally substituted 4-5 membered heterocyclyl, or optionally substituted 5-6 membered heterocyclyl.

(58) In certain embodiments, R.sup.10 is optionally substituted aryl, e.g., optionally substituted phenyl. In certain embodiments, R.sup.10 is optionally substituted heteroaryl, e.g., optionally substituted 5-6 membered heteroaryl, or optionally substituted 9-10 membered bicyclic heteroaryl. In certain embodiments, R.sup.10 is optionally substituted aralkyl, e.g., optionally substituted benzyl. In certain embodiments, R.sup.10 is optionally substituted heteroaralkyl, e.g., methyl substituted with a 5-6-membered heteroaryl ring.

(59) In certain embodiments, R.sup.11 is hydrogen. In certain embodiments, R.sup.11 is halogen. In certain embodiments, R.sup.11 is F. In certain embodiments, R.sup.11 is Cl, Br, or F. In certain embodiments, R.sup.11 is NO.sub.2. In certain embodiments, R.sup.11 is CN. In certain embodiments, R.sup.11 is OR.sup.4. In certain embodiments, R.sup.11 is OR.sup.5. In certain embodiments, R.sup.11 is OR.sup.e (e.g. OH, OMe, O(C.sub.1-6 alkyl)). In certain embodiments, R.sup.11 is OH. In certain embodiments, R.sup.11 is OR.sup.e, and R.sup.e is an oxygen protecting group. In certain embodiments, R.sup.11 is N(R.sup.e).sub.2 (e.g., NH.sub.2, NMe.sub.2, NH(C.sub.1-6 alkyl)). In certain embodiments, R.sup.11 is NHR.sup.e, and R.sup.e is a nitrogen protecting group. In certain embodiments, R.sup.11 is optionally substituted acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In some embodiments, R.sup.11 is C(O)OMe. In some embodiments, R.sup.11 is C(O)OH.

(60) In certain embodiments, R.sup.11 is optionally substituted alkyl, e.g., optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.1-2 alkyl, optionally substituted C.sub.2-3 alkyl, optionally substituted C.sub.3-4 alkyl, optionally substituted C.sub.4-5 alkyl, or optionally substituted C.sub.5-6 alkyl. In certain embodiments, R.sup.11 is optionally substituted Cab alkyl. In certain embodiments, R.sup.11 is substituted methyl. In certain embodiments, R.sup.11 is substituted ethyl, propyl, or butyl. In certain embodiments, R.sup.11 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.11 is unsubstituted methyl. In certain embodiments, R.sup.11 is unsubstituted ethyl, propyl, or butyl. In certain embodiments, R.sup.11 is optionally substituted alkenyl, e.g., optionally substituted C.sub.2-6 alkenyl. In certain embodiments, R.sup.11 is vinyl, allyl, or prenyl. In certain embodiments, R.sup.11 is optionally substituted alkynyl, e.g., C.sub.2-6 alkynyl.

(61) In certain embodiments, R.sup.11 is optionally substituted carbocyclyl, e.g., optionally substituted C.sub.3-6 carbocyclyl, optionally substituted C.sub.3-4 carbocyclyl, optionally substituted C.sub.4-5 carbocyclyl, or optionally substituted C.sub.5-6 carbocyclyl. In certain embodiments R.sup.11 is optionally substituted heterocyclyl, e.g., optionally substituted 3-6 membered heterocyclyl, optionally substituted 3-4 membered heterocyclyl, optionally substituted 4-5 membered heterocyclyl, or optionally substituted 5-6 membered heterocyclyl.

(62) In certain embodiments, R.sup.11 is optionally substituted aryl, e.g., optionally substituted phenyl. In certain embodiments, R.sup.11 is optionally substituted heteroaryl, e.g., optionally substituted 5-6 membered heteroaryl, or optionally substituted 9-10 membered bicyclic heteroaryl. In certain embodiments, R.sup.11 is optionally substituted aralkyl, e.g., optionally substituted benzyl. In certain embodiments, R.sup.11 is optionally substituted heteroaralkyl, e.g., methyl substituted with a 5-6-membered heteroaryl ring.

(63) In certain embodiments, R.sup.12 is hydrogen. In certain embodiments, R.sup.12 is halogen. In certain embodiments, R.sup.12 is F. In certain embodiments, R.sup.12 is Cl, Br, or F. In certain embodiments, R.sup.12 is NO.sub.2. In certain embodiments, R.sup.12 is CN. In certain embodiments, R.sup.12 is OR.sup.e (e.g. OH, OMe, O(C.sub.1-6 alkyl)). In certain embodiments R.sup.12 is OH. In certain embodiments, R.sup.12 is OR.sup.4. In certain embodiments, R.sup.12 is OR.sup.5. In certain embodiments, R.sup.12 is OR.sup.e, and R.sup.e is an oxygen protecting group. In certain embodiments, R.sup.12 is N(R.sup.e).sub.2 (e.g., NH.sub.2, NMe.sub.2, NH(C.sub.1-6 alkyl)). In certain embodiments, R.sup.12 is NHR.sup.e, and R.sup.e is a nitrogen protecting group. In certain embodiments, R.sup.12 is optionally substituted acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In some embodiments, R.sup.12 is C(O)OMe. In some embodiments, R.sup.12 is C(O)OH.

(64) In certain embodiments, R.sup.12 is optionally substituted alkyl, e.g., optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.1-2 alkyl, optionally substituted C.sub.2-3 alkyl, optionally substituted C.sub.3-4 alkyl, optionally substituted C.sub.4-5 alkyl, or optionally substituted C.sub.5-6 alkyl. In certain embodiments, R.sup.12 is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.12 is substituted methyl. In certain embodiments, R.sup.12 is substituted ethyl, propyl, or butyl. In certain embodiments, R.sup.12 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.12 is unsubstituted methyl. In certain embodiments, R.sup.12 is unsubstituted ethyl, propyl, or butyl. In certain embodiments, R.sup.12 is optionally substituted alkenyl, e.g., optionally substituted C.sub.2-6 alkenyl. In certain embodiments, R.sup.12 is vinyl, allyl, or prenyl. In certain embodiments, R.sup.12 is optionally substituted alkynyl, e.g., C.sub.2-6 alkynyl.

(65) In certain embodiments, R.sup.12 is optionally substituted carbocyclyl, e.g., optionally substituted C.sub.3-6 carbocyclyl, optionally substituted C.sub.3-4 carbocyclyl, optionally substituted C.sub.4-5 carbocyclyl, or optionally substituted C.sub.5-6 carbocyclyl. In certain embodiments R.sup.12 is optionally substituted heterocyclyl, e.g., optionally substituted 3-6 membered heterocyclyl, optionally substituted 3-4 membered heterocyclyl, optionally substituted 4-5 membered heterocyclyl, or optionally substituted 5-6 membered heterocyclyl.

(66) In certain embodiments, R.sup.12 is optionally substituted aryl, e.g., optionally substituted phenyl. In certain embodiments, R.sup.12 is optionally substituted heteroaryl, e.g., optionally substituted 5-6 membered heteroaryl, or optionally substituted 9-10 membered bicyclic heteroaryl. In certain embodiments, R.sup.12 is optionally substituted aralkyl, e.g., optionally substituted benzyl. In certain embodiments, R.sup.12 is optionally substituted heteroaralkyl, e.g., methyl substituted with a 5-6-membered heteroaryl ring.

(67) In certain embodiments, two occurrences of R.sup.9, R.sup.10, R.sup.11, and R.sup.12 groups are joined to form an optionally substituted carbocyclic ring. In certain embodiments, two occurrences of R.sup.9, R.sup.10, R.sup.11, and R.sup.12 groups are joined to form an optionally substituted C.sub.3-C.sub.6 heterocyclyl ring (e.g., cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl). In certain embodiments, two occurrences of R.sup.9, R.sup.10, R.sup.11, and R.sup.12 groups are joined to form an optionally substituted heterocyclic ring. In certain embodiments, two occurrences of R.sup.9, R.sup.10, R.sup.11, and R.sup.12 groups are joined to form an optionally substituted C.sub.3-C.sub.6 heterocyclyl ring (e.g., piperidinyl, piperizinyl, morpholinyl, pyrrolidinyl).

(68) In some embodiments, R.sup.9 is OR.sup.4, R.sup.10 is H, R.sup.11 is OR.sup.5, and R.sup.12 is H. In certain embodiments, R.sup.10 is OR.sup.4, R.sup.9 is H, R.sup.12 is OR.sup.5, and R.sup.11 is H.

(69) As generally defined herein, each of R.sup.4 and R.sup.5 is independently hydrogen, optionally substituted C.sub.1-6 alkyl, optionally substituted acyl, or an oxygen protecting group, or R.sup.4 and R.sup.5 are joined to form an optionally substituted heterocyclic ring. The carbon to which R.sup.4 is attached may be in either the (R) or (S) configuration. The carbon to which R.sup.5 is attached may be in either the (R) or (S) configuration.

(70) In certain embodiments, at least one of R.sup.4 and R.sup.5 is hydrogen. In certain embodiments, at least one of R.sup.4 and R.sup.5 is optionally substituted C.sub.1-6 alkyl. In certain embodiments, at least one of R.sup.4 and R.sup.5 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, at least one of R.sup.4 and R.sup.5 is methyl. In certain embodiments, at least one of R.sup.4 and R.sup.5 is ethyl, propyl, or butyl. In certain embodiments, at least one of R.sup.4 and R.sup.5 is acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In certain embodiments, at least one of R.sup.4 and R.sup.5 is an oxygen protecting group. In some embodiments, at least one of R.sup.4 and R.sup.5 is silyl (e.g., TMS, TBDMS, TIPS). In some embodiments, at least one of R.sup.4 and R.sup.5 is acetyl (Ac), benzyl (Bn), benzoyl (Bz), or methoxymethyl ether (MOM).

(71) In certain embodiments, both R.sup.4 and R.sup.5 are hydrogen. In certain embodiments, both R.sup.4 and R.sup.5 are optionally substituted C.sub.1-6 alkyl. In certain embodiments, both R.sup.4 and R.sup.5 are unsubstituted C.sub.1-6 alkyl. In certain embodiments, both R.sup.4 and R.sup.5 are methyl. In certain embodiments, both R.sup.4 and R.sup.5 are ethyl, propyl, or butyl. In certain embodiments, both R.sup.4 and R.sup.5 are acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In certain embodiments, both R.sup.4 and R.sup.5 are oxygen protecting groups. In some embodiments, both R.sup.4 and R.sup.5 are silyl (e.g., TMS, TBDMS, TIPS). In some embodiments, both R.sup.4 and R.sup.5 are acetyl (Ac), benzyl (Bn), benzoyl (Bz), or methoxymethyl ether (MOM).

(72) In certain embodiments, R.sup.4 is hydrogen. In certain embodiments, R.sup.4 is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.4 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.4 is methyl. In certain embodiments, R.sup.4 is ethyl, propyl, or butyl. In certain embodiments, R.sup.4 is acyl (e.g. C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In certain embodiments, R.sup.4 is an oxygen protecting group. In some embodiments, R.sup.4 is silyl (e.g., TMS, TBDMS, TIPS). In some embodiments, R.sup.4 is acetyl (Ac), benzyl (Bn), benzoyl (Bz), or methoxymethyl ether (MOM).

(73) In certain embodiments, R.sup.5 is hydrogen. In certain embodiments, R.sup.5 is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.5 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.5 is methyl. In certain embodiments, R.sup.5 is ethyl, propyl, or butyl. In certain embodiments, R.sup.5 is acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In certain embodiments, R.sup.5 is an oxygen protecting group. In some embodiments, R.sup.5 is silyl (e.g., TMS, TBDMS, TIPS). In some embodiments, R.sup.5 is acetyl (Ac), benzyl (Bn), benzoyl (Bz), or methoxymethyl ether (MOM).

(74) In certain embodiments, R.sup.4 and R.sup.5 are joined to form an optionally substituted heterocyclic ring. In certain embodiments, R.sup.4 and R.sup.5 are taken together to form a cyclic acetal (e.g., C(CH.sub.3).sub.2).

(75) As generally defined herein, each of R.sup.a and R.sup.b is independently hydrogen, halogen, optionally substituted C.sub.1-6 alkyl, OR.sup.e, or N(R.sup.e).sub.2. The carbon to which R.sup.a and R.sup.b is attached may be in either the (R) or (S) configuration. In certain embodiments, at least one of R.sup.a and R.sup.b is hydrogen. In certain embodiments, at least one of R.sup.a and R.sup.b is halogen. In some embodiments, at least one of R.sup.a and R.sup.b is F. In some embodiments, at least one of R.sup.a and R.sup.b is Cl, Br, or I. In certain embodiments, at least one of R.sup.a and R.sup.b is optionally substituted C.sub.1-6 alkyl. In certain embodiments, at least one of R.sup.a and R.sup.b is unsubstituted C.sub.1-6 alkyl. In certain embodiments, at least one of R.sup.a and R.sup.b is methyl. In certain embodiments, at least one of R.sup.a and R.sup.b is ethyl, propyl, or butyl.

(76) In certain embodiments, R.sup.a is hydrogen. In certain embodiments, R.sup.a is halogen. In some embodiments, R.sup.a is F. In some embodiments, at least one of R.sup.3 is Cl, Br, or I. In certain embodiments, R.sup.a is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.a is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.a is methyl. In certain embodiments, R.sup.a is ethyl, propyl, or butyl. In certain embodiments, R.sup.a is OR.sup.e, e.g., OH. In certain embodiments, R.sup.a is N(R.sup.e).sub.2. In certain embodiments, R.sup.a is NHR.sup.e, e.g., NH.sub.2.

(77) In certain embodiments, R.sup.b is hydrogen. In certain embodiments, R.sup.b is halogen. In some embodiments, R.sup.b is F. In some embodiments, at least one of R.sup.b is Cl, Br, or I. In certain embodiments, R.sup.b is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.b is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.b is methyl. In certain embodiments, R.sup.b is ethyl, propyl, or butyl. In certain embodiments, R.sup.b is OR.sup.e, e.g., OH. In certain embodiments, R.sup.b is N(R.sup.e).sub.2. In certain embodiments, R.sup.b is NHR.sup.e, e.g., NH.sub.2.

(78) In certain embodiments, both R.sup.a and R.sup.b are hydrogen. In certain embodiments, both R.sup.a and R.sup.b are halogen. In some embodiments, both R.sup.a and R.sup.b are F. In some embodiments, both R.sup.a and R.sup.b are Cl, Br, or I. In certain embodiments, both R.sup.a and R.sup.b are optionally substituted C.sub.1-6 alkyl. In certain embodiments, both R.sup.a and R.sup.b are unsubstituted C.sub.1-6 alkyl. In certain embodiments, both R.sup.a and R.sup.b are methyl. In certain embodiments, both R.sup.a and R.sup.b are ethyl, propyl, or butyl.

(79) As generally defined herein, X.sup.1 is a bond, O, (C(R.sup.d).sub.2).sub.q, or NR.sup.e. In certain embodiments, X.sup.1 is a bond. In certain embodiments, X.sup.1 is O. In certain embodiments, X.sup.1 is NH. In certain embodiments, X.sup.1 is NR.sup.e, and R.sup.e is optionally substituted C.sub.1-6 alkyl. In certain embodiments, X.sup.1 is NR.sup.e, and R.sup.e is unsubstituted C.sub.1-6 alkyl. In certain embodiments, X.sup.1 is NR.sup.e, and R.sup.e is methyl. In certain embodiments, X.sup.1 is NR.sup.e, and R.sup.e is ethyl, propyl, or butyl. In certain embodiments, X.sup.1 is NR.sup.e, and R.sup.e is optionally substituted acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In certain embodiments, X.sup.1 is NR.sup.e, and R.sup.e is a nitrogen protecting group. In certain embodiments, X.sup.1 is C(R.sup.d).sub.2. In certain embodiments, X.sup.1 is CH.sub.2. In certain embodiments, X.sup.1 is C(R.sup.d).sub.2, and both R.sup.d are halogen. In certain embodiments, X.sup.1 is CF.sub.2. In certain embodiments, X.sup.1 is (CH.sub.2).sub.q, wherein q is 1, 2, or 3. In some embodiments, X.sup.1 is (CH.sub.2).sub.q, wherein q is 1. In some embodiments, X.sup.1 is (CH.sub.2).sub.q, wherein q is 2 or 3.

(80) As generally defined herein, X.sup.2 is a bond. O, (C(R.sup.d).sub.2).sub.t, or NR.sup.e. As generally defined herein, X.sup.2 is a bond, O, (C(R.sup.d).sub.2).sub.q, or NR.sup.e. In certain embodiments, X.sup.2 is a bond. In certain embodiments, X.sup.2 is O. In certain embodiments, X.sup.2 is NH. In certain embodiments, X.sup.2 is NR.sup.e, and R.sup.e is optionally substituted C.sub.1-6 alkyl. In certain embodiments, X.sup.2 is NR.sup.e, and R.sup.e is unsubstituted C.sub.1-6 alkyl. In certain embodiments, X.sup.2 is NR.sup.e, and R.sup.e is methyl. In certain embodiments, X.sup.2 is NR.sup.e, and R.sup.e is ethyl, propyl, or butyl. In certain embodiments, X.sup.2 is NR.sup.e, and R.sup.e is optionally substituted acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e). C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In certain embodiments, X.sup.2 is NR.sup.e, and R.sup.e is a nitrogen protecting group. In certain embodiments, X.sup.2 is C(R.sup.d).sub.2. In certain embodiments, X.sup.2 is CH.sub.2. In certain embodiments, X.sup.2 is C(R.sup.d).sub.2, and both R.sup.d are halogen. In certain embodiments, X.sup.2 is CF.sub.2. In certain embodiments, X.sup.2 is (CH.sub.2).sub.t, wherein t is 1, 2, or 3. In some embodiments, X.sup.2 is (CH.sub.2).sub.t, wherein t is 1. In some embodiments, X.sup.2 is (CH.sub.2).sub.t, wherein t is 2 or 3.

(81) In some embodiments, t is 1. In certain embodiments, t is 2. In some embodiments, t is 3.

(82) In certain embodiments, both X.sup.1 and X.sup.2 are bonds. In certain embodiments, both X.sup.1 and X.sup.2 are O. In certain embodiments, both X.sup.1 and X.sup.2 are NR.sup.f. In certain embodiments, both X.sup.1 and X.sup.2 are NH. In certain embodiments, both X.sup.1 and X.sup.2 are C(R.sup.d).sub.2. In certain embodiments, X.sup.1 is (CH.sub.2).sub.q, and X.sup.2 is (CH.sub.2).sub.t, wherein each of q and t is independently 1, 2, or 3. In certain embodiments, both X.sup.1 and X.sup.2 are CH.sub.2. In certain embodiments, X.sup.1 is a bond, and X.sup.2 is O. In certain embodiments, X.sup.1 is a bond, and X.sup.2 is NR.sup.f. In certain embodiments, X.sup.1 is a bond, and X.sup.2 is NH. In certain embodiments, X.sup.1 is a bond, and X.sup.2 is C(R.sup.d).sub.2. In certain embodiments, X.sup.1 is a bond, and X.sup.2 is (CH.sub.2).sub.t. In certain embodiments, X.sup.1 is O, and X.sup.2 is a bond. In certain embodiments, X.sup.1 is O, and X.sup.1 is NR.sup.f. In certain embodiments, X.sup.1 is O, and X.sup.2 is NH. In certain embodiments, X.sup.1 is O, and X.sup.2 is C(R.sup.d).sub.2. In certain embodiments, X.sup.1 is O, and X.sup.2 is CH.sub.2. In certain embodiments, X.sup.1 is O, and X.sup.2 is (CH.sub.2).sub.t. In certain embodiments, X.sup.1 is NR.sup.f, and X.sup.2 is a bond. In certain embodiments, X.sup.1 is NH, and X.sup.2 is a bond. In certain embodiments, X.sup.1 is NR.sup.f, and X.sup.2 is O. In certain embodiments, X.sup.1 is NH, and X.sup.2 is O. In certain embodiments, X.sup.1 is NH, and X.sup.2 is C(R.sup.d).sub.2. In certain embodiments, X.sup.1 is NR.sup.f, and X.sup.2 is CH.sub.2. In certain embodiments, X.sup.1 is NR.sup.f, and X.sup.2 is (CH.sub.2).sub.t. In certain embodiments, X.sup.1 is NH, and X.sup.2 is C(R.sup.d).sub.2. In certain embodiments, X.sup.1 is NH, and X.sup.2 is CH.sub.2. In certain embodiments, X.sup.1 is NH, and X.sup.2 is (CH.sub.2).sub.1. In certain embodiments, X.sup.1 is C(R.sup.d).sub.2, and X.sup.2 is a bond. In certain embodiments, X.sup.1 is C(R.sup.d).sub.2, and X.sup.2 is NR.sup.f. In certain embodiments, X.sup.1C(R.sup.d).sub.2, and X.sup.2 is NH. In certain embodiments, X.sup.1 is C(R.sup.d) and X.sup.2 is O. In certain embodiments, X.sup.1 is C(R.sup.d).sub.2, and X.sup.2 is (CH.sub.2). In certain embodiments, X.sup.1 is CH.sub.2, and X.sup.2 is a bond. In certain embodiments, X.sup.1 is CH.sub.2, and X.sup.2 is NR.sup.f. In certain embodiments, X.sup.1CH.sub.2, and X.sup.2 is NH. In certain embodiments, X.sup.1 is CH.sub.2, and X.sup.2 is O. In certain embodiments, X.sup.1 is (CH.sub.2).sub.q, and X.sup.2 is a bond. In certain embodiments, X.sup.1 is (CH).sub.q, and X.sup.2 is O. In certain embodiments, X.sup.1 is (CH.sub.2).sub.q, and X.sup.1 is a NR.sup.f bond. In certain embodiments, X.sup.1 is (CH.sub.2).sub.q, and X.sup.2 is NH. In certain embodiments, X.sup.1 is (CH.sub.2).sub.q, and X.sup.2 is C(R.sup.d).sub.2.

(83) In certain embodiments, q is 1. In some embodiments, q is 2. In certain embodiments, q is 3.

(84) In certain embodiments, R.sup.6 is of the formula:

(85) ##STR00016##
In certain embodiments, R.sup.6 is of the formula:

(86) ##STR00017##
In some embodiments, R.sup.6 is of the formula:

(87) ##STR00018##
In certain embodiments, R.sup.6 is of the formula:

(88) ##STR00019##
In some embodiments, R.sup.6 is of the formula:

(89) ##STR00020##
In certain embodiments, R.sup.6 is of the formula:

(90) ##STR00021##
In some embodiments, R.sup.6 is of the formula:

(91) ##STR00022##
In certain embodiments, R.sup.6 is of the formula:

(92) ##STR00023##
In some embodiments, R.sup.6 is of the formula:

(93) ##STR00024##
In certain embodiments, R.sup.6 is of formula:

(94) ##STR00025##
In some embodiments, R.sup.6 is of formula:

(95) ##STR00026##
In certain embodiments, R.sup.6 is of formula:

(96) ##STR00027##
In certain embodiments, R.sup.6 is of formula:

(97) ##STR00028##
In some embodiments, R.sup.6 is of formula:

(98) ##STR00029##
In certain embodiments, R.sup.6 is of formula:

(99) ##STR00030##
In certain embodiments, R.sup.6 is of formula:

(100) ##STR00031##
In certain embodiments, R.sup.6 is of formula:

(101) ##STR00032##
In some embodiments, R.sup.6 is of formula:

(102) ##STR00033##
In certain embodiments, R.sup.6 is of formula:

(103) ##STR00034##

(104) In certain embodiments, Y is optionally substituted alkyl (e.g., optionally substituted C.sub.1-6 alkyl), optionally substituted alkenyl (e.g., optionally substituted C.sub.1-6 alkenyl), or optionally substituted alkynyl (e.g., optionally substituted C.sub.1-6 alkynyl). In certain embodiments, Y is optionally substituted heteroalkyl (e.g., optionally substituted C.sub.1-6 heteroalkyl), optionally substituted heteroalkenyl (e.g., optionally substituted CLU heteroalkenyl), or optionally substituted heteroalkynyl (e.g., optionally substituted C.sub.1-6 heteroalkynyl). In certain embodiments, Y is optionally substituted alkoxy (e.g., optionally substituted C.sub.1-6 alkoxy), optionally substituted amino, OR.sup.c, or N(R.sup.c).sub.2. In certain embodiments, Y is optionally substituted carbocyclyl (e.g., optionally substituted monocyclic 3- to 7-membered carbocyclyl). In certain embodiments, Y is optionally substituted aryl (e.g., optionally substituted 6- to 14-membered aryl, e.g., optionally substituted phenyl). In certain embodiments, Y is optionally substituted heteroaryl (e.g., optionally substituted monocyclic 5- or 6-membered heteroaryl, wherein 1, 2, 3, or 4 atoms in the heteroaryl ring system are independently oxygen, nitrogen, or sulfur). In certain embodiments, Y is optionally substituted heterocyclyl, optionally substituted 6-membered heteroaryl. In certain embodiments, Y is optionally substituted heterocyclyl, e.g., optionally substituted 3-6 membered heterocyclyl, optionally substituted 3-4 membered heterocyclyl, optionally substituted 4-5 membered heterocyclyl, or optionally substituted 5-6 membered heterocyclyl. In certain embodiments, Y is optionally substituted 6-membered heteroaryl, e.g., optionally substituted pyridyl.

(105) In some embodiments, Y is of formula:

(106) ##STR00035##
In certain embodiments, Y is of formula:

(107) ##STR00036##
In some embodiments, Y is of formula:

(108) ##STR00037##
In certain embodiments, Y is of formula:

(109) ##STR00038##

(110) In certain embodiments, Y is of formula:

(111) ##STR00039##
In some embodiments, Y is of formula:

(112) ##STR00040##
In certain embodiments, Y is of formula:

(113) ##STR00041##
In some embodiments, Y is of formula:

(114) ##STR00042##

(115) In certain embodiments, Y is of formula:

(116) ##STR00043##
In some embodiments, Y is of formula:

(117) ##STR00044##
In certain embodiments, Y is of formula:

(118) ##STR00045##

(119) In some embodiments, Y is of formula:

(120) ##STR00046##
In certain embodiments, Y is of formula:

(121) ##STR00047##
In certain embodiments, Y is of formula:

(122) ##STR00048##

(123) In certain embodiments, Y is of formula:

(124) ##STR00049##
In certain embodiments, Y is of formula:

(125) ##STR00050##
In certain embodiments, Y is of formula:

(126) ##STR00051##

(127) In some embodiments, Y is of formula:

(128) ##STR00052##
In certain embodiments, Y is of formula:

(129) ##STR00053##
In some embodiments, Y is of formula:

(130) ##STR00054##
In certain embodiments, Y is of formula:

(131) ##STR00055##

(132) In certain embodiments, Y is of formula:

(133) ##STR00056##
In certain embodiments, Y is of formula:

(134) ##STR00057##

(135) In certain embodiments, Z is optionally substituted alkyl (e.g., optionally substituted C.sub.1-6 alkyl), optionally substituted alkenyl (e.g., optionally substituted C.sub.1-6 alkenyl), or optionally substituted alkynyl (e.g., optionally substituted C.sub.1-6 alkynyl). In certain embodiments, Z is optionally substituted heteroalkyl (e.g., optionally substituted C.sub.1-6 heteroalkyl), optionally substituted heteroalkenyl (e.g., optionally substituted C.sub.1-6 heteroalkenyl), or optionally substituted heteroalkynyl (e.g., optionally substituted C.sub.1-6 heteroalkynyl). In certain embodiments, Z is optionally substituted alkoxy (e.g., optionally substituted C.sub.1-6 alkoxy), optionally substituted amino, OR.sup.e, or N(R.sup.e).sub.2. In certain embodiments, Z is optionally substituted carbocyclyl (e.g., optionally substituted monocyclic 3- to 7-membered carbocyclyl). In certain embodiments, Z is optionally substituted aryl (e.g., optionally substituted 6- to 14-membered aryl, e.g., optionally substituted phenyl). In certain embodiments, Z is optionally substituted heteroaryl (e.g., optionally substituted monocyclic 5- or 6-membered heteroaryl, wherein 1, 2, 3, or 4 atoms in the heteroaryl ring system are independently oxygen, nitrogen, or sulfur). In certain embodiments, Z is optionally substituted heterocyclyl, optionally substituted 6-membered heteroaryl. In certain embodiments, Z is optionally substituted heterocyclyl, e.g., optionally substituted 3-6 membered heterocyclyl, optionally substituted 3-4 membered heterocyclyl, optionally substituted 4-5 membered heterocyclyl, or optionally substituted 5-6 membered heterocyclyl. In certain embodiments, Z is optionally substituted 6-membered heteroaryl, e.g., optionally substituted pyridyl.

(136) In some embodiments, Z is of formula:

(137) ##STR00058##
In certain embodiments, Z is of formula:

(138) ##STR00059##
In some embodiments, Z is of formula:

(139) ##STR00060##
In certain embodiments, Z is of formula:

(140) ##STR00061##

(141) In certain embodiments, Z is of formula:

(142) ##STR00062##
In some embodiments, Z is of formula:

(143) ##STR00063##
In certain embodiments, Z is of formula:

(144) ##STR00064##
In some embodiments, Z is of formula:

(145) ##STR00065##

(146) In certain embodiments, Z is of formula:

(147) ##STR00066##
In some embodiments, Z is of formula:

(148) ##STR00067##
In certain embodiments, Z is of formula:

(149) ##STR00068##

(150) In some embodiments, Z is of formula:

(151) ##STR00069##
In certain embodiments, Z is of formula:

(152) ##STR00070##
In some embodiments, Z is of formula:

(153) ##STR00071##

(154) In certain embodiments, Z is of formula:

(155) ##STR00072##
In some embodiments, Z is of formula:

(156) ##STR00073##
In some embodiments, Z is of formula:

(157) ##STR00074##

(158) In certain embodiments, Z is of formula:

(159) ##STR00075##
In certain embodiments, Z is of formula:

(160) ##STR00076##
In some embodiments, Z is of formula:

(161) ##STR00077##
In certain embodiments, Z is of formula:

(162) ##STR00078##

(163) In some embodiments, Z is of formula:

(164) ##STR00079##
In certain embodiments, Z is of formula:

(165) ##STR00080##

(166) As generally defined herein, each of R.sup.6a and R.sup.6b is independently hydrogen, halogen, optionally substituted C.sub.1-6 alkyl, OR.sup.e, or N(R.sup.e).sub.2. The carbon to which R.sup.6a and R.sup.6b is attached may be in either the (R) or (S) configuration. In certain embodiments, at least one of R.sup.6a and R.sup.6b is hydrogen. In certain embodiments, at least one of R.sup.6a and R.sup.6b is halogen. In some embodiments, at least one of R.sup.6a and R.sup.6b is F. In some embodiments, at least one of R.sup.6a and R.sup.6b is Cl, Br, or I. In certain embodiments, at least one of R.sup.6a and R.sup.6b is optionally substituted C.sub.1-6 alkyl. In certain embodiments, at least one of R.sup.6a and R.sup.6b is unsubstituted C.sub.1-6 alkyl. In certain embodiments, at least one of R.sup.6a and R.sup.6b is methyl. In certain embodiments, at least one of R.sup.6a and R.sup.6b is ethyl, propyl, or butyl.

(167) In certain embodiments, both R.sup.6a and R.sup.6b are hydrogen. In certain embodiments, both R.sup.6a and R.sup.6b are halogen. In some embodiments, both R.sup.6a and R.sup.6b are F. In some embodiments, both R.sup.6a and R.sup.6b are Cl, Br, or I. In certain embodiments, both R.sup.6a and R.sup.6b are optionally substituted C.sub.1-6 alkyl. In certain embodiments, both R.sup.6a and R.sup.6b are unsubstituted C.sub.1-6 alkyl. In certain embodiments, both R.sup.6a and R.sup.6b are methyl. In certain embodiments, both R.sup.6a and R.sup.6b are ethyl, propyl, or butyl.

(168) In certain embodiments, R.sup.6a is hydrogen. In certain embodiments, R.sup.6a is halogen. In some embodiments, R.sup.6a is F. In some embodiments, at least one of R.sup.68 is Cl, Br, or I. In certain embodiments, R.sup.6a is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.6a is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.6a is methyl. In certain embodiments, R.sup.6a is ethyl, propyl, or butyl. In certain embodiments, R.sup.6a is OR.sup.e, e.g., OH. In certain embodiments, R.sup.6a is N(R.sup.e).sub.2. In certain embodiments, R.sup.6a is NHR.sup.e, e.g., NH.sub.2.

(169) In certain embodiments, R.sup.6b is hydrogen. In certain embodiments, R.sup.6b is halogen. In some embodiments, R.sup.6b is F. In some embodiments, at least one of R.sup.6b is Cl, Br, or I. In certain embodiments, R.sup.6b is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.6b is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.6b is methyl. In certain embodiments, R.sup.6b is ethyl, propyl, or butyl. In certain embodiments, R.sup.6b is OR.sup.e, e.g., OH. In certain embodiments, R.sup.6b is N(R.sup.e).sub.2. In certain embodiments, R.sup.6b is NHR.sup.e. e.g., NH.sub.2.

(170) In certain embodiments, R.sup.6c is hydrogen. In certain embodiments, R.sup.6c is halogen. In some embodiments, R.sup.6c is F. In some embodiments, at least one of R.sup.6c is Cl, Br, or I. In certain embodiments, R.sup.6c is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sup.6c is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.6c is methyl. In certain embodiments, R.sup.6c is ethyl, propyl, or butyl. In certain embodiments, R.sup.6c is OR.sup.e, e.g., OH. In certain embodiments, R.sup.6c is N(R.sup.e).sub.2. In certain embodiments, R.sup.6c is NHR.sup.e, e.g., NH.sub.2.

(171) In certain embodiments, there are no instances of R.sup.e. In certain embodiments, there is a single instance of R.sup.e. In certain embodiments, there are multiple instances of R.sup.e. In certain embodiments, each instance of R.sup.e is independently selected, wherein all instances of R.sup.e are different. In certain embodiments, each instance of R.sup.e is independently selected, wherein some instances of R.sup.e are different. In certain embodiments, all instances of R.sup.e are the same.

(172) In certain embodiments, at least one instance of R.sup.e is hydrogen. In certain embodiments, each instance of R.sup.e is hydrogen. In certain embodiments, R.sup.e is optionally substituted acyl (e.g., C(O)CH.sub.3, C(O)CH.sub.2CH.sub.3, C(O)CF.sub.3). In certain embodiments, at least one instance of R.sup.e is optionally substituted C.sub.1-C.sub.6 alkyl (e.g., optionally substituted methyl (e.g., trifluoromethyl), optionally substituted ethyl, optionally substituted propyl). In certain embodiments, R.sup.e is optionally substituted alkenyl (e.g., optionally substituted vinylene). In certain embodiments, R.sup.e is optionally substituted alkynyl (e.g., optionally substituted ethynyl). In certain embodiments, R.sup.e is optionally substituted C.sub.3-C.sub.6 carbocyclyl ring (e.g., cyclopropyl, cyclopentyl, cyclohexyl). In certain embodiments, R.sup.e is an optionally substituted C.sub.3-C.sub.6 heterocyclyl ring (e.g., piperidinyl, piperizinyl, morpholinyl, pyrrolidinyl). In certain embodiments, R.sup.e is an optionally substituted aryl (e.g., phenyl, naphthyl). In certain embodiments, R.sup.e is an optionally substituted heteroaryl (e.g., pyridinyl, pyrimidinyl, isoquinolinyl, thienopyrimidinyl). In certain embodiments, Reis a nitrogen protecting group, oxygen protecting group, or sulfur protecting group.

(173) In certain embodiments, two R.sup.e groups are joined to form an optionally substituted carbocyclic ring. In certain embodiments, two R.sup.e groups are joined to form an optionally substituted C.sub.3-C.sub.6 carbocyclyl ring (e.g., cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl). In certain embodiments, two R.sup.e groups are joined to form an optionally substituted aryl ring. In certain embodiments, two R.sup.e groups form an optionally substituted phenyl. In certain embodiments, two R.sup.e groups form an optionally substituted naphthalenyl.

(174) In certain embodiments, two R.sup.e groups are joined to form an optionally substituted heterocyclic ring. In certain embodiments, two R.sup.e groups are joined to form an optionally substituted C.sub.3-C.sub.6 heterocyclyl ring (e.g., piperidinyl, piperizinyl, morpholinyl, pyrrolidinyl). In certain embodiments, two R.sup.e groups are joined to form an optionally substituted heteroaryl ring. In certain embodiments, two R.sup.e groups form an optionally substituted pyridinyl. In certain embodiments, two R groups form an optionally substituted pyrimidinyl. In certain embodiments, two R.sup.e groups form an optionally substituted isoquinolinyl. In certain embodiments, two R.sup.e groups form an optionally substituted thienopyrimidinyl.

(175) In certain embodiments, custom character is a single bond (custom character). In some embodiments, custom character is a double bond (custom character).

(176) In certain embodiments, a compound is of the formula:

(177) ##STR00081##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(178) In some embodiments, a compound is of one of the following formulae:

(179) ##STR00082##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(180) In certain embodiments, a compound is of one of the following formulae:

(181) ##STR00083##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(182) In some aspects, the compound of Formula (I) is Formula (III):

(183) ##STR00084##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, wherein: each occurrence of R.sup.7 is independently is halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, NO.sub.2, CN, OR.sup.e, or N(R.sup.e).sub.2, or two R.sup.7 are joined to form an optionally substituted aryl or optionally substituted heteroaryl ring; and n is 0, 1, 2, 3, 4, or 5.

(184) In certain embodiments, there are no instances of R.sup.7. In certain embodiments, there is a single instance of R.sup.7. In certain embodiments, there are multiple instances of R.sup.7. In certain embodiments, each instance of R.sup.1 is independently selected, and all instances of R.sup.7 are different. In certain embodiments, each instance of R.sup.7 is independently selected, and some instances of R.sup.1 are different. In certain embodiments, all instances of R.sup.7 are the same.

(185) In some embodiments, R.sup.7 is Cl, Br, or I. In some embodiments, R.sup.1 is F. In certain embodiments, R.sup.7 is optionally substituted alkyl. In certain embodiments, R.sup.7 is unsubstituted C.sub.1-6 alkyl. In certain embodiments, R.sup.7 is methyl. In certain embodiments, R.sup.7 is ethyl, propyl, or butyl. In certain embodiments, R.sup.7 is CF.sub.3. In certain embodiments, R.sup.1 is optionally substituted alkenyl, e.g., optionally substituted C.sub.2-6 alkenyl. In certain embodiments, R.sup.7 is vinyl, allyl, or prenyl. In certain embodiments, R.sup.7 is optionally substituted alkynyl, e.g., C.sub.2-6 alkynyl.

(186) In certain embodiments, R.sup.7 is optionally substituted carbocyclyl, e.g., optionally substituted C.sub.3-6 carbocyclyl, optionally substituted C.sub.3-4 carbocyclyl, optionally substituted C.sub.4-5 carbocyclyl, or optionally substituted C.sub.5-6 carbocyclyl. In certain embodiments R.sup.7 is optionally substituted heterocyclyl, e.g., optionally substituted 3-6 membered heterocyclyl, optionally substituted 3-4 membered heterocyclyl, optionally substituted 4-5 membered heterocyclyl, or optionally substituted 5-6 membered heterocyclyl.

(187) In certain embodiments, R.sup.7 is optionally substituted aryl, e.g., optionally substituted phenyl. In certain embodiments, R.sup.7 is optionally substituted heteroaryl, e.g., optionally substituted 5-6 membered heteroaryl, or optionally substituted 9-10 membered bicyclic heteroaryl. In certain embodiments, R.sup.7 is optionally substituted aralkyl, e.g., optionally substituted benzyl. In certain embodiments, R.sup.7 is optionally substituted heteroaralkyl, e.g., methyl substituted with a 5-6-membered heteroaryl ring.

(188) In certain embodiments, R.sup.7 is NO.sub.2. In certain embodiments, R.sup.7 is CN. In certain embodiments, R.sup.7 is OR (e.g., OH, OMe, O(C.sub.1-6 alkyl)). In certain embodiments, R.sup.7 is OR.sup.e, and R.sup.e is an oxygen protecting group. In certain embodiments, R.sup.7 is N(R.sup.e).sub.2 (e.g., NH.sub.2, NMe.sub.2, or NH(C.sub.1-6 alkyl)). In certain embodiments, R.sup.7 is N(R.sup.e, and R.sup.e is a nitrogen protecting group. In certain embodiments, R.sup.7 is optionally substituted acyl (e.g., C(O)(R.sup.e), C(O)O(R.sup.e), C(O)NH(R.sup.e), C(O)N(R.sup.e).sub.2). In some embodiments, R.sup.7 is C(O)OMe. In some embodiments, R.sup.7 is C(O)OH.

(189) In certain embodiments, n is 0. In some embodiments, n is 1. In certain embodiments, n is 2. In some embodiments, n is 3, 4, or 5.

(190) In some embodiments, a compound is of one of the following formulae:

(191) ##STR00085##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(192) In certain embodiments, a compound is of one of the following formulae:

(193) ##STR00086##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(194) In some aspects, the compound of Formula (I) is of Formula (IV):

(195) ##STR00087##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, wherein: X.sup.1 is a bond, O, C, (CH.sub.2).sub.p, or N; each occurrence of R.sup.8 is independently hydrogen, optionally substituted alkyl, optionally, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted acyl, oxygen protecting group, or a nitrogen protecting group, or two R.sup.8 are joined to form an optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl ring; and m is 1, 2, or 3.

(196) In certain embodiments, X.sup.3 is O. In some embodiments, X.sup.1 is C. In certain embodiments, X.sup.3 is N. In some embodiments, X.sup.3 is (CH.sub.2).sub.p. In certain embodiments, X.sup.3 is CH.sub.2 where p is 1. In some embodiments, X.sup.1 is (CH.sub.2).sub.2 where p is 2. In some embodiments, X.sup.3 is (CH.sub.2).sub.3 where p is 3.

(197) In some embodiments, p is 1, In certain embodiments, p is 2. In certain embodiments, p is 3.

(198) In certain embodiments, there are no instances of R.sup.8. In certain embodiments, there is a single instance of R.sup.8. In certain embodiments, there are multiple instances of R.sup.8. In certain embodiments, each instance of R.sup.8 is independently selected, wherein all instances of R.sup.8 are different. In certain embodiments, each instance of R.sup.8 is independently selected, wherein some instances of R.sup.8 are different. In certain embodiments, all instances of R.sup.8 are the same.

(199) In certain embodiments, at least one instance of R.sup.8 is hydrogen. In certain embodiments, each instance of R.sup.8 is hydrogen. In certain embodiments, R.sup.8 is optionally substituted acyl (e.g., C(O)CH.sub.3, C(O)CH.sub.2CH.sub.3, C(O)CF.sub.3). In certain embodiments, at least one instance of R.sup.8 is optionally substituted C.sub.1-C.sub.6 alkyl (e.g., optionally substituted methyl (e.g., trifluoromethyl), optionally substituted ethyl, optionally substituted propyl). In certain embodiments, R.sup.8 is optionally substituted alkenyl (e.g., optionally substituted vinylene). In certain embodiments, R.sup.8 is optionally substituted alkynyl (e.g., optionally substituted ethynyl). In certain embodiments, R.sup.8 is optionally substituted C.sub.3-C.sub.6 carbocyclyl ring (e.g., cyclopropyl, cyclopentyl, cyclohexyl). In certain embodiments, R.sup.8 is an optionally substituted C.sub.3-C.sub.6 heterocyclyl ring (e.g., piperidinyl, piperizinyl, morpholinyl, pyrrolidinyl). In certain embodiments, R.sup.8 is an optionally substituted aryl (e.g., phenyl, naphthyl). In certain embodiments, R.sup.8 is an optionally substituted heteroaryl (e.g., pyridinyl, pyrimidinyl, isoquinolinyl, thienopyrimidinyl). In certain embodiments, R.sup.8 is a nitrogen protecting group, oxygen protecting group, or sulfur protecting group.

(200) In certain embodiments, two R.sup.8 groups are joined to form an optionally substituted carbocyclyl. In certain embodiments, two R.sup.8 groups are joined to form an optionally substituted C.sub.3-C.sub.6 carbocyclyl (e.g., cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl). In certain embodiments, two R.sup.8 groups are joined to form an optionally substituted heterocyclyl. In certain embodiments, two R.sup.8 groups are joined to form an optionally substituted C.sub.3-C.sub.6 heterocyclyl (e.g., piperidinyl, piperizinyl, morpholinyl, pyrrolidinyl). In certain embodiments, two R.sup.8 groups are joined to form an optionally substituted aryl. In certain embodiments, two R.sup.8 groups are joined to form an optionally substituted aryl (e.g., phenyl, naphthyl). In certain embodiments, two R.sup.8 groups are joined to form an optionally substituted heteroaryl ring. In certain embodiments, two R.sup.8 groups form an optionally substituted pyridinyl. In certain embodiments, two R.sup.8 groups form an optionally substituted pyrimidinyl. In certain embodiments, two R.sup.8 groups form an optionally substituted isoquinolinyl. In certain embodiments, two R.sup.8 groups form an optionally substituted thienopyrimidinyl.

(201) In certain embodiments, m is 1. In some embodiments, m is 2. In certain embodiments m is 3.

(202) In some embodiments, a compound is of one of the following formulae:

(203) ##STR00088##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(204) In some embodiments, a compound is of one of the following formulae:

(205) ##STR00089##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(206) In some embodiments, a compound is of one of the following formulae:

(207) ##STR00090##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(208) In some embodiments, a compound is of one of the following formulae:

(209) ##STR00091##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(210) In some embodiments, a compound is of one of the following formulae:

(211) ##STR00092##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(212) In some embodiments, a compound is of one of the following formulae:

(213) ##STR00093##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(214) In some embodiments, a compound is of the formula:

(215) ##STR00094##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(216) In some embodiments, a compound is one of the following formulae:

(217) ##STR00095##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(218) In certain embodiments, a compound is of the formula:

(219) ##STR00096##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(220) In certain embodiments, a compound is one of the following formulae:

(221) ##STR00097## ##STR00098##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(222) In certain embodiments, the compound of Formula (I) is:

(223) ##STR00099## ##STR00100##
or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof.

(224) In certain embodiments, a compound of Formula (I) may contain the moieties expressed in Tables A, B, C, and D below. Non-limiting examples of moieties appear in Tables A to D.

(225) TABLE-US-00001 TABLE A Exemplary Purine and Heterocycle Moieties 01embedded image 02embedded image 03embedded image 04embedded image 05embedded image 06embedded image 07embedded image 08embedded image 09embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image

(226) TABLE-US-00002 TABLE B Exemplary Ribose and Heterocyclic Moieties embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 00embedded image 01embedded image 02embedded image 03embedded image 04embedded image 05embedded image 06embedded image 07embedded image 08embedded image 09embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image

(227) TABLE-US-00003 TABLE C Exemplary Linker Moieties embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image

(228) TABLE-US-00004 TABLE D Exemplary R.sup.6 Moieties embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 00embedded image 01embedded image 02embedded image 03embedded image 04embedded image 05embedded image 06embedded image 07embedded image 08embedded image 09embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image
Pharmaceutical Compositions and Administration

(229) The present disclosure also provides pharmaceutical compositions comprising a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable or tautomer thereof, and optionally a pharmaceutically acceptable excipient. In some embodiments, the pharmaceutical compositions comprising a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, or prodrug thereof, and optionally a pharmaceutically acceptable excipient. In certain embodiments, the present disclosure also provides pharmaceutical compositions comprising a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable or tautomer thereof, and optionally a pharmaceutically acceptable excipient, and further comprising an additional pharmaceutical agent (e.g., antibiotic).

(230) In certain embodiments, the pharmaceutical composition described herein comprises a compound of Formula (I), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, and a pharmaceutically acceptable excipient. In certain embodiments, the pharmaceutical composition described herein comprises a compound of Formula (I), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, a pharmaceutically acceptable excipient, and a pharmaceutical agent. In certain embodiments, the composition is useful for and/or preventing a disease. In certain embodiments, the composition useful for treating a bacterial infection (e.g. Mycobacterium tuberculosis infection). In certain embodiments, the composition useful for treating tuberculosis.

(231) In certain embodiments, the compound described herein is provided in an effective amount in the pharmaceutical composition. In certain embodiments, the effective amount is a therapeutically effective amount. In certain embodiments, the effective amount is a prophylactically effective amount. In certain embodiments, the effective amount is an amount effective for and/or preventing an infectious disease (e.g., bacterial infection (e.g., Mycobacterium tuberculosis infection)) in a subject in need thereof. In certain embodiments, the effective amount is an amount effective for preventing an infectious disease (e.g., bacterial infection (e.g., Mycobacterium tuberculosis infection)) in a subject in need thereof. In certain embodiments, the effective amount is an amount effective for reducing the risk of developing an infectious disease (e.g., bacterial infection (e.g., Mycobacterium tuberculosis infection)) in a subject in need thereof.

(232) In certain embodiments, the effective amount is an amount effective for inhibiting siderophore (e.g., mycobactin, yersiniabactin, pyochelin, enterobactin, bacillibactin, vibriobactin, petrobactin) biosynthesis in an infection in a subject. In certain embodiments, the effective amount is an amount effective for inhibiting MBT biosynthesis in an infection in a subject. In certain embodiments, the effective amount is an amount effective for inhibiting MbtA.sub.tb in an infection in a subject. In certain embodiments, the effective amount is an amount effective for inhibiting MbtA.sub.tb in an infectious microorganism. In certain embodiments, the effective amount is an amount effective for inhibiting PQS biosynthesis (e.g., inhibiting anthranilate-CoA synthetase (PqsA)) in an infection in a subject. In certain embodiments, the effective amount is an amount effective for inhibiting the biosynthesis of virulence factors (e.g., pyocyanin) in an infection in a subject. In certain embodiments, the effective amount is an amount effective for inhibiting menaquinone biosynthesis (e.g., inhibiting anthranilate-CoA ligase (PqsA)) in an infectious microorganism. In certain embodiments, the effective amount is an amount effective for inhibiting the biosynthesis of virulence factors (e.g., pyocyanin) in an infectious microorganism. In certain embodiments, the effective amount is an amount effective for inhibiting yersiniabactin biosynthesis (e.g., inhibiting YbtE) in an infection in a subject. In certain embodiments, the effective amount is an amount effective for inhibiting the biosynthesis of virulence factors (e.g., yersiniabactin) in an infection in a subject. In certain embodiments, the effective amount is an amount effective for inhibiting yersiniabactin biosynthesis (e.g., inhibiting YbtE) in an infectious microorganism. In certain embodiments, the effective amount is an amount effective for inhibiting the biosynthesis of virulence factors (e.g., yersiniabactin) in an infectious microorganism.

(233) In certain embodiments, the subject is an animal. The animal may be of either sex and may be at any stage of development. In certain embodiments, the subject described herein is a human. In certain embodiments, the subject is a non-human animal. In certain embodiments, the subject is a mammal. In certain embodiments, the subject is a non-human mammal. In certain embodiments, the subject is a domesticated animal, such as a dog, cat, cow, pig, horse, sheep, or goat. In certain embodiments, the subject is a companion animal, such as a dog or cat. In certain embodiments, the subject is a livestock animal, such as a cow, pig, horse, sheep, or goat. In certain embodiments, the subject is a zoo animal. In another embodiment, the subject is a research animal, such as a rodent (e.g., mouse, rat), dog, pig, or non-human primate. In certain embodiments, the animal is a genetically engineered animal. In certain embodiments, the animal is a transgenic animal (e.g., transgenic mice and transgenic pigs). In certain embodiments, the subject is a fish or reptile.

(234) In certain embodiments, the effective amount is an amount effective for inhibiting siderophore (e.g., mycobactin, yersiniabactin, pyochelin, enterobactin, bacillibactin, vibriobactin, petrobactin) biosynthesis by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%. In certain embodiments, the effective amount is an amount effective for inhibiting siderophore (e.g., mycobactin, yersiniabactin, pyochelin, enterobactin, bacillibactin, vibriobactin, petrobactin) biosynthesis by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80%, not more than 90%, not more than 95%, or not more than 98%. In certain embodiments, the effective amount is an amount effective for inhibiting MBT biosynthesis by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%. In certain embodiments, the effective amount is an amount effective for inhibiting MBT biosynthesis by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80%, not more than 90%, not more than 95%, or not more than 98%. In certain embodiments, the effective amount is an amount effective for inhibiting MbtA.sub.tb by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%. In certain embodiments, the effective amount is an amount effective for inhibiting MbtA.sub.tb by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80% not more than 90%, not more than 95%, or not more than 98%. In certain embodiments, the effective amount is an amount effective for inhibiting PQS biosynthesis by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%. In certain embodiments, the effective amount is an amount effective for inhibiting menaquinone biosynthesis by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80%, not more than 90%, not more than 95%, or not more than 98%. In certain embodiments, the effective amount is an amount effective for inhibiting an adenylate-forming enzyme (e.g., an acyl-CoA synthetase) by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%. In certain embodiments, the effective amount is an amount effective for inhibiting adenylate-forming enzyme (e.g., an acyl-CoA synthetase) by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80%, not more than 90%, not more than 95%, or not more than 98%. In certain embodiments, the effective amount is an amount effective for inhibiting anthranilate-CoA synthetase (PqsA) by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%. In certain embodiments, the effective amount is an amount effective for inhibiting anthranilate-CoA synthetase (PqsA) by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80%, not more than 90%, not more than 95%, or not more than 98%. In certain embodiments, the effective amount is an amount effective for inhibiting YbtE by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%. In certain embodiments, the effective amount is an amount effective for inhibiting YbtE by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80%, not more than 90%, not more than 95%, or not more than 98%. In certain embodiments, the effective amount is an amount effective for a range of inhibition between a percentage described in this paragraph and another percentage described in this paragraph, inclusive.

(235) Pharmaceutical compositions described herein can be prepared by any method known in the art of pharmacology. In general, such preparatory methods include bringing the compound described herein (i.e., the active ingredient) into association with a carrier or excipient, and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping, and/or packaging the product into a desired single- or multi-dose unit.

(236) Pharmaceutical compositions can be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. A unit dose is a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage, such as one-half or one-third of such a dosage.

(237) Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition described herein will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered. The composition may comprise between 0.1% and 100% (w/w) active ingredient.

(238) Pharmaceutically acceptable excipients used in the manufacture of provided pharmaceutical compositions include inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and perfuming agents may also be present in the composition.

(239) Exemplary diluents include calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, and mixtures thereof.

(240) Exemplary granulating and/or dispersing agents include potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose, and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, and mixtures thereof.

(241) Exemplary surface active agents and/or emulsifiers include natural emulsifiers (e.g., acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g., bentonite (aluminum silicate) and Veegum (magnesium aluminum silicate)), long chain amino acid derivatives, high molecular weight alcohols (e.g., stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g., carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g., carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g., polyoxyethylene sorbitan monolaurate (Tween 20), polyoxyethylene sorbitan (Tween 60), polyoxyethylene sorbitan monooleate (Tween 80), sorbitan monopalmitate (Span 40), sorbitan monostearate (Span 60), sorbitan tristearate (Span 65), glyceryl monooleate, sorbitan monooleate (Span 80), polyoxyethylene esters (e.g., polyoxyethylene monostearate (Myrj 45), polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and Solutol), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g., Cremophor), polyoxyethylene ethers, (e.g., polyoxyethylene lauryl ether (Brij 30)), poly(vinyl-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic F-68, poloxamer P-188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, and/or mixtures thereof.

(242) Exemplary binding agents include starch (e.g., cornstarch and starch paste), gelatin, sugars (e.g., sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc.), natural and synthetic gums (e.g., acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum), and larch arabogalactan), alginates, polyethylene oxide, polyethylene glycol, inorganic calcium salts, silicic acid, polymethacrylates, waxes, water, alcohol, and/or mixtures thereof.

(243) Exemplary preservatives include antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, antiprotozoan preservatives, alcohol preservatives, acidic preservatives, and other preservatives. In certain embodiments, the preservative is an antioxidant. In other embodiments, the preservative is a chelating agent.

(244) Exemplary antioxidants include alpha tocopherol, ascorbic acid, acorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and sodium sulfite.

(245) Exemplary chelating agents include ethylenediaminetetraacetic acid (EDTA) and salts and hydrates thereof (e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like), citric acid and salts and hydrates thereof (e.g., citric acid monohydrate), fumaric acid and salts and hydrates thereof, malic acid and salts and hydrates thereof, phosphoric acid and salts and hydrates thereof, and tartaric acid and salts and hydrates thereof. Exemplary antimicrobial preservatives include benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and thimerosal.

(246) Exemplary antifungal preservatives include butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and sorbic acid.

(247) Exemplary alcohol preservatives include ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.

(248) Exemplary acidic preservatives include vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid.

(249) Other preservatives include tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, Glydant Plus, Phenonip, methylparaben. Germall 115, Germaben II, Neolone, Kathon, and Euxyl.

(250) Exemplary buffering agents include citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water, isotonic saline, Ringer's solution, ethyl alcohol, and mixtures thereof.

(251) Exemplary lubricating agents include magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, and mixtures thereof.

(252) Exemplary natural oils include almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauba, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury, sea buckthorn, sesame, shea butter, silicone, soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut, and wheat germ oils. Exemplary synthetic oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and mixtures thereof.

(253) Liquid dosage forms for oral and parenteral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. In addition to the active ingredients, the liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizng agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (e.g., cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. Besides inert diluents, the oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents. In certain embodiments for parenteral administration, the conjugates described herein are mixed with solubilizing agents such as Cremophor, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and mixtures thereof.

(254) Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions can be formulated according to the known art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation can be a sterile injectable solution, suspension, or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that can be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or di-glycerides. In addition, fatty acids such as oleic acid are used in the preparation of injectables.

(255) The injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.

(256) In order to prolong the effect of a drug, it is often desirable to slow the absorption of the drug from subcutaneous or intramuscular injection. This can be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution, which, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered drug form may be accomplished by dissolving or suspending the drug in an oil vehicle.

(257) Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules. In such solid dosage forms, the active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or (a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, (b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, (c) humectants such as glycerol, (d) disintegrating agents such as agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, (e) solution retarding agents such as paraffin. (f) absorption accelerators such as quaternary ammonium compounds, (g) wetting agents such as, for example, cetyl alcohol and glycerol monostearate, (h) absorbents such as kaolin and bentonite clay, and (i) lubricants such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof. In the case of capsules, tablets, and pills, the dosage form may include a buffering agent.

(258) Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the art of pharmacology. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of encapsulating compositions which can be used include polymeric substances and waxes. Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.

(259) The active ingredient can be in a micro-encapsulated form with one or more excipients as noted above. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings, release controlling coatings, and other coatings well known in the pharmaceutical formulating art. In such solid dosage forms the active ingredient can be admixed with at least one inert diluent such as sucrose, lactose, or starch. Such dosage forms may comprise, as is normal practice, additional substances other than inert diluents, e.g., tableting lubricants and other tableting aids such a magnesium stearate and microcrystalline cellulose. In the case of capsules, tablets and pills, the dosage forms may comprise buffering agents. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of encapsulating agents which can be used include polymeric substances and waxes.

(260) Dosage forms for topical and/or transdermal administration of a compound described herein may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants, and/or patches. Generally, the active ingredient is admixed under sterile conditions with a pharmaceutically acceptable carrier or excipient and/or any needed preservatives and/or buffers as can be required. Additionally, the present disclosure contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of an active ingredient to the body. Such dosage forms can be prepared, for example, by dissolving and/or dispensing the active ingredient in the proper medium. Alternatively or additionally, the rate can be controlled by either providing a rate controlling membrane and/or by dispersing the active ingredient in a polymer matrix and/or gel.

(261) Formulations suitable for topical administration include, but are not limited to, liquid and/or semi-liquid preparations such as liniments, lotions, oil-in-water and/or water-in-oil emulsions such as creams, ointments, and/or pastes, and/or solutions and/or suspensions. Topically administrable formulations may, for example, comprise from about 1% to about 10% (w/w) active ingredient, although the concentration of the active ingredient can be as high as the solubility limit of the active ingredient in the solvent. Formulations for topical administration may further comprise one or more of the additional ingredients described herein.

(262) A pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation suitable for pulmonary administration via the buccal cavity. Such a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 to about 7 nanometers, or from about 1 to about 6 nanometers. Such compositions are conveniently in the form of dry powders for administration using a device comprising a dry powder reservoir to which a stream of propellant can be directed to disperse the powder and/or using a self-propelling solvent/powder dispensing container such as a device comprising the active ingredient dissolved and/or suspended in a low-boiling propellant in a sealed container. Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nanometers and at least 95% of the particles by number have a diameter less than 7 nanometers. Alternatively, at least 95% of the particles by weight have a diameter greater than 1 nanometer and at least 90% of the particles by number have a diameter less than 6 nanometers. Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form.

(263) Low boiling propellants generally include liquid propellants having a boiling point of below 65 F. at atmospheric pressure. Generally the propellant may constitute 50 to 99.9% (w/w) of the composition, and the active ingredient may constitute 0.1 to 20% (w/w) of the composition. The propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient).

(264) Pharmaceutical compositions described herein formulated for pulmonary delivery may provide the active ingredient in the form of droplets of a solution and/or suspension. Such formulations can be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any nebulization and/or atomization device. Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate. The droplets provided by this route of administration may have an average diameter in the range from about 0.1 to about 200 nanometers.

(265) Formulations described herein as being useful for pulmonary delivery are useful for intranasal delivery of a pharmaceutical composition described herein. Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 to 500 micrometers. Such a formulation is administered by rapid inhalation through the nasal passage from a container of the powder held close to the nares.

(266) Formulations for nasal administration may, for example, comprise from about as little as 0.1% (w/w) to as much as 100% (w/w) of the active ingredient, and may comprise one or more of the additional ingredients described herein. A pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation for buccal administration. Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may contain, for example, 0.1 to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein. Alternately, formulations for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising the active ingredient. Such powdered, aerosolized, and/or aerosolized formulations, when dispersed, may have an average particle and/or droplet size in the range from about 0.1 to about 200 nanometers, and may further comprise one or more of the additional ingredients described herein.

(267) A pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation for ophthalmic administration. Such formulations may, for example, be in the form of eye drops including, for example, a 0.1-1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid carrier or excipient. Such drops may further comprise buffering agents, salts, and/or one or more other of the additional ingredients described herein. Other ophthalmically-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form and/or in a liposomal preparation. Ear drops and/or eye drops are also contemplated as being within the scope of this disclosure.

(268) Although the descriptions of pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with ordinary experimentation.

(269) Compounds provided herein are typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions described herein will be decided by a physician within the scope of sound medical judgment. The specific therapeutically effective dose level for any particular subject or organism will depend upon a variety of factors including the infectious disease being treated and/or prevented, as well as the severity of the disorder; the activity of the specific active ingredient employed; the specific composition employed; the age, body weight, general health, sex, and diet of the subject; the time of administration, route of administration, and rate of excretion of the specific active ingredient employed: the duration of the treatment and/or prevention; drugs used in combination or coincidental with the specific active ingredient employed; and like factors well known in the medical arts.

(270) The compounds and compositions provided herein can be administered by any route, including enteral (e.g., oral), parenteral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, subcutaneous, intraventricular, transdermal, intradermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, and/or drops), mucosal, nasal, bucal, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol. Specifically contemplated routes are oral administration, intravenous administration (e.g., systemic intravenous injection), regional administration via blood and/or lymph supply, and/or direct administration to an affected site. In general, the most appropriate route of administration will depend upon a variety of factors including the nature of the agent (e.g., its stability in the environment of the gastrointestinal tract), and/or the condition of the subject (e.g., whether the subject is able to tolerate oral administration). In certain embodiments, the compound or pharmaceutical composition described herein is suitable for topical administration to the eye of a subject.

(271) The exact amount of a compound required to achieve an effective amount will vary from subject to subject, depending, for example, on species, age, and general condition of a subject, severity of the side effects or disorder, identity of the particular compound, mode of administration, and the like. An effective amount may be included in a single dose (e.g., single oral dose) or multiple doses (e.g., multiple oral doses). In certain embodiments, when multiple doses are administered to a subject or applied to a tissue or cell, any two doses of the multiple doses include different or substantially the same amounts of a compound described herein. In certain embodiments, when multiple doses are administered to a subject or applied to a tissue or cell, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is three doses a day, two doses a day, one dose a day, one dose every other day, one dose every third day, one dose every week, one dose every two weeks, one dose every three weeks, or one dose every four weeks. In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is one dose per day. In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is two doses per day. In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is three doses per day. In certain embodiments, when multiple doses are administered to a subject or applied to a tissue or cell, the duration between the first dose and last dose of the multiple doses is one day, two days, four days, one week, two weeks, three weeks, one month, two months, three months, four months, six months, nine months, one year, two years, three years, four years, five years, seven years, ten years, fifteen years, twenty years, or the lifetime of the subject, tissue, or cell. In certain embodiments, the duration between the first dose and last dose of the multiple doses is three months, six months, or one year. In certain embodiments, the duration between the first dose and last dose of the multiple doses is the lifetime of the subject, tissue, or cell.

(272) In certain embodiments, a dose (e.g., a single dose, or any dose of multiple doses) described herein includes independently between 0.1 g and 1 g, between 0.001 mg and 0.01 mg, between 0.01 mg and 0.1 mg, between 0.1 mg and 1 mg, between 1 mg and 3 mg, between 3 mg and 10 mg, between 10 mg and 30 mg, between 30 mg and 100 mg, between 100 mg and 300 mg, between 300 mg and 1,000 mg, or between 1 g and 10 g, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 1 mg and 3 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 3 mg and 10 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 10 mg and 30 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 30 mg and 100 mg, inclusive, of a compound described herein.

(273) Dose ranges as described herein provide guidance for the administration of provided pharmaceutical compositions to an adult. The amount to be administered to, for example, a child or an adolescent can be determined by a medical practitioner or person skilled in the art and can be lower or the same as that administered to an adult.

(274) A compound or composition, as described herein, can be administered in combination with one or more additional pharmaceutical agents (e.g., therapeutically and/or prophylactically active agents). The compounds or compositions can be administered in combination with additional pharmaceutical agents that improve their activity (e.g., activity (e.g., potency and/or efficacy) in treating an infectious disease in a subject in need thereof (e.g., tuberculosis), in preventing an infectious disease in a subject in need thereof, and/or in reducing the risk to develop an infectious disease in a subject in need thereof), improve bioavailability, improve safety, reduce drug resistance, reduce and/or modify metabolism, inhibit excretion, and/or modify distribution in a subject or cell. It will also be appreciated that the therapy employed may achieve a desired effect for the same disorder, and/or it may achieve different effects. In certain embodiments, a pharmaceutical composition described herein including a compound described herein and an additional pharmaceutical agent shows a synergistic effect that is absent in a pharmaceutical composition including one of the compound and the additional pharmaceutical agent, but not both.

(275) The compound or composition can be administered concurrently with, prior to, or subsequent to one or more additional pharmaceutical agents, which may be useful as, e.g., combination therapies. Pharmaceutical agents include therapeutically active agents. Pharmaceutical agents also include prophylactically active agents. Pharmaceutical agents include small organic molecules such as drug compounds (e.g., compounds approved for human or veterinary use by the U.S. Food and Drug Administration as provided in the Code of Federal Regulations (CFR)), peptides, proteins, carbohydrates, monosaccharides, oligosaccharides, polysaccharides, nucleoproteins, mucoproteins, lipoproteins, synthetic polypeptides or proteins, small molecules linked to proteins, glycoproteins, steroids, nucleic acids, DNAs, RNAs, nucleotides, nucleosides, oligonucleotides, antisense oligonucleotides, lipids, hormones, vitamins, and cells. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent useful for treating and/or preventing a disease (e.g., infectious disease (e.g., tuberculosis), proliferative disease, hematological disease, or painful condition). Each additional pharmaceutical agent may be administered at a dose and/or on a time schedule determined for that pharmaceutical agent. The additional pharmaceutical agents may also be administered together with each other and/or with the compound or composition described herein in a single dose or administered separately in different doses. The particular combination to employ in a regimen will take into account compatibility of the compound described herein with the additional pharmaceutical agent(s) and/or the desired therapeutic and/or prophylactic effect to be achieved. In general, it is expected that the additional pharmaceutical agent(s) in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.

(276) The additional pharmaceutical agents include, but are not limited to, anti-diabetic agents, anti-proliferative agents, anti-cancer agents, anti-angiogenesis agents, anti-inflammatory agents, anti-bacterial agents, anti-viral agents, cardiovascular agents, and pain-relieving agents.

(277) In certain embodiments, the additional pharmaceutical agent inhibits siderophore biosynthesis (e.g., mycobactin (M. tuberculosis), yersiniabactin (Yersinia pestis and E. coli), pyochelin (P. aeruginosa), enterobactin (E. coli), bacillibactin (Bacillus subtilis, Bacillus anthraces), vibriobactin (Vibrio cholerae), petrobactin (B. anthracis)). In certain embodiments, the additional pharmaceutical agent inhibits the biosynthesis of MBT. In certain embodiments, the additional pharmaceutical agent is a binder or inhibitor of MbtA.sub.tb. In certain embodiments, the additional pharmaceutical agent is a binder or inhibitor of an AMP-producing synthetase. In certain embodiments, the additional pharmaceutical agent is a binder or inhibitor of anthranilate-CoA synthetase (PqsA). In certain embodiments, the additional pharmaceutical agent is a binder or inhibitor of YbtE. In certain embodiments, the additional pharmaceutical agent inhibits cellular respiration. In certain embodiments, the additional pharmaceutical agent inhibits biosynthesis of a virulence factor. In certain embodiments, the additional pharmaceutical agent inhibits biosynthesis of pyocyanin. In some embodiments, the additional pharmaceutical agent inhibits biosynthesis of yersiniabactin. In certain embodiments, the additional pharmaceutical agent inhibits biosynthesis of PQS, PqsE, lectin, HCN, yersiniabactin, or a rhamnolipid. In certain embodiments, the additional pharmaceutical agent inhibits protein synthesis. In certain embodiments, the additional pharmaceutical agent down-regulates expression of PqsABCDE, PqsR, PqsH, or PhnAB. In certain embodiments, the additional pharmaceutical agent binds a ribosome. In certain embodiments, the additional pharmaceutical agent is an antibiotic. In certain embodiments, the additional pharmaceutical agent is an anti-bacterial agent.

(278) In some embodiments, the additional pharmaceutical agent is an antibiotic. Exemplary antibiotics include, but are not limited to gentamicin, amikacin, tobramycin, ciprofloxacin, levofloxacin, ceflazidimine, cefepime, cefoperazone, cefpirome, ceftobiprole, carbenicllin, ticarcillin, mezlocillin, azlocillin, piperacillin, meropenem, imipenem, doripenem, polymyxin B, colistin, aztreonam, isoniazid, rifampicin (also called rifampin), pyrazinamide, ethambutol, streptomycin, moxifloxacin, gatifloxacin, amikacin, capremycin, kanamycin, ethionamide, prothionamide, cycloserine, terizidone, linezolide, clofazimine, pretomanid, bedaquiline, delamanid, or rifamycins. In certain embodiments, the additional pharmaceutical agent is isoniazid, rifampicin (also called rifampin), pyrazinamide, ethambutol, or streptomycin. In some embodiments, the additional pharmaceutical agent is levofloxacin, moxifloxacin, gatifloxacin, amikacin, capremycin, kanamycin, ethionamide, prothionamide, cycloserine, terizidone, linezolide, or clofazimine.

(279) In certain embodiments, the additional pharmaceutical agent is a -lactam antibiotic. Exemplary -lactam antibiotics include, but are not limited to: -lactamase inhibitors (e.g., avibactam, clavulanic acid, tazobactam, sulbactam); carbacephems (e.g., loracarbef); carbapenems (e.g., doripenem, imipenem, ertapenem, meropenem); cephalosporins (1.sup.st generation) (e.g., cefacetrile, cefadroxil, cefalexin, cefaloglycin, cefalonium, cefaloridine, cefalotin, cefapirin, cefatrizine, cefazaflur, cefazedone, cefazolin, cefradine, cefroxadine, ceftezole, cephalosporin C); cephalosporins (2.sup.nd generation) (e.g., cefaclor, cefamandole, cefbuperzone, cefmetazole, cefonicid, ceforanide, cefotetan, cefotiam, cefoxitin, cefminox, cefprozil, cefuroxime, cefuzonam); cephalosporins (3.sup.rd generation) (e.g., cefcapene, cefdaloxime, cefdinir, cefditorin, cefetamet, cefixime, cefmenoxime, cefodizime, cefoperazone, cefotaxime, cefovecin, cefpimizole, cefpiramide, cefpodoxime, ceflamere, ceftazidime, cefleram, ceftibuten, cefliofur, cefliolene, ceftizoxime, ceftriaxone, latamoxef); cephalosporins (4.sup.th generation) (e.g., cefepime, cefluprenam, cefoselis, cefozopran, cefpirome, cefquinome, flomoxef); cephalosporins (5.sup.th generation) (e.g., ceftaroline fosamil, ceftobiprole, ceftolozane); cephems (e.g., cefaloram, cefaparole, cefcanel, cefedrolor, cefempidone, cefetrizole, cefivitril, cefmepidium cefoxazole, cefrotil, cefsulodin, cefsumide, ceftioline, ceftioxime, cefuracetime, nitrocefin); monobactams (e.g., aztreonam, carumonam, norcadicin A, tabtoxinine -lactam, tigemonam); penicillins/penams (e.g., amoxicillin, amoxicillin/clavulanate, ampicillin, ampicillin/flucloxacillin, ampicillin/sulbactam, azidocillin, azlocillin, bacampacillin, benzathine benzylpenicillin, benzathine phenoxymethylpenicillin, carbenicillin, carindacillin, clometocillin, cloxacillin, dicloxacillin, epicillin, flucloxacillin, hetacllin, mecillinam, mezlocillin, meticillin, metampiciillin, nafcillin, oxacillin, penamacillin, penicillin G, penicillin V, phenaticillin, piperacillin, piperacillin/tazobactam, pivampicillin, pivmeclillinam, procaine benzylpenicillin, propicillin, sulbenicillin, talampicillin, temocllin, ticarcillin, ticarcillin/clavulanate); and penems/carbapenems (e.g., biapenem, donpenem, ertapenem, faropenem, imipenem, imipenem/cilastatin, lenapenem, meropenem, panipenem, razupenem, tebipenem, thienamycin, tomopenem).

(280) In certain embodiments, the additional pharmaceutical agent is a non--lactam antibiotic. Exemplary non--lactam antibiotics include, but are not limited to: aminoglycosides (e.g., amikacin, dibekacin, gentamicin, kanamycin, neomycin, netilmicin, tobramycin, paromomycin, sisomicin, streptomycin, spectinomycin); ansamycins (e.g., geldanamycin, herbimycin); glycopeptides (e.g., belomycin, dalbavancin, oritavancin, ramoplanin, teicoplanin, telavancin, vancomycin); glycylcyclines (e.g., tigecycline); lincosamides (e.g., clindamycin, lincomycin): lipopeptides (e.g., anidulafungin, caspofungin, cilofungin, daptomycin, echinocandin B, micafungin, mycosubtilin); macrolides (e.g., azithromycin, carbomycin A, clarithromycin, dirithromycin, erythromycin, josmycin, kitasamycin, midecamycin, oleandomycin, roxithromycin, solithromycin, spiramycin, troleandomycin, telithromycin, tylosin): nitrofurans (e.g., furazolidone, furylfuramide, nitrofurantoin, nitrofurazone, nifuratel, nifurquinazol, nifurtoinol, nifuroxazide, nifurtimox, nifurzide, ranbezolid): nitroimidazoles (e.g., metronidazole, nimorazole, tinadazole); oxazolidinones (e.g., cycloserine, linezolid, posizolid radezolid, tedizolid); polypeptides (e.g., actinomycin, bacitracin, colistin, polymyxin B); quinolones (e.g., balofloxacin, besifloxacin, cinoxacin, ciprofloxacin, clinafloxacin, danofloxacin, delafloxacin, diflofloxacin, enoxacin, enrofloxacin, fleroxacin, flumequine, gatifloxacin, gemifloxacin, grepafloxacin, ibafloxacin, JNJ-Q2, levofloxacin, lomefloxacin, marbofloxacin, moxifloxacin, nadifloxacin, nalidixic acid, nemonoxacin, norfloxacin, ofloxacin, orbifloxacin, oxilinic acid, pazufloxacin, pefloxacin, piromidic acid, pipemidic acid, prulifloxacin, rosoxacin, rufloxacin, sarafloxacin, sparfloxacin, sitafloxacin, temafloxacin, tosufloxacin, trovafloxacin); rifamycins (e.g., rifamycin B, rifamycin S, rifamycin SV, rifampicin, rifabutin, rifapentine, rifalazil, rifaximin); sulfonamides (e.g., co-trimoxazole, mafenide, pediazole, sulfacetamide, sulfadiazine, silver sulfadiazine, sulfadimidine, sulfadimethoxine, sulfadoxine, sulfafurazole, sulfamethizole, sulfamethoxazole, sulfamethoxypyridazine, sulfametopyrazine, sulfametoxydiazine, sulfamoxole, sulfanilamide, sulfanitran, sulfasalazine, sulfisomidine, sulfonamidochrysoidine, trimethoprim): tetracyclines (e.g., 6-deoxytetracycline, aureomycin, chlortetracycline, demeclocycline, doxycycline, lymecycline, meclocycline, methacycline, minocycline, oxytetracycline, PTK-0796, sancycline, rolitetracycline, tetracycline, terramycin): tuberactinomycins (e.g., tuberactinomycin A, tuberactinomycin O, viomycin, enviomycin, capreomycin); arsphenamine; chioramphenicol; dalfoprisitin; fosfomycin; fusidic acid; fidaxomycin, gramicidin; lysozyme; mupirocin; platensimycin; pristinamycin; sparsomycin; quinupristin; quinupristin/dalfopristin; teixobactin; and thiamphenicol.

(281) In certain embodiments, the additional pharmaceutical agent is isoniazid.

(282) In certain embodiments, the additional pharmaceutical agent is rifampicin (also called rifampin).

(283) In certain embodiments, the additional pharmaceutical agent is pyrazinamide.

(284) In certain embodiments, the additional pharmaceutical agent is ethambutol.

(285) In certain embodiments, the additional pharmaceutical agent is streptomycin.

(286) In certain embodiments, the additional pharmaceutical agent is a carbapenem. In some embodiments, the additional pharmaceutical agent is doripenem, imipenem, or meropenem.

(287) In certain embodiments, the additional pharmaceutical agent is a glycylcycline. In some embodiments, the additional pharmaceutical agent is tigecycline.

(288) In certain embodiments, the additional pharmaceutical agent is a aminoglycoside. In some embodiments, the additional pharmaceutical agent is gentamycin, amikacin, or tobramycin.

(289) In certain embodiments, the additional pharmaceutical agent is a quinolone. In some embodiments, the additional pharmaceutical agent is ciprofloxacin or levofloxacin.

(290) In certain embodiments, the additional pharmaceutical agent is a cephalosporin. In some embodiments, the additional pharmaceutical agent is ceftazidime, cefepime, cefoperazone, cefpirome, ceftobirprole, or ceftaroline fosamil.

(291) In certain embodiments, the additional pharmaceutical agent is a penicillin. In some embodiments, the additional pharmaceutical agent is an antipseudomonal penicillin or extended spectrum penicillin. In certain embodiments, the additional pharmaceutical agent is a carboxypenicillin or a ureidopenicillin. In some embodiments, the additional pharmaceutical agent is carbenicillin, ticarcillin, mezlocillin, azlocillin, piperacillin, or mecillinam.

(292) In certain embodiments, the additional pharmaceutical agent is a polymyxin. In some embodiments, the additional pharmaceutical agent is polymyxin B or colistin.

(293) In certain embodiments, the additional pharmaceutical agent is a monobactam. In some embodiments, the additional pharmaceutical agent is aztreonam.

(294) In certain embodiments, the additional pharmaceutical agent is a -lactamase inhibitor. In some embodiments, the additional pharmaceutical agent is sulbactam.

(295) Also encompassed by the disclosure are kits (e.g., pharmaceutical packs). The kits provided may comprise a pharmaceutical composition or compound described herein and a container (e.g., a vial, ampule, bottle, syringe, and/or dispenser package, or other suitable container). In some embodiments, provided kits may optionally further include a second container comprising a pharmaceutical excipient for dilution or suspension of a pharmaceutical composition or compound described herein. In some embodiments, the pharmaceutical composition or compound described herein provided in the first container and the second container are combined to form one unit dosage form.

(296) Thus, in one aspect, provided are kits including a first container comprising a compound or pharmaceutical composition described herein. In certain embodiments, the kits are useful for treating an infectious disease (e.g., bacterial infection (e.g., Mycobacterium tuberculosis infection)) in a subject in need thereof. In certain embodiments, the kits are useful for preventing an infectious disease (e.g., bacterial infection (e.g., Mycobacterium tuberculosis infection)) in a subject in need thereof. In certain embodiments, the kits are useful for reducing the risk of developing an infectious disease (e.g., bacterial infection (e.g., Mycobacterium tuberculosis infection)) in a subject in need thereof. In certain embodiments, the kits are useful for inhibiting biosynthesis of virulence factors in an infection in a subject or in an infectious microorganism. In certain embodiments, the kits are useful for inhibiting siderophore (e.g., mycobactin, yersiniabactin, pyochelin, enterobactin, bacillibactin, vibriobactin, petrobactin) biosynthesis. In certain embodiments, the kits are useful for inhibiting MBT biosynthesis. In certain embodiments, the kits are useful for inhibiting MbtA.sub.tb. In some embodiments, the kits are useful for inhibiting yersiniabactin biosynthesis. In some embodiments, the kits are useful for inhibiting YbtE. In certain embodiments, the kits are useful for inhibiting PQS biosynthesis (e.g., inhibiting anthranilate-CoA synthetase (PqsA)) in an infection in a subject or in an infectious microorganism. In certain embodiments, the kits are useful for treating a patient with cystic fibrosis. In certain embodiments, the kits are useful for treating a patient with tuberculosis. In certain embodiments, the kits are useful for eradication of a biofilm in a patient. In certain embodiments, the kits are useful for preventing the formation of a biofilm in a patient.

(297) In certain embodiments, a kit described herein further includes instructions for using the kit. A kit described herein may also include information as required by a regulatory agency such as the U.S. Food and Drug Administration (FDA). In certain embodiments, the information included in the kits is prescribing information. In certain embodiments, the kits and instructions provide for treating an infectious disease (e.g., bacterial infection (e.g., Mycobacterium tuberculosis infection)) in a subject in need thereof. In certain embodiments, the kits and instructions provide for preventing an infectious disease (e.g., bacterial infection (e.g., Mycobacterium tuberculosis infection)) in a subject in need thereof. In certain embodiments, the kits and instructions provide for reducing the risk of developing an infectious disease (e.g., bacterial infection (e.g., Mycobacterium tuberculosis infection)) in a subject in need thereof. In certain embodiments, the kits and instructions provide for inhibiting siderophore (e.g., mycobactin, yersiniabactin, pyochelin, enterobactin, bacillibactin, vibriobactin, petrobactin) biosynthesis in an infection in a subject or in an infectious microorganism. In certain embodiments, the kits and instructions provide for inhibiting biosynthesis of MBT in an infection in a subject or in an infectious microorganism. In certain embodiments, the kits and instructions provide for inhibiting biosynthesis of virulence factors in an infection in a subject or in an infectious microorganism. In certain embodiments, the kits and instructions provide for inhibiting menaquinone biosynthesis (e.g., inhibiting anthranilate-CoA synthetase (PqsA)) in an infection in a subject or in an infectious microorganism. In certain embodiments, the kits and instructions provide for inhibiting yersiniabactin biosynthesis (e.g., inhibiting aYbtE) in an infection in a subject or in an infectious microorganism. A kit described herein may include one or more additional pharmaceutical agents described herein as a separate composition.

(298) Methods of Treatment and Uses

(299) The present disclosure also provides methods that may be useful for the treatment and/or prevention of a disease. In certain embodiments, the disease is an infectious disease. In certain embodiments, the infectious disease is a bacterial infection. In certain embodiments, the infectious disease is a fungal infection. In certain embodiments, the infectious disease is a parasitic infection. In certain embodiments, the infectious disease is a viral infection. In certain embodiments, the infectious disease is associated with another disease or condition, for example, in subjects with a weakened immune system as a result of HIV infection, AIDS, lupus, cancer, cystic fibrosis, or diabetes, or subjects with burns. In certain embodiments, the bacterial infection is an infection caused by Gram-positive bacteria. In certain, embodiments, the bacterial infection is an infection caused by Gram-negative bacteria. In some embodiments, the bacterial infection is caused by a member of Mycobacteriacae. In certain embodiments, the bacterial infection is an infection caused by Mycobacterium tuberculosis. In some embodiments, the infectious disease is tuberculosis.

(300) Exemplary bacterial infections include, but are not limited to, infections with a Gram positive bacteria (e.g., of the phylum Actinobacteria, phylum Firmicutes, or phylum Tenericutes); Gram negative bacteria (e.g., of the phylum Aquificae, phylum Deinococcus-Thermus, phylum Fibrobacteres/Chlorobi/Bacteroidetes (FCB), phylum Fusobacteria, phylum Gemmatimonadest, phylum Nitrospirae, phylum Planctomycetes/Verrucomicrobia/Chlamydiae (PVC), phylum Proteobacteria, phylum Spirochaetes, or phylum Synergistetes); or other bacteria (e.g., of the phylum Acidobacteria, phylum Chlroflexi, phylum Chrystiogenetes, phylum Cyanobacteria, phylum Deferrubacteres, phylum Dictyoglomi, phylum Thermodesulfobacteria, or phylum Thermotogae).

(301) In certain embodiments, the bacteria is a member of the phylum Firmicutes and the genus Enterococcus, i.e., the bacterial infection is an Enterococcus infection. Exemplary Enterococci bacteria include, but are not limited to, E. avium, E. durans, E. faecalis, E. faecium, E. gallinarum, E. solitarius, E. casseliflavus, and E. raffinosus. In certain embodiments, the bacteria is a member of the phylum Firmicutes and the genus Staphylococcus, i.e., the bacterial infection is a Staphylococcus infection. Exemplary Staphylococci bacteria include, but are not limited to, S. arlettae, S. aureus, S. auricularis, S. capitis, S. caprae, S. carnous, S. chromogenes, S. cohii, S. condimenti, S. croceolyticus, S. delphini, S. devriesei, S. epidermis, S equorum, S. felis, S. fluroettii, S gallinarum, S. haemolyticus, S. hominis, S. hyicus, S. intermedius, S. kloosii, S. leei, S. lenus, S. lugdunesis, S. lutrae, S. lyticans, S. massiliensis, S. microti, S. muscae, S. nepalensis, S. pasteuri, S. penttenkoferi, S. piscifermentans, S. psuedointermedius, S. psudolugdensis, S. pulvereri, S. rostri, S. saccharolyticus, S. saprophyticus, S. schleiferi, S. sciuri, S. simiae, S. simulans, S. stepanovicii, S. succinus, S. vitulinus, S. warneri, and S. xylosus. In certain embodiments, the Staphylococcus infection is a S. aureus infection. In certain embodiments, the bacteria is a member of the phylum Firmicutes and the genus Bacillus, i.e., the bacterial infection is a Bacillus infection. Exemplary Bacillus bacteria include, but are not limited to, B. alcalophilus, B. alvei, B. aminovorans, B. amyloliquefaciens, B. aneurinolyticus, B. anthracis, B. aquaemaris, B. atrophaeus, B. boroniphilus, B. brevis, B. caldolyticus, B. centrosporus, B. cereus, B. circulars, B. coagulans, B. firmus, B. flavothermus, B. fusiformis, B. globigii, B. infernus, B. larvae, B. laterosporus, B. lentus, B. licheniformis, B. megaterium, B. mesentericus, B. mucilaginosus, B. mycoides, B. natto, B. pantothenticus, B. polymyxa, B. pseudoanthracis, B. pumilus, B. schlegelii, B. sphaericus, B. sporothermodurans, B. stearothermophilus, B. subtilis, B. thermoglucosidasius, B. thuringiensis, B. vulgatis, and B. weihenstephanensis. In certain embodiments, the Bacillus infection is a B. subtilis infection. In certain embodiments, the B. subtilis has an efflux (e.g., mef, msr) genotype. In certain embodiments, the B. subtilis has a methylase (e.g., erm) genotype. In certain embodiments, the bacteria is a member of the phylum Firmicutes and the genus Streptococcus, i.e., the bacterial infection is a Streptococcus infection. Exemplary Streptococcus bacteria include, but are not limited to, S. agalactiae, S. anginosus, S. bovis, S canis, S. constellatus, S. dysgalactiae, S. equinus, S. iniae, S. intermedius, S. mitis, S. mutans, S. oralis, S. parasanguinis, S. peroris, S. pneumoniae, S. pyogenes, S. ratti, S. salivarius, S. thermophilus, S. sanguinis, S. sobrinus, S. suis, S. uberis, S. vestibularis, S. viridans, and S. zooepidemicus. In certain embodiments, the Streptococcus infection is an S. pyogenes infection. In certain embodiments, the Streptococcus infection is an S. pneumoniae infection. In certain embodiments, the S. pneumoniae has an efflux (e.g., mef, msr) genotype. In certain embodiments, the S. pneumoniae has a methylase (e.g., erm) genotype. In certain embodiments, the bacteria is a member of the phylum Firmicutes and the genus Clostridium, i.e., the bacterial infection is a Clostridium infection. Exemplary Clostridia bacteria include, but are not limited to, C. botulinum, C. difficile, C. perfringens, C. tetani, and C. sordellii.

(302) In certain embodiments, the Gram negative bacteria is a bacteria of the phylum Proteobacteria and the genus Escherichia. i.e., the bacterial infection is an Escherichia infection. Exemplary Escherichia bacteria include, but are not limited to, E. albertii, E. blattae, E. coli, E. fergusonii, E. hermannii, and E. vulneris. In certain embodiments, the Escherichia infection is an E. coli infection. In certain embodiments, the Gram negative bacteria is a bacteria of the phylum Proteobacteria and the genus Haemophilus. i.e., the bacterial infection is an Haemophilus infection. Exemplary Haemophilus bacteria include, but are not limited to, H. aegyptius, H. aphrophilus, H. avium, H. ducreyi, H. felis, H. haemolyticus, H. influenzae, H. parainfluenzae, H. paracuniculus, H. parahaemolyticus, H. pittmaniae, Haemophilus segnis, and H. somnus. In certain embodiments, the Haemophilus infection is an H. influenzae infection.

(303) In certain embodiments, the Gram negative-bacteria is a bacteria of the phylum Proteobacteria and the genus Acinetobacter. i.e., the bacterial infection is an Acinetobacter infection. Exemplary Acinetobacter bacteria include, but are not limited to, A. baumanii, A. haemolyticus, and A. lwoffii. In certain embodiments, the Acinetobacter infection is an A. baumanii infection. In certain embodiments, the Gram-negative bacteria is a bacteria of the phylum Proteobacteria and the genus Klebsiella. i.e., the bacterial infection is a Klebsiella infection. Exemplary Klebsiella bacteria include, but are not limited to, K. granulomatis, K. oxytoca, K. michiganensis, K. pneumoniae, K. quasipneumoniae, and K. variicola. In certain embodiments, the Klebsiella infection is a K. pneumoniae infection. In certain embodiments, the Grain-negative bacteria is a bacteria of the phylum Proteobacteria and the genus Pseudomonas. i.e., the bacterial infection is a Pseudomonas infection. Exemplary Pseudomonas bacteria include, but are not limited to, P. aeruginosa, P. oryzihabitans. P. plecoglissicida. P. syringae, P. putida, and P. fluoroscens. In certain embodiments, the Pseudomonas infection is a P. aeruginosa infection. In certain embodiments, the Gram-negative bacteria is a bacteria of the phylum Bacteroidetes and the genus Bacteroides. i.e., the bacterial infection is a Bacteroides infection. Exemplary Bacteroides bacteria include, but are not limited to, B. fragilis, B. distasonis, B. ovatus. B. thetaiotaomicron, and B. vulgates. In certain embodiments, the Bacteroides infection is a B. fragilis infection. In certain embodiments, the Gram negative-bacteria is a bacteria of the phylum Proteobacteria and the genus Yersinia. i.e., the bacterial infection is an Yersinia infection. Exemplary Yersinia bacteria include, but are not limited to, Y. pestis, Y. entercolitica, and Y. pseudotuberculosis. In certain embodiments, the Acinetobacter infection is an Y. pestis infection.

(304) In certain embodiments, the bacterial infection is caused by a bacteria of the phylum Actinobacteria. Exemplary bacteria of the phylum include, but are not limited to bacteria within Acidimicrobiaceae family, Actinomycetaceae family, Corynebacteriaceae family, Gordoniaceae family, Mycobacteriaceae family, Nocardiaceae family, Tsukamurellaceae family, Williamsiaceae family, Acidothermaceae family, Frankiaceae family, Geodermatophilaceae, Kineosporiaceae, Microsphaeraceae family, Sporichthyaceae family, Glycomycetaceae family, Beutenbergiaceae family, Bogoriellaceae family, Brevibacteriaceae family, Cellulomonadaceae family, Dermabacteraceae family, Dermatophilaceae family, Dermacoccaceae family, Intrasporangiaceae family, Jonesiaceae family, Microbacteriaceae family, Micrococcaceae family, Promicromonosporaceae family, Rarobacteraceae family, Sanguibacteraceae family, Micromonosporaceae family, Nocardioidaceae family, Propionibacteriaceae family, Actinosynnemataceae family, Pseudonocardiaceae family, Streptomycetaceae family, Nocardiopsaceae family, Streptosporangiaceae family, Iltermomonosporaceae family, Bifidobacteriaceae family, Coriobacteriaceae family, Rubrobacteraceae family, and Sphaerobacteraceae family.

(305) In certain embodiments, the bacterial infection is a Mycobacterium infection, a Staphylococcus infection, Pseudomonas infection, a Bacillus infection, or an Escherichia infection. In certain, embodiments, the bacterial infection is tuberculosis. In some embodiments, the bacterial infection is a Mycobacterium tuberculosis infection. In certain embodiments, the bacterial infection is a Pseudomonas infection. In some embodiments, the bacterial infection is Pseudomonas aeruginosa infection. In some embodiments, the bacterial infection is Yersinia infection. In some embodiments the bacterial infection is Yersinia pestis infection. In some embodiments the bacterial infection is E. coli infection. In some embodiments the bacterial infection is Bacillus subtilis infection. In some embodiments the bacterial infection is Bacillus anthracis infection. In some embodiments the bacterial infection is Vibrio cholera infection. In some embodiments, the bacterial infection is infection of multiple species of bacterium. In some embodiments, the bacterial infection is infection of multiple species of bacterium, one of which is P. aeruginosa. In some embodiments, the bacterial infection is infection of multiple species of bacterium, one of which is Mycobacterium tuberculosis.

(306) In some embodiments, the infectious disease is a parasitic infection. Exemplary parasites causing the parasitic infection include, but are not limited to, Trypanosoma spp. (e.g., Trypanosoma cruzi, Trypansosoma brucei), Leishmania spp., Giardia spp., Trichomonas spp., Entamoeba spp., Naegleria spp., Acanthamoeba spp., Schistosoma spp., Plasmodium spp. (e.g., P. flaciparum), Crytosporidium spp., Isospora spp., Balantidium spp., Pneumocystis spp., Babesia, Loa loa, Ascaris lumbricoides, Dirotilaria immitis, and Toxoplasma ssp. (e.g. T. gondii).

(307) The present disclosure also provides methods that may be useful for the treatment and/or prevention of an infectious disease including, but not limited to pneumonic plague, septicemic plague, bubonic plague, gastroenteritis, urinary tract infections, neonatal meningitis, hemorrhagic colitis, Crohn's disease, pneumonia, septic shock, gastrointestinal infection, necrotising enterocolitis, anthrax, and tuberculosis.

(308) The compounds described herein (e.g., compounds of Formula (I)) may exhibit inhibitory activity towards MtbA.sub.tb, may exhibit inhibitory activity towards an adenylate-forming enzyme (e.g., an acyl-CoA synthetase), may exhibit the ability to inhibit anthranilate-CoA synthetase (PqsA), may exhibit the ability to inhibit YbtE, may exhibit the ability to inhibit the siderophore biosynthesis, may exhibit the ability to inhibit the biosynthesis of MBT, may exhibit the ability to inhibit the biosynthesis of virulence factors in an infectious microorganism, may exhibit the ability to inhibit PQS biosynthesis, may exhibit a therapeutic effect and/or preventative effect in the treatment of infectious diseases (e.g., bacterial infections), and/or may exhibit a therapeutic and/or preventative effect superior to existing agents for treatment of an infectious disease.

(309) The compounds described herein (e.g., compounds of Formula (I)) may exhibit selective inhibition of MtbA.sub.tb versus inhibition of other proteins. The compounds described herein (e.g., compounds of Formula (I)) may exhibit selective inhibition of anthranilate-CoA synthetase (PqsA) versus inhibition of other proteins. The compounds described herein (e.g., compounds of Formula (I)) may exhibit selective inhibition of YbtE. In certain embodiments, the selectivity versus inhibition of another protein is between about 2 fold and about 10 fold. In certain embodiments, the selectivity is between about 10 fold and about 50 fold. In certain embodiments, the selectivity is between about 50 fold and about 100 fold. In certain embodiments, the selectivity is between about 100 fold and about 500 fold. In certain embodiments, the selectivity is between about 500 fold and about 1000 fold. In certain embodiments, the selectivity is between about 1000 fold and about 5000 fold. In certain embodiments. In certain embodiments, the selectivity is between about 5000 fold and about 10000 fold. In certain embodiments, or at least about 10000 fold.

(310) The present disclosure provides methods that may be useful for the treatment and/or prevention of an infectious disease by administering a compound described herein, or pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, or prodrug thereof, or pharmaceutical composition thereof, to a subject in need thereof. In certain embodiments, the compound is administered as a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof. In certain embodiments, the compound is administered as a pharmaceutically acceptable salt of the compound. In certain embodiments, the compound is administered as a specific stereoisomer or mixture of stereoisomers of the compound. In certain embodiments, the compound is administered as a specific tautomer or mixture of tautomers of the compound. In certain embodiments, the compound is administered as a pharmaceutical composition as described herein comprising the compound.

(311) The present disclosure also provides uses of the inventive compounds, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, prodrugs, and pharmaceutical compositions thereof, in the manufacture of medicaments for the treatment and prevention of diseases. In certain embodiments, the disease is an infectious disease. In certain embodiments, the infectious disease is a bacterial infection. In certain embodiments, the disease is tuberculosis. In certain embodiments, the infectious disease is a parasitic infection. In certain embodiments, the infectious disease may be associated with another disease or condition, for example, in subjects with a weakened immune system as a result of HIV infection, AIDS, lupus, cancer, cystic fibrosis, or diabetes, or subjects with burns. In certain embodiments, the infectious disease may arise as complication of another disease or condition, for example, in subjects with a weakened immune system as a result of HIV infection, AIDS, lupus, cancer, cystic fibrosis or diabetes. In certain embodiments, the bacterial infection is an infection caused by Gram-positive bacteria. In certain, embodiments, the bacterial infection is an infection caused by Gram-negative bacteria. In certain embodiments, the bacterial infection is a Staphylococcus infection, a Bacillus infection, or an Escherichia infection. In certain embodiments, the bacterial infection is a Pseudomonas infection. In some embodiments the bacterial infection is Pseudomonas aeruginosa infection. In some embodiments the bacterial infection is Mycobacterium tuberculosis infection. In some embodiments the bacterial infection is Yersinia pestis infection. In some embodiments the bacterial infection is E. coli infection. In some embodiments the bacterial infection is Bacillus subtilis infection. In some embodiments the bacterial infection is Bacillus anthracis infection. In some embodiments the bacterial infection is Vibrio cholera infection.

(312) Certain methods described herein include methods of treating a bacterial infection, methods of treating an infection in a subject, preventing a bacterial infection, methods of preventing an infection in a subject, or methods of contacting an infectious microorganism with a compound described herein (e.g. a compound of Formula (I)). Any of these methods may involve a specific class of bacteria or type of bacteria. In certain embodiments, the bacterial infection is caused by Gram-positive bacteria. In certain, embodiments, the bacterial infection caused by Gram-negative bacteria. In certain embodiments the bacteria is from the genus Yersinia, Staphylococcus, Escherichia, or Bacillus. In certain embodiments the bacteria is from the genus Pseudomonas. In certain embodiments the bacteria is from the genus Mycobacterium.

(313) In certain embodiments, the microbial infection is an infection with a bacteria, i.e., a bacterial infection. In certain embodiments, the compounds of the disclosure exhibit anti bacterial activity. For example, in certain embodiments, the compound has a mean inhibitory concentration, with respect to a particular bacterium, of less than 50 g/mL, preferably less than 25 g/mL, more preferably less than 5 g/mL, and most preferably less than 1 g/mL.

(314) Exemplary bacteria include, but are not limited to, Gram positive bacteria (e.g., of the phylum Actinobacteria, phylum Firmicutes, or phylum Tenericutes); Gram negative bacteria (e.g., of the phylum Aquificae, phylum Deinococcus-Thermus, phylum Fibrobacteres/Chlorobi/Bacteroidetes (FCB), phylum Fusobacteria, phylum Gemmatimonadest, phylum Ntrospirae, phylum Planctomycetes/Verrucomicrobia/Chlamydiae (PVC), phylum Proteobacteria, phylum Spirochaetes, or phylum Synergistetes); or other bacteria (e.g., of the phylum Acidobacteria, phylum Chlroflexi, phylum Chrystiogenetes, phylum Cyanobacteria, phylum Deferrubacteres, phylum Dictyoglomi, phylum Thermodesulfobacteria, or phylum Thermotogae).

(315) In certain embodiments, the bacteria is a member of the phylum Actinobacteria and the genus Mycobacterium, e.g., the bacterial infection is a Mycobacterium infection. Exemplary Mycobacterium bacteria include, but are not limited to, Mycobacterium tuberculosis, Mycobacterium leprae. Mycobacterium avium paratuberculosis. Mycobacterium ulcerans, Mycobacterium lepromatosis, and Mycobacterium marinum. In certain embodiments, the bacteria is Mycobacterium tuberculosis.

(316) In certain embodiments, the bacteria is a member of the phylum Proteobacteria and the genus Pseudomonas, e.g., the bacterial infection is a Pseudomonas infection. Exemplary Pseudomonas bacteria include, but are not limited to, P. aeruginosa, P. anguilliseptica, P. agarici, P. luteola, P. oryzihabitans, P. plecoglossida, P. syringae, and P. tolaasii. In certain embodiments, the bacteria is P. aeruginosa.

(317) In certain embodiments, the bacteria is a member of the phylum Proteobacteria and the genus Yersinia, e.g., the bacterial infection is a Yersinia infection. Exemplary Yersinia bacteria include, but are not limited to, Y. pestis, Y. entercolitica, and Y. pseudotuberculosis. In certain embodiments, the Acinetobacter infection is an Y. pestis infection.

(318) In certain embodiments, the methods of the disclosure include administering to the subject an effective amount of a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof. In certain embodiments, the effective amount is a therapeutically effective amount. In certain embodiments, the effective amount is a prophylactically effective amount.

(319) In another aspect, the present disclosure provides methods for inhibiting the biosynthesis of virulence factors in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(320) In another aspect, the present disclosure provides methods for inhibiting the biosynthesis of virulence factors in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(321) In some embodiments, the virulence factor is pyocyanin. In some embodiments, the virulence factor is lectin, HCN, or a rhamnolipid. In some embodiments, the virulence factor is PQS. In some embodiments, the virulence factor is PqsE. In some embodiments, the virulence factor is yersiniabactin.

(322) In another aspect, the present disclosure provides methods for inhibiting siderophore (e.g., mycobactin, yersiniabactin, pyochelin, enterobactin, bacillibactin, vibriobactin, petrobactin) biosynthesis in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(323) In another aspect, the present disclosure provides methods for inhibiting siderophore (e.g., mycobactin, yersiniabactin, pyochelin, enterobactin, bacillibactin, vibriobactin, petrobactin) biosynthesis in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(324) In another aspect, the present disclosure provides methods for inhibiting MBT biosynthesis in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(325) In another aspect, the present disclosure provides methods for inhibiting MBT biosynthesis in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(326) In another aspect, the present disclosure provides methods for inhibiting PQS biosynthesis in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(327) In another aspect, the present disclosure provides methods for inhibiting PQS biosynthesis in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(328) Inhibiting PQS biosynthesis may decrease levels of one or more PQS metabolite and/or virulence factors. In some embodiments, the PQS metabolite is anthranilyl-S-CoA. In some embodiments, the PQS metabolite is 2-heptyl-4-hydroxyquinoline (HHQ). In some embodiments, the PQS metabolite is 3,4-dihydroxy-2-heptylquinoline (PQS). In some embodiments, the virulence factor is pyocyanin. In some embodiments, the virulence factor is another virulence factor described herein.

(329) In another aspect, the present disclosure provides methods for inhibiting HHQ biosynthesis in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(330) In another aspect, the present disclosure provides methods for inhibiting HHQ biosynthesis in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(331) In another aspect, the present disclosure provides methods for inhibiting pyocyanin in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(332) In another aspect, the present disclosure provides methods for inhibiting pyocyanin biosynthesis in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(333) In another aspect, the present disclosure provides methods for inhibiting biofilm formation, in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(334) In another aspect, the present disclosure provides methods for inhibiting biofilm formation by contacting the biofilm with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof: or a pharmaceutical composition thereof.

(335) In another aspect, the present disclosure provides methods for eradicating a biofilm in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof; or a pharmaceutical composition thereof.

(336) In another aspect, the present disclosure provides methods for eradicating a biofilm by contacting the biofilm with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(337) In another aspect, the present disclosure provides methods for inhibiting a mycobactin forming enzyme (e.g., MbtA.sub.tb) in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(338) In another aspect, the present disclosure provides methods for inhibiting mycobactin forming enzyme (e.g., MbtA.sub.tb) in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(339) In another aspect, the present disclosure provides methods for inhibiting an adenylate-forming enzyme (e.g., an acyl-CoA synthetase) in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(340) In another aspect, the present disclosure provides methods for inhibiting an adenylate-forming enzyme (e.g., an acyl-CoA synthetase) in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(341) In another aspect, the present disclosure provides methods for inhibiting bifunctional enzyme salicyl-AMP ligase (MbtA.sub.tb) in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(342) In another aspect, the present disclosure provides methods for inhibiting bifunctional enzyme salicyl-AMP ligase (MbtA.sub.tb) in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof: or a pharmaceutical composition thereof.

(343) In another aspect, the present disclosure provides methods for inhibiting anthranilate-CoA synthetase (PqsA) in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(344) In another aspect, the present disclosure provides methods for inhibiting anthranilate-CoA synthetase (PqsA) in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(345) In another aspect, the present disclosure provides methods for inhibiting a YbtE in an infection in a subject by administering to the subject a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(346) In another aspect, the present disclosure provides methods for inhibiting YbtE in an infectious microorganism, by contacting the sample with a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, stereoisomer, or tautomer thereof, or a pharmaceutical composition thereof.

(347) The present disclosure also provides methods of using a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, or prodrug thereof, or pharmaceutical compositions thereof, in research studies in the field of disease pathology, biochemistry, cell biology, and other fields associated with infectious diseases. The compounds of the disclosure can be used to study the roles of biomolecules (e.g., MbtA.sub.tb, MBT, anthranilate-CoA synthetase, anthranilic acid, anthranilate-AMP, anthranilyl-S-CoA, HHQ, PQS, pyocyanin, YbtE, yersiniabactin). The compounds of the disclosure can be used to study the biosynthesis of a virulence factor in a microorganism. The compounds of the disclosure can be used to study quorum sensing in a microorganism. In certain embodiments, the method comprises use of the compound or composition thereof to inhibit the biosynthesis of virulence factors, inhibit MBT biosynthesis, inhibit PQS biosynthesis, inhibit yersiniabactin biosynthesis, or disrupt quorum sensing. In certain embodiments, the method comprises use of the compound or composition thereof to inhibit MbtA.sub.tb. In certain embodiments, the method comprises use of the compound or composition thereof to inhibit anthranilate-CoA synthetase (PqsA). In certain embodiments, the method comprises use of the compound or composition thereof to inhibit YtbE. In certain embodiments, the method comprises determining the concentration of a biomolecule in a subject or biological sample.

(348) Certain methods described herein, may comprise administering one or more additional pharmaceutical agent in combination with the compounds described herein. The additional pharmaceutical agents include, but are not limited to, anti-diabetic agents, anti-proliferative agents, anti-cancer agents, anti-angiogenesis agents, anti-inflammatory agents, anti-bacterial agents, anti-viral agents, cardiovascular agents, and pain-relieving agents. In certain embodiments, the additional pharmaceutical agent is an antibiotic. In certain embodiments, the additional pharmaceutical agent is an anti-bacterial agent. In certain embodiments, the additional pharmaceutical agent is a binder or inhibitor of MbtA.sub.tb. In certain embodiments, the additional pharmaceutical agent inhibits the biosynthesis of a virulence factor. In certain embodiments, the additional pharmaceutical agent inhibits siderophore (e.g., mycobactin, yersiniabactin, pyochelin, enterobactin, bacillibactin, vibriobactin, petrobactin) biosynthesis. In certain embodiments, the additional pharmaceutical agent inhibits MBT biosynthesis. In certain embodiments, the additional pharmaceutical agent is a binder or inhibitor of an AMP-producing synthetase. In certain embodiments, the additional pharmaceutical agent is a binder or inhibitor of anthranilate-CoA synthetase (PqsA). In certain embodiments, the additional pharmaceutical agent inhibits yersiniabactin biosynthesis. In certain embodiments, the additional pharmaceutical agent is a binder or inhibitor of YbtE. In certain embodiments, the additional pharmaceutical agent inhibits the biosynthesis of a virulence factor. In certain embodiments, the additional pharmaceutical agent inhibits PQS biosynthesis.

(349) In certain embodiments, the additional pharmaceutical agent is isoniazid.

(350) In certain embodiments, the additional pharmaceutical agent is rifampicin (also called rifampin).

(351) In certain embodiments, the additional pharmaceutical agent is pyrazinamide.

(352) In certain embodiments, the additional pharmaceutical agent is ethambutol.

(353) In certain embodiments, the additional pharmaceutical agent is streptomycin.

(354) In certain embodiments, the additional pharmaceutical agent is a carbapenem. In some embodiments, the additional pharmaceutical agent is doripenem, imipenem, or meropenem.

(355) In certain embodiments, the additional pharmaceutical agent is a glycylcycline. In some embodiments, the additional pharmaceutical agent is tigecycline.

(356) In certain embodiments, the additional pharmaceutical agent is a aminoglycoside. In some embodiments, the additional pharmaceutical agent is gentamycin, amikacin, or tobramycin.

(357) In certain embodiments, the additional pharmaceutical agent is a quinolone. In some embodiments, the additional pharmaceutical agent is ciprofloxacin or levofloxacin.

(358) In certain embodiments, the additional pharmaceutical agent is a cephalosporin. In some embodiments, the additional pharmaceutical agent is ceftazidime, cefepime, cefoperazone, cefpirome, ceftobirprole, or ceftaroline fosamil.

(359) In certain embodiments, the additional pharmaceutical agent is a penicillin. In some embodiments, the additional pharmaceutical agent is an antipseudomonal penicillin or extended spectrum penicillin. In certain embodiments, the additional pharmaceutical agent is a carboxypenicillin or a ureidopenicillin. In some embodiments, the additional pharmaceutical agent is carbenicillin, ticarcillin, mezlocillin, azlocillin, piperacillin, or mecillinam.

(360) In certain embodiments, the additional pharmaceutical agent is a polymyxin. In some embodiments, the additional pharmaceutical agent is polymyxin B or colistin.

(361) In certain embodiments, the additional pharmaceutical agent is a monobactam. In some embodiments, the additional pharmaceutical agent is aztreonam.

(362) In certain embodiments, the additional pharmaceutical agent is a -lactamase inhibitor. In some embodiments, the additional pharmaceutical agent is sulbactam.

(363) Codon-Optimized MbtA.sub.tb

(364) In certain aspects, the disclosure provides a protein, H10MbtA.sup.opt (SEQ ID NO: 4), generated via a codon-optimized nucleotide sequence of MbtA.sub.tb with a His10 tag (SEQ ID NO: 3), see FIG. 2 for the original non-optimized nucleotide sequence of MbtA.sub.tb and the optimized nucleotide sequence of MbtA.sub.tb). In some aspects, the protein comprises an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NO: 4. In some embodiments, the amino acid sequence is at least 85%, 90%, 95%, 98%, 99%, or 99.5% identical to the amino acid sequence of SEQ ID NO: 4. In some embodiments, the disclosure provides a polynucleotide encoding a protein at least 80% identical to SEQ ID NO: 4. In some embodiments, the disclosure provides a polynucleotide encoding a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4. In some embodiments, the disclosure provides a vector comprising a polynucleotide of a protein at least 80% identical to SEQ ID NO: 4. In some embodiments, the disclosure provides a vector comprising a polynucleotide of a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4. In some embodiments, the disclosure provides a cell comprising a protein at least 80% identical to SEQ ID NO: 4. In some embodiments, the disclosure provides a cell comprising a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4. In certain embodiments, the disclosure provides a cell comprising the nucleic acid molecule encoding a protein at least 80% identical to SEQ ID NO: 4. In certain embodiments, the disclosure provides a cell comprising the nucleic acid molecule encoding a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4. In certain embodiments, the disclosure provides a kit comprising a vector for expressing a protein at least 80% identical to SEQ ID NO: 4. In certain embodiments, the disclosure provides a kit comprising a vector for expressing a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4.

(365) In some embodiments, the disclosure provides a method for identifying MbtA inhibitors. In certain embodiments, the method comprises the use of a protein at least 80% identical to SEQ ID NO: 4. In certain embodiments, the method comprises the use of a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4. In certain embodiments, the method comprises the use of a protein at least 80% identical to SEQ ID NO: 4 and a compound. In certain embodiments, the method comprises the use of a protein at least 85%, 90/o, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4 and a compound. In certain embodiments, the method comprises contacting a protein at least 80% identical to SEQ ID NO: 4 with a compound and detecting the binding of the compound to the protein. In certain embodiments, the method comprises contacting a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4 with a compound and detecting the binding of the compound to the protein.

(366) In some embodiments, the disclosure provides a method for identifying MbtA inhibitors using a MesG assay. In some embodiments, the MesG assay uses MesG (7-methyl-6-thioguanosine). In certain embodiments, the method comprises the use of a protein at least 80% identical to SEQ ID NO: 4. in a MesG assay. In certain embodiments, the method comprises the use of a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4 in a MesG assay. In certain embodiments, the method comprises contacting a protein at least 80% identical to SEQ ID NO: 4 with a compound and detecting the phosphorolysis of MesG. In certain embodiments, the method comprises contacting a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4 with a compound and detecting the phosphorolysis of MesG. In certain embodiments, the method comprises contacting a protein at least 80% identical to SEQ ID NO: 4 with a compound and detecting the conversion of MesG to 2-amino-6-mercapto-7-methylpurine. In certain embodiments, the method comprises contacting a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4 with a compound and detecting the conversion of MesG to 2-amino-6-mercapto-7-methylpurine.

(367) In some embodiments, the MesG assay is a hydroxylamine-7-methyl-6-thioguanosine (HA-MesG) spectrophotometric assay. In some embodiments, the disclosure provides a method for identifying MbtA inhibitors using a HA-MesG spectrophotometric assay. In certain embodiments, the method comprises contacting a protein at least 80% identical to SEQ ID NO: 4 with a compound and detecting the phosphorolysis of MesG. In certain embodiments, the method comprises contacting a protein at least 85%, 90%, 95%, 89%, 99%, or 99.5% identical to SEQ ID NO: 4 with a compound and detecting the phosphorolysis of MesG.

(368) Mycobacterium smegmatis

(369) In certain embodiments, a Mycobacterium smegmatis is a modified Mycobacterium smegmatis. In certain embodiments, a Mycobacterium smegmatis is a modified strain of Mycobacterium smegmatis. In certain embodiments, a Mycobacterium smegmatis is a modified version of Mycobacterium smegmatis. In certain embodiments, a Mycobacterium smegmatis has the strain designation mc.sup.2155. In some embodiments, a Mycobacterium smegmatis has the GenBank identifier of CP000480.1. For example, a Mycobacterium smegmatis having the GenBank identifier of CP000480.1 is modified. In certain embodiments, a Mycobacterium smegmatis may be modified to remove certain amino acids. In certain embodiments, a Mycobacterium smegmatis may be modified to remove multiple amino acids. In certain embodiments, a Mycobacterium smegmatis may be modified to remove amino acid sequences. In certain embodiments, a Mycobacterium smegmatis may be modified to carry a plasmid. In some embodiments, a Mycobacterium smegmatis may be modified to carry a plasmid such as pMbtA.sub.tb or pMbtA.sub.sm.

Definitions

(370) Definitions of specific functional groups and chemical terms are described in more detail below. The chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75.sup.th Ed., inside cover, and specific functional groups are generally defined as described therein. Additionally, general principles of organic chemistry, as well as specific functional moieties and reactivity, are described in Organic Chemistry, Thomas Sorrell, University Science Books, Sausalito, 1999; Smith and March March's Advanced Organic Chemistry, 5.sup.th Edition, John Wiley & Sons, Inc., New York, 2001; Larock, Comprehensive Organic Transformations, VCH Publishers, Inc., New York, 1989; and Carruthers, Some Modern Methods of Organic Synthesis, 3.sup.rd Edition, Cambridge University Press, Cambridge, 1987.

(371) Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various stereoisomeric forms, e.g., enantiomers and/or diastereomers. For example, the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer. Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses. See, for example, Jacques et al., Enantiomers, Racemates and Resolutions (Wiley Interscience, New York, 1981); Wilen et al., Tetrahedron 33:2725 (1977); Eliel, E. L. Stereochemistry of Carbon Compounds (McGraw-Hill, N Y, 1962); and Wilen, S. H. Tables of Resolving Agents and Optical Resolutions p. 268 (E. L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, IN. 1972). The disclosure additionally encompasses compounds as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers.

(372) In a formula, custom character is a single bond where the stereochemistry of the moieties immediately attached thereto is not specified custom character is absent or a single bond, custom character or custom character is a single or double bond, and custom character is a single, double, or triple bond. If drawn in a ring, custom character indicates that each bond of the ring is a single or double bond, valency permitting. The precise of arrangement of single and double bonds will be determined by the number, type, and substitution of atoms in the ring, and if the ring is multicyclic or polycyclic. In general, any ring atom (e.g., C or N), can have a double bond with a maximum of one adjacent atom.

(373) Unless otherwise stated, structures depicted herein are also meant to include compounds that differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structures except for the replacement of hydrogen by deuterium or tritium, replacement of .sup.19F with .sup.18F, or the replacement of .sup.12C with .sup.13C or .sup.14C are within the scope of the disclosure. Such compounds are useful, for example, as analytical tools or probes in biological assays.

(374) When a range of values is listed, it is intended to encompass each value and sub-range within the range. For example C.sub.1-6 alkyl is intended to encompass, C.sub.1, C.sub.2, C.sub.3, C.sub.4, C.sub.5, C.sub.6, C.sub.1-6, C.sub.1-5, C.sub.1-4, C.sub.1-3, C.sub.1-2, C.sub.2-6, C.sub.2-5, C.sub.2-4, C.sub.2-3, C.sub.3-6, C.sub.3-5, C.sub.3-4, C.sub.4-6, C.sub.4-5, and C.sub.5-6 alkyl.

(375) The term aliphatic refers to alkyl, alkenyl, alkynyl, and carbocyclic groups. Likewise, the term heteroaliphatic refers to heteroalkyl, heteroalkenyl, heteroalkynyl, and heterocyclic groups.

(376) The term alkyl refers to a radical of a straight-chain or branched saturated hydrocarbon group having from 1 to 10 carbon atoms (C.sub.1-10 alkyl). In some embodiments, an alkyl group has 1 to 9 carbon atoms (C.sub.1-9 alkyl). In some embodiments, an alkyl group has 1 to 8 carbon atoms (C.sub.1-8 alkyl). In some embodiments, an alkyl group has 1 to 7 carbon atoms (C.sub.1-7 alkyl). In some embodiments, an alkyl group has 1 to 6 carbon atoms (C.sub.1-6 alkyl). In some embodiments, an alkyl group has 1 to 5 carbon atoms (C.sub.1-5 alkyl). In some embodiments, an alkyl group has 1 to 4 carbon atoms (C.sub.1-4 alkyl). In some embodiments, an alkyl group has 1 to 3 carbon atoms (C.sub.1-3 alkyl). In some embodiments, an alkyl group has 1 to 2 carbon atoms (C.sub.1-2 alkyl). In some embodiments, an alkyl group has 1 carbon atom (C.sub.1 alkyl). In some embodiments, an alkyl group has 2 to 6 carbon atoms (C.sub.2-6 alkyl). Examples of C.sub.1-6 alkyl groups include methyl (C.sub.1), ethyl (C.sub.2), propyl (C.sub.3) (e.g., n-propyl, isopropyl), butyl (C.sub.4) (e.g., n-butyl, tert-butyl, sec-butyl, iso-butyl), pentyl (C.sub.5) (e.g., n-pentyl, 3-pentanyl, amyl, neopentyl, 3-methyl-2-butanyl, tertiary amyl), and hexyl (C.sub.6) (e.g., n-hexyl). Additional examples of alkyl groups include n-heptyl (C.sub.7), n-octyl (C.sub.8), and the like. Unless otherwise specified, each instance of an alkyl group is independently unsubstituted (an unsubstituted alkyl) or substituted (a substituted alkyl) with one or more substituents (e.g., halogen, such as F). In certain embodiments, the alkyl group is an unsubstituted C.sub.1-10 alkyl (such as unsubstituted C.sub.1-6 alkyl, e.g., CH.sub.3 (Me), unsubstituted ethyl (Et), unsubstituted propyl (Pr, e.g., unsubstituted n-propyl (n-Pr), unsubstituted isopropyl (i-Pr)), unsubstituted butyl (Bu, e.g., unsubstituted n-butyl (n-Bu), unsubstituted tert-butyl (tert-Bu or t-Bu), unsubstituted sec-butyl (sec-Bu), unsubstituted isobutyl (i-Bu)). In certain embodiments, the alkyl group is a substituted C.sub.1-10 alkyl (such as substituted C.sub.1-6 alkyl, e.g., CF.sub.3, Bn).

(377) The term haloalkyl is a substituted alkyl group, wherein one or more of the hydrogen atoms are independently replaced by a halogen, e.g., fluoro, bromo, chloro, or iodo. In some embodiments, the haloalkyl moiety has 1 to 8 carbon atoms (C.sub.1-8 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 6 carbon atoms (C.sub.1-6 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 4 carbon atoms (C.sub.1-4 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 3 carbon atoms (C.sub.1-3 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 2 carbon atoms (C.sup.1-2 haloalkyl). Examples of haloalkyl groups include CF.sub.3, CF.sub.2CF.sub.3, CF.sub.2CF.sub.2CF.sub.3, CCl.sub.3, CFCl.sub.2, CF.sub.2Cl, and the like.

(378) The term heteroalkyl refers to an alkyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkyl group refers to a saturated group having from 1 to 10 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-10 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 9 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-9 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 8 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-8 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 7 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-7 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 6 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-6 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 5 carbon atoms and 1 or 2 heteroatoms within the parent chain (heteroC.sub.1-5 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 4 carbon atoms and for 2 heteroatoms within the parent chain (heteroC.sub.1-4 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 3 carbon atoms and 1 heteroatom within the parent chain (heteroC.sub.1-3 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 2 carbon atoms and 1 heteroatom within the parent chain (heteroC.sub.1-2 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 carbon atom and 1 heteroatom (heteroC.sub.1 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 2 to 6 carbon atoms and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-6 alkyl). Unless otherwise specified, each instance of a heteroalkyl group is independently unsubstituted (an unsubstituted heteroalkyl) or substituted (a substituted heteroalkyl) with one or more substituents. In certain embodiments, the heteroalkyl group is an unsubstituted heteroC.sub.1-10 alkyl. In certain embodiments, the heteroalkyl group is a substituted heteroC.sub.1-10 alkyl.

(379) The term alkenyl refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 10 carbon atoms and one or more carbon-carbon double bonds (e.g., 1, 2, 3, or 4 double bonds). In some embodiments, an alkenyl group has 2 to 9 carbon atoms (C.sub.2-9 alkenyl). In some embodiments, an alkenyl group has 2 to 8 carbon atoms (C.sub.2-8 alkenyl). In some embodiments, an alkenyl group has 2 to 7 carbon atoms (C.sub.2-7 alkenyl). In some embodiments, an alkenyl group has 2 to 6 carbon atoms (C.sub.2-6 alkenyl). In some embodiments, an alkenyl group has 2 to 5 carbon atoms (C.sub.2-5 alkenyl). In some embodiments, an alkenyl group has 2 to 4 carbon atoms (C.sub.2-4 alkenyl). In some embodiments, an alkenyl group has 2 to 3 carbon atoms (C.sub.2-3 alkenyl). In some embodiments, an alkenyl group has 2 carbon atoms (C.sub.2 alkenyl). The one or more carbon-carbon double bonds can be internal (such as in 2-butenyl) or terminal (such as in 1-butenyl). Examples of C.sub.2-4 alkenyl groups include ethenyl (C.sub.2), 1-propenyl (C.sub.3), 2-propenyl (C.sub.3), 1-butenyl (C.sub.4), 2-butenyl (C.sub.4), butadienyl (C.sub.4), and the like. Examples of C.sub.2-6 alkenyl groups include the aforementioned C.sub.2-4 alkenyl groups as well as pentenyl (C.sub.5), pentadienyl (C.sub.5), hexenyl (C.sub.6), and the like. Additional examples of alkenyl include heptenyl (C.sub.7), octenyl (C.sub.8), octatrienyl (C.sub.8), and the like. Unless otherwise specified, each instance of an alkenyl group is independently unsubstituted (an unsubstituted alkenyl) or substituted (a substituted alkenyl) with one or more substituents. In certain embodiments, the alkenyl group is an unsubstituted C.sub.2-10 alkenyl. In certain embodiments, the alkenyl group is a substituted C.sub.2-10 alkenyl. In an alkenyl group, a CC double bond for which the stereochemistry is not specified (e.g., CHCHCH.sub.3 or

(380) ##STR00318##
may be an (E)- or (Z)-double bond.

(381) The term heteroalkenyl refers to an alkenyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkenyl group refers to a group having from 2 to 10 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-10 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 9 carbon atoms at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-9 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 8 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-8 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 7 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-7 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-6 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 5 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-5 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 4 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-4 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 3 carbon atoms, at least one double bond, and 1 heteroatom within the parent chain (heteroC.sub.2-3 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-6 alkenyl). Unless otherwise specified, each instance of a heteroalkenyl group is independently unsubstituted (an unsubstituted heteroalkenyl) or substituted (a substituted heteroalkenyl) with one or more substituents. In certain embodiments, the heteroalkenyl group is an unsubstituted heteroC.sub.2-10 alkenyl. In certain embodiments, the heteroalkenyl group is a substituted heteroC.sub.2-10 alkenyl.

(382) The term alkynyl refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 10 carbon atoms and one or more carbon-carbon triple bonds (e.g., 1, 2, 3, or 4 triple bonds) (C.sub.2-10alkynyl). In some embodiments, an alkynyl group has 2 to 9 carbon atoms (C.sub.2-9 alkynyl). In some embodiments, an alkynyl group has 2 to 8 carbon atoms (C.sub.2-8 alkynyl). In some embodiments, an alkynyl group has 2 to 7 carbon atoms (C.sub.2-7 alkynyl). In some embodiments, an alkynyl group has 2 to 6 carbon atoms (C.sub.2-6 alkynyl). In some embodiments, an alkynyl group has 2 to 5 carbon atoms (C.sub.2-5 alkynyl). In some embodiments, an alkynyl group has 2 to 4 carbon atoms (C.sub.2-4 alkynyl). In some embodiments, an alkynyl group has 2 to 3 carbon atoms (C.sub.2-3 alkynyl). In some embodiments, an alkynyl group has 2 carbon atoms (C.sub.2 alkynyl). The one or more carbon-carbon triple bonds can be internal (such as in 2-butynyl) or terminal (such as in 1-butynyl). Examples of C.sub.2-4 alkynyl groups include, without limitation, ethynyl (C.sub.2), 1-propynyl (C.sub.3), 2-propynyl (C.sub.3), 1-butynyl (C4), 2-butynyl (C4), and the like. Examples of C.sub.2-6 alkenyl groups include the aforementioned C.sub.2-4 alkynyl groups as well as pentynyl (C.sub.5), hexynyl (C.sub.6), and the like. Additional examples of alkynyl include heptynyl (C.sub.7), octynyl (C.sub.8), and the like. Unless otherwise specified, each instance of an alkynyl group is independently unsubstituted (an unsubstituted alkynyl) or substituted (a substituted alkynyl) with one or more substituents. In certain embodiments, the alkynyl group is an unsubstituted C.sub.2-10 alkynyl. In certain embodiments, the alkynyl group is a substituted C.sub.2-10 alkynyl.

(383) The term heteroalkynyl refers to an alkynyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (i.e., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkynyl group refers to a group having from 2 to 10 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-10 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 9 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-9 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 8 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-8 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 7 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-7 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-6 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 5 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-5 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 4 carbon atoms, at least one triple bond, and for 2 heteroatoms within the parent chain (heteroC.sub.2-4 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 3 carbon atoms, at least one triple bond, and 1 heteroatom within the parent chain (heteroC.sub.2-3 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-6 alkynyl). Unless otherwise specified, each instance of a heteroalkynyl group is independently unsubstituted (an unsubstituted heteroalkynyl) or substituted (a substituted heteroalkynyl) with one or more substituents. In certain embodiments, the heteroalkynyl group is an unsubstituted heteroC.sub.2-10 alkynyl. In certain embodiments, the heteroalkynyl group is a substituted heteroC.sub.2-10 alkynyl.

(384) The term carbocyclyl or carbocyclic refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 14 ring carbon atoms (C.sub.3-14 carbocyclyl) and zero heteroatoms in the non-aromatic ring system. In some embodiments, a carbocyclyl group has 3 to 10 ring carbon atoms (C.sub.3-10 carbocyclyl). In some embodiments, a carbocyclyl group has 3 to 8 ring carbon atoms (C.sub.3-8 carbocyclyl). In some embodiments, a carbocyclyl group has 3 to 7 ring carbon atoms (C.sub.3-7 carbocyclyl). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms (C.sub.3-6 carbocyclyl). In some embodiments, a carbocyclyl group has 4 to 6 ring carbon atoms (C.sub.4-6 carbocyclyl). In some embodiments, a carbocyclyl group has 5 to 6 ring carbon atoms (C.sub.5-6 carbocyclyl). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms (C.sub.5-10 carbocyclyl). Exemplary C.sub.3-6 carbocyclyl groups include, without limitation, cyclopropyl (C.sub.3), cyclopropenyl (C.sub.3), cyclobutyl (C.sub.4), cyclobutenyl (C.sub.4), cyclopentyl (C.sub.5), cyclopentenyl (C.sub.5), cyclohexyl (C.sub.6), cyclohexenyl (C.sub.6), cyclohexadienyl (C.sub.6), and the like. Exemplary C.sub.3-8 carbocyclyl groups include, without limitation, the aforementioned C.sub.3-6 carbocyclyl groups as well as cycloheptyl (C.sub.7), cycloheptenyl (C.sub.7), cycloheptadienyl (C.sub.7), cycloheptatrienyl (C.sub.7), cyclooctyl (C.sub.8), cyclooctenyl (C.sub.8), bicyclo[2.2.1]heptanyl (C7), bicyclo[2.2.2]octanyl (C.sub.8), and the like. Exemplary Ciao carbocyclyl groups include, without limitation, the aforementioned C.sub.3-8 carbocyclyl groups as well as cyclononyl (C.sub.9), cyclononenyl (C.sub.9), cyclodecyl (C.sub.10), cyclodecenyl (C.sub.10), octahydro-1H-indenyl (C.sub.9), decahydronaphthalenyl (C.sub.10), spiro[4.5]decanyl (C.sub.10), and the like. As the foregoing examples illustrate, in certain embodiments, the carbocyclyl group is either monocyclic (monocyclic carbocyclyl) or polycyclic (e.g., containing a fused, bridged or Spiro ring system such as a bicyclic system (bicyclic carbocyclyl) or tricyclic system (tricyclic carbocyclyl)) and can be saturated or can contain one or more carbon-carbon double or triple bonds. Carbocyclyl also includes ring systems wherein the carbocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclyl ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocyclic ring system. Unless otherwise specified, each instance of a carbocyclyl group is independently unsubstituted (an unsubstituted carbocyclyl) or substituted (a substituted carbocyclyl) with one or more substituents. In certain embodiments, the carbocyclyl group is an unsubstituted C.sub.3-14 carbocyclyl. In certain embodiments, the carbocyclyl group is a substituted C.sub.3-14 carbocyclyl.

(385) In some embodiments, carbocyclyl is a monocyclic, saturated carbocyclyl group having from 3 to 14 ring carbon atoms (C.sub.3-14 cycloalkyl). In some embodiments, a cycloalkyl group has 3 to 10 ring carbon atoms (C.sub.3-10 cycloalkyl). In some embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms (C.sub.3-8 cycloalkyl). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms (C.sub.3-6 cycloalkyl). In some embodiments, a cycloalkyl group has 4 to 6 ring carbon atoms (C.sub.4-6 cycloalkyl). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms (C.sub.5-6 cycloalkyl). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms (C.sub.5-10 cycloalkyl). Examples of C.sub.5-6 cycloalkyl groups include cyclopentyl (C.sub.5) and cyclohexyl (C.sub.5). Examples of C.sub.3-6 cycloalkyl groups include the aforementioned C.sub.5-6 cycloalkyl groups as well as cyclopropyl (C3) and cyclobutyl (C.sub.4). Examples of C.sub.3-8 cycloalkyl groups include the aforementioned C.sub.3-6 cycloalkyl groups as well as cycloheptyl (C.sub.7) and cyclooctyl (C.sub.8). Unless otherwise specified, each instance of a cycloalkyl group is independently unsubstituted (an unsubstituted cycloalkyl) or substituted (a substituted cycloalkyl) with one or more substituents. In certain embodiments, the cycloalkyl group is an unsubstituted C.sub.3-14 cycloalkyl. In certain embodiments, the cycloalkyl group is a substituted C.sub.3-14 cycloalkyl.

(386) The term heterocyclyl or heterocyclic refers to a radical of a 3- to 14-membered non-aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (3-14 membered heterocyclyl). In heterocyclyl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. A heterocyclyl group can either be monocyclic (monocyclic heterocyclyl) or polycyclic (e.g., a fused, bridged or spiro ring system such as a bicyclic system (bicyclic heterocyclyl) or tricyclic system (tricyclic heterocyclyl)), and can be saturated or can contain one or more carbon-carbon double or triple bonds. Heterocyclyl polycyclic ring systems can include one or more heteroatoms in one or both rings. Heterocyclyl also includes ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more carbocyclyl groups wherein the point of attachment is either on the carbocyclyl or heterocyclyl ring, or ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclyl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclyl ring system. Unless otherwise specified, each instance of heterocyclyl is independently unsubstituted (an unsubstituted heterocyclyl) or substituted (a substituted heterocyclyl) with one or more substituents. In certain embodiments, the heterocyclyl group is an unsubstituted 3-14 membered heterocyclyl. In certain embodiments, the heterocyclyl group is a substituted 3-14 membered heterocyclyl.

(387) In some embodiments, a heterocyclyl group is a 5-10 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-10 membered heterocyclyl). In some embodiments, a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-8 membered heterocyclyl). In some %/155 embodiments, a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-6 membered heterocyclyl). In some embodiments, the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur.

(388) Exemplary 3-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azirdinyl, oxiranyl, and thiiranyl. Exemplary 4-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azetidinyl, oxetanyl, and thietanyl. Exemplary -membered heterocyclyl groups containing 1 heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, and pyrrolyl-2,5-dione. Exemplary 5-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, dioxolanyl, oxathiolanyl and dithiolanyl. Exemplary 5-membered heterocyclyl groups containing 3 heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl. Exemplary 6-membered heterocyclyl groups containing 1 heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, triazinanyl. Exemplary 7-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl. Exemplary bicyclic heterocyclyl groups include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetrahydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl, octahydroisochromenyl, decahydronaphthyridinyl, decahydro-1,8-naphthyridinyl, octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl, naphthalimidyl, chromanyl, chromenyl, 1H-benzo[e][1,4]diazepinyl, 1,4,5,7-tetrahydropyrano[3,4-b]pyrrolyl, 5,6-dihydro-4H-furo[3,2-b]pyrrolyl, 6,7-dihydro-5H-furo[3,2-b]pyranyl, 5,7-dihydro-4H-thieno[2,3-c]pyranyl, 2,3-dihydro-1H-pyrrolo[2,3-b]pyridinyl, 2,3-dihydrofuro[2,3-b]pyridinyl, 4,5,6,7-tetrahydro-1H-pyrrolo[2,3-b]pyridinyl, 4,5,6,7-tetrahydrofuro[3,2-c]pyridinyl, 4,5,6,7-tetrahydrothieno[3,2-b]pyridinyl, 1,2,3,4-tetrahydro-1,6-naphthyridinyl, and the like.

(389) The term aryl refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 it electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system (C.sub.6-14 aryl). In some embodiments, an aryl group has 6 ring carbon atoms (C.sub.6 aryl; e.g., phenyl). In some embodiments, an aryl group has 10 ring carbon atoms (C.sub.10 aryl; e.g., naphthyl such as 1-naphthyl and 2-naphthyl). In some embodiments, an aryl group has 14 ring carbon atoms (C.sub.14 aryl; e.g., anthracyl). Aryl also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the aryl ring system. Unless otherwise specified, each instance of an aryl group is independently unsubstituted (an unsubstituted aryl) or substituted (a substituted aryl) with one or more substituents. In certain embodiments, the aryl group is an unsubstituted C.sub.6-14 aryl. In certain embodiments, the aryl group is a substituted C.sub.6-14 aryl.

(390) Aralkyl is a subset of alkyl and refers to an alkyl group substituted by an aryl group, wherein the point of attachment is on the alkyl moiety.

(391) The term heteroaryl refers to a radical of a 5-14 membered monocyclic or polycyclic (e.g., bicyclic, tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 it electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-14 membered heteroaryl). In heteroaryl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. Heteroaryl polycyclic ring systems can include one or more heteroatoms in one or both rings. Heteroaryl includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system. Heteroaryl also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused polycyclic (aryl/heteroaryl) ring system. Polycyclic heteroaryl groups wherein one ring does not contain a heteroatom (e.g., indolyl, quinolinyl, carbazolyl, and the like) the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl).

(392) In some embodiments, a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-10 membered heteroaryl). In some embodiments, a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-8 membered heteroaryl). In some embodiments, a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-6 membered heteroaryl). In some embodiments, the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur. Unless otherwise specified, each instance of a heteroaryl group is independently unsubstituted (an unsubstituted heteroaryl) or substituted (a substituted heteroaryl) with one or more substituents. In certain embodiments, the heteroaryl group is an unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is a substituted 5-14 membered heteroaryl.

(393) Exemplary 5-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyrrolyl, furanyl, and thiophenyl. Exemplary 5-membered heteroaryl groups containing 2 heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl. Exemplary 5-membered heteroaryl groups containing 3 heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl. Exemplary 5-membered heteroaryl groups containing 4 heteroatoms include, without limitation, tetrazolyl. Exemplary 6-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyridinyl. Exemplary 6-membered heteroaryl groups containing 2 heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl. Exemplary 6-membered heteroaryl groups containing 3 or 4 heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively. Exemplary 7-membered heteroaryl groups containing 1 heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl. Exemplary 5,6-bicyclic heteroaryl groups include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl. Exemplary 6,6-bicyclic heteroaryl groups include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl. Exemplary tricyclic heteroaryl groups include, without limitation, phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl and phenazinyl.

(394) Heteroaralkyl is a subset of alkyl and refers to an alkyl group substituted by a heteroaryl group, wherein the point of attachment is on the alkyl moiety.

(395) Affixing the suffix -ene to a group indicates the group is a divalent moiety, e.g., alkylene is the divalent moiety of alkyl, alkenylene is the divalent moiety of alkenyl, alkynylene is the divalent moiety of alkynyl, heteroalkylene is the divalent moiety of heteroalkyl, heteroalkenylene is the divalent moiety of heteroalkenyl, heteroalkynylene is the divalent moiety of heteroalkynyl, carbocyclylene is the divalent moiety of carbocyclyl, heterocyclylene is the divalent moiety of heterocyclyl, arylene is the divalent moiety of aryl, and heteroarylene is the divalent moiety of heteroaryl.

(396) A group is optionally substituted unless expressly provided otherwise. The term optionally substituted refers to being substituted or unsubstituted. In certain embodiments, alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups are optionally substituted. Optionally substituted refers to a group which may be substituted or unsubstituted (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted heteroalkenyl, substituted or unsubstituted heteroalkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl or substituted or unsubstituted heteroaryl group). In general, the term substituted means that at least one hydrogen present on a group is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction. Unless otherwise indicated, a substituted group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position. The term substituted is contemplated to include substitution with all permissible substituents of organic compounds, and includes any one of the substituents described herein that results in the formation of a stable compound. The present disclosure contemplates any and all such combinations in order to arrive at a stable compound. For purposes of this disclosure, heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety. The disclosure is not intended to be limited in any manner by the exemplary substituents described herein.

(397) Exemplary carbon atom substituents include, but are not limited to, halogen, CN, NO.sub.2, N.sub.3, SO.sub.2H, SO.sub.3H, OH, OR.sup.aa, ON(R.sup.bb).sub.2, N(R.sup.bb).sub.2, N(R.sup.bb).sub.3.sup.+X.sup., N(OR.sup.cc)R.sup.bb, SH, SR.sup.aa, SSR.sup.cc, C(O)R.sup.aa, CO.sub.2H, CHO, C(OR.sup.cc).sub.2, CO.sub.2R.sup.aa, OC(O)R.sup.aa, OCO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, OC(O)N(R.sup.bb).sub.2, NR.sup.bbC(O)R.sup.aa, NR.sup.bbCO.sub.2R.sup.aa, NR.sup.bbC(O)N(R.sup.bb).sub.2, C(NR.sup.bb)R.sup.aa, C(NR.sup.bb)OR.sup.aa, OC(NR.sup.bb)R.sup.aa, OC(NR.sup.bb)OR.sup.aa, C(NR.sup.bb)N(R.sup.bb).sub.2, OC(NR.sup.bb)N(R.sup.bb).sub.2, NR.sup.bbC(NR.sup.bb)N(R.sup.bb).sub.2, C(O)NR.sup.bbSO.sub.2R.sup.aa, NR.sup.bbSO.sub.2R.sup.aa, SO.sub.2N(R.sup.bb).sub.2, SO.sub.2R.sup.aa, SO.sub.2OR.sup.aa, OSO.sub.2R.sup.aa, S(O)R.sup.aa, OS(O)R.sup.aa, Si(R.sup.aa).sub.3, OSi(R.sup.aa).sub.3C(S)N(R.sup.bb).sub.2, C(O)SR.sup.aa, C(S)SR.sup.aa, SC(S)SR.sup.aa, SC(O)SR.sup.aa, OC(O)SR.sup.aa, SC(O)OR.sup.aa, SC(O)R.sup.aa, P(O)(R.sup.aa).sub.2, P(O)(OR.sup.cc).sub.2, OP(O)(R.sup.aa).sub.2, OP(O)(OR.sup.cc).sub.2, P(O)(N(R.sup.bb).sub.2).sub.2, OP(O)(N(R.sup.bb).sub.2).sub.2, NR.sup.bbP(O)(R.sup.aa).sub.2, NR.sup.bbP(O)(OR.sup.cc).sub.2, NR.sup.bbP(O)(N(R.sup.bb).sub.2).sub.2, P(R.sup.cc).sub.2, P(OR.sup.cc).sub.2, P(R.sup.cc).sub.3.sup.+X.sup., P(OR.sup.cc).sub.3.sup.+X.sup., P(R.sup.cc).sub.4, P(OR.sup.cc).sub.4, OP(R.sup.cc).sub.2, OP(R.sup.cc).sub.3.sup.+X.sup., OP(OR.sup.cc).sub.2, OP(OR.sup.cc).sub.3.sup.+X.sup., OP(R.sup.cc).sub.4, OP(OR.sup.cc).sub.1, B(R.sup.aa).sub.2, B(OR.sup.cc).sub.2, BR.sup.aa(OR.sup.cc), C.sub.1-10 alkyl. C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, heteroC.sub.1-10 alkyl, heteroC.sub.2-10 alkenyl, heteroC.sub.2-10 alkynyl, Ciao carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups; wherein X.sup. is a counterion; or two geminal hydrogens on a carbon atom are replaced with the group O, S, NN(R.sup.bb).sub.2, NNR.sup.bbC(O)R.sup.aa, NNR.sup.bbC(O)OR.sup.aa, NNR.sup.bbS(O).sub.2R.sup.aa, NR.sup.bb, or NOR.sup.cc;

(398) each instance of R.sup.11 is, independently, selected from C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, heteroC.sub.1-10 alkyl, heteroC.sub.2-10alkenyl, heteroC.sub.2-10alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two R.sup.aa groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups; each instance of R.sup.bb is, independently, selected from hydrogen, OH, OR.sup.aa, N(R.sup.cc).sub.2, CN, C(O)R.sup.aa, C(O)N(R.sup.cc).sub.2, CO.sub.2R.sup.aa, SO.sub.2R.sup.aa, C(NR.sup.cc)OR.sup.aa, C(NR.sup.cc)N(R.sup.cc).sub.2, SO.sub.2N(R.sup.cc).sub.2, SO.sub.2R.sup.cc, SO.sub.2OR.sup.cc, SOR.sup.aa, C(S)N(R.sup.cc).sub.2, C(O)SR.sup.cc, C(S)SR.sup.cc, P(O)(R.sup.aa).sub.2, P(O)(OR.sup.cc).sub.2, P(O)(N(R.sup.cc).sub.2).sub.2, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, heteroC.sub.1-10alkyl, heteroC.sub.2-10alkenyl, heteroC.sub.2-10alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two R.sup.bb groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups: wherein X.sup.is a counterion:

(399) each instance of R.sup.cc is, independently, selected from hydrogen, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10alkenyl, C.sub.2-10 alkynyl, heteroC.sub.1-10 alkyl, heteroC.sub.2-10 alkenyl, heteroC.sub.2-10alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two R.sup.cc groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups:

(400) each instance of R.sup.dd is, independently, selected from halogen, CN. NO.sub.2, N.sub.3, SO.sub.2H, SO.sub.3H, OH, OR.sup.ee, ON(R.sup.ff).sub.2, N(R.sup.ff).sub.2, N(R.sup.ff).sub.3.sup.+X.sup., N(OR.sup.ee)R.sup.ff, SH, SR.sup.ee, SSR.sup.ee, C(O)R.sup.ee, CO.sub.2H, CO.sub.2R.sup.ee, OC(O)R.sup.ee, OCO.sub.2R.sup.ee, C(O)N(R.sup.ff).sub.2, OC(O)N(R.sup.ff).sub.2, NR.sup.ffC(O)R.sup.ee, NR.sup.ffCO.sub.2R.sup.ee, NR.sup.ffC(O)N(R.sup.ff).sub.2, (NR.sup.ff)OR.sup.ee, OC(NR.sup.ff)R.sup.ee, OC(NR.sup.ff)OR.sup.ee, C(NR.sup.ff)N(R.sup.ff).sub.2, OC(NR.sup.ff)N(R.sup.ff).sub.2, NR.sup.ffC(NR.sup.ff)N(R.sup.ff).sub.2, NR.sup.ffSO.sub.2R.sup.ee, SO.sub.2N(R.sup.ff).sub.2, SO.sub.2R.sup.ee, SO.sub.2OR.sup.ee, OSO.sub.2R.sup.ee, S(O)R.sup.ee, Si(R.sup.ee).sub.3, OSi(R.sup.ee).sub.3, C(S)N(R.sup.ff).sub.2, C(O)SR.sup.ee, C(S)SR.sup.ee, SC(S)SR.sup.ee, P(O)(OR.sup.ee).sub.2, P(O)(R.sup.ee).sub.2, OP(O)(R.sup.ee).sub.2, OP(O)(OR.sup.ee).sub.2, C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, heteroC.sub.1-6alkyl, heteroC.sub.2-6alkenyl, heteroC.sub.2-6alkynyl, C.sub.3-10 carbocyclyl, 3-10 membered heterocyclyl, C.sub.6-10 aryl, 5-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.gg groups, or two geminal R.sup.dd substituents can be joined to form O or S; wherein X is a counterion:

(401) each instance of R.sup.ee is, independently, selected from C.sub.1-6 alkyl. C.sub.1-6 perhaloalkyl. C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, heteroC.sub.1-6 alkyl, heteroC.sub.2-6alkaryl, heteroC.sub.2-6 alkynyl, C.sub.3-10 carbocyclyl, C.sub.6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.1 groups;

(402) each instance of R.sup.ff is, independently, selected from hydrogen, C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, heteroC.sub.1-6alkyl, heteroC.sub.2-6alkenyl, heteroC.sub.2-6alkynyl, C.sub.3-10 carbocyclyl, 3-10 membered heterocyclyl, C.sub.6-10 aryl and 5-10 membered heteroaryl, or two R.sup.ff groups are joined to form a 3-10 membered heterocyclyl or 5-10 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.gg groups: and

(403) each instance of R.sup.gg is, independently, halogen, CN, NO.sub.2, N.sub.3, SO.sub.2H, SO.sub.3H, OH, OC.sub.1-6 alkyl, ON(C.sub.1-6 alkyl).sub.2, N(C.sub.1-6 alkyl).sub.2, N(C.sub.1-6 alkyl).sub.3.sup.+X.sup., NH(C.sub.1-6 alkyl).sub.2.sup.+X.sup., NH.sub.2(C.sub.1-6 alkyl).sup.+X.sup., NH.sub.3.sup.+X.sup., N(OC.sub.1-6 alkyl)(C.sub.1-6 alkyl), N(OH)(C.sub.1-6 alkyl), NH(OH), SH, SC.sub.1-6 alkyl, SS(C.sub.1-6 alkyl), C(O)(C.sub.1-6 alkyl), CO.sub.2H, CO.sub.2(C.sub.1-6 alkyl), OC(O)(C.sub.1-6 alkyl), OCO.sub.2(C.sub.1-6 alkyl), C(O)NH.sub.2, C(O)N(C.sub.1-6 alkyl).sub.2, OC(O)NH(C.sub.1-6 alkyl), NHC(O)(C.sub.1-6 alkyl), N(C.sub.1-6 alkyl)C(O)(C.sub.1-6 alkyl), NHCO.sub.2(C.sub.1-6 alkyl), NHC(O)N(C.sub.1-6 alkyl).sub.2, NHC(O)NH(C.sub.1-6 alkyl), NHC(O)NH.sub.2, C(NH)O(C.sub.1-6 alkyl), OC(NH)(C.sub.1-6 alkyl), OC(NH)OC.sub.1-6alkyl, C(NH)N(C.sub.1-6 alkyl).sub.2, C(NH)NH(C.sub.1-6 alkyl), C(NH)NH.sub.2, OC(NH)N(C.sub.1-6 alkyl).sub.2, OC(NH)NH(C.sub.1-6 alkyl), OC(NH)NH.sub.2, NHC(NH)N(C.sub.1-6 alkyl).sub.2, NHC(NH)NH.sub.2, NHSO.sub.2(C.sub.1-6 alkyl), SO.sub.2N(C.sub.1-6 alkyl).sub.2, SO.sub.2NH(C.sub.1-6 alkyl), SO.sub.2NH.sub.2, SO.sub.2C.sub.1-6 alkyl, SO.sub.2OC.sub.1-6 alkyl, OSO.sub.2C.sub.1-6 alkyl, SOC.sub.1-6 alkyl, Si(C.sub.1-6 alkyl).sub.3, OSi(C.sub.1-6 alkyl), C(S)N(C.sub.1-6 alkyl).sub.2, C(S)NH(C.sub.1-6 alkyl), C(S)NH.sub.2, C(O)S(C.sub.1-6 alkyl), C(S)SC.sub.1-6 alkyl, SC(S)SC.sub.1-6 alkyl, P(O)(OC.sub.1-6 alkyl).sub.2, P(O)(C.sub.1-6 alkyl).sub.2, OP(O)(C.sub.1-6 alkyl).sub.2, OP(O)(OC.sub.1-6 alkyl).sub.2, C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, heteroC.sub.1-6alkyl, heteroC.sub.2-6alkenyl, heteroC.sub.2-6alkynyl, C.sub.3-10 carbocyclyl, C.sub.6-10 aryl, 3-10 membered heterocyclyl, 5-10 membered heteroaryl; or two geminal R.sup.gg substituents can be joined to form O or S; wherein X.sup. is a counterion.

(404) The term halo or halogen refers to fluorine (fluoro, F), chlorine (chloro, Cl), bromine (bromo, Br), or iodine (iodo, I).

(405) The term hydroxyl or hydroxy refers to the group OH. The term substituted hydroxyl or substituted hydroxyl, by extension, refers to a hydroxyl group wherein the oxygen atom directly attached to the parent molecule is substituted with a group other than hydrogen, and includes groups selected from OR.sup.aa, ON(R.sup.bb).sub.2, OC(O)SR.sup.aa, OC(O)R.sup.aa, OCO.sub.2R.sup.aa, OC(O)N(R.sup.bb).sub.2, OC(NR.sup.bb)R.sup.aa, OC(NR.sup.bb)OR.sup.aa, OC(NR.sup.bb)N(R.sup.bb).sub.2, OS(O)R.sup.aa, OSO.sub.2R.sup.aa, OSi(R.sup.aa).sub.3, OP(R.sup.cc).sub.2, OP(R.sup.cc).sub.3.sup.+X.sup., OP(OR.sup.cc).sub.2, OP(OR.sup.cc).sub.3.sup.+X.sup., OP(O)(R.sup.aa).sub.2, OP(O)(OR.sup.cc).sub.2, and OP(O)(N(R.sup.bb)).sub.2, wherein X.sup., R.sup.aa, R.sup.bb, and R.sup.cc are as defined herein.

(406) The term amino refers to the group NH.sub.2. The term substituted amino, by extension, refers to a monosubstituted amino, a disubstituted amino, or a trisubstituted amino. In certain embodiments, the substituted amino is a monosubstituted amino or a disubstituted amino group.

(407) The term monosubstituted amino refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with one hydrogen and one group other than hydrogen, and includes groups selected from NH(R.sup.bb), NHC(O)R.sup.aa, NHCO.sub.2R.sup.aa, NHC(O)N(R.sup.bb).sub.2, NHC(NR.sup.bb)N(R.sup.bb).sub.2, NHSO.sub.2R.sup.aa, NHP(O)(OR.sup.cc).sub.2, and NHP(O)(N(R.sup.bb).sub.2).sub.2, wherein R.sup.aa, R.sup.bb and R.sup.cc are as defined herein, and wherein R.sup.bb of the group NH(R.sup.bb) is not hydrogen.

(408) The term disubstituted amino refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with two groups other than hydrogen, and includes groups selected from N(R.sup.bb).sub.2, NR.sup.bb C(O)R.sup.aa, NR.sup.bbCO.sub.2R.sup.aa, NR.sup.bbC(O)N(R.sup.bb).sub.2, NR.sup.bbC(NR.sup.bb)N(R.sup.bb).sub.2, NR.sup.bbSO.sub.2R.sup.aa, NR.sup.bbP(O)(OR.sup.cc).sub.2, and NR.sup.bbP(O)(N(R.sup.bb).sub.2).sub.2, wherein R.sup.aa, R.sup.bb, and R.sup.cc are as defined herein, with the proviso that the nitrogen atom directly attached to the parent molecule is not substituted with hydrogen.

(409) The term trisubstituted amino refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with three groups, and includes groups selected from N(R.sup.bb); and N(R.sup.bb).sub.3.sup.+X.sup., wherein R.sup.bb and X.sup. are as defined herein.

(410) The term sulfonyl refers to a group selected from SO.sub.2N(R.sup.bb).sub.2, SO.sub.2R.sup.aa, and SO.sub.2OR.sup.aa, wherein R.sup.aa and R.sup.bb are as defined herein.

(411) The term sulfinyl refers to the group S(O)R.sup.aa, wherein R.sup.aa is as defined herein.

(412) The term acyl refers to a group having the general formula C(O)R.sup.X1, C(O)OR.sup.X1, C(O)OC(O)R.sup.X1, C(O)SR.sup.X1, C(O)N(R.sup.X1).sub.2, C(S)R.sup.X1, C(S)N(R.sup.X1).sub.2, and C(S)S(R.sup.X1), C(NR.sup.X1)R.sup.X1, C(NR.sup.X1)OR.sup.X1, C(NR.sup.X1)SR.sup.X1, and C(NR.sup.X1)N(R.sup.X1).sub.2, wherein R.sup.X1 is hydrogen: halogen; substituted or unsubstituted hydroxyl: substituted or unsubstituted thiol: substituted or unsubstituted amino: substituted or unsubstituted acyl, cyclic or acyclic, substituted or unsubstituted, branched or unbranched aliphatic; cyclic or acyclic, substituted or unsubstituted, branched or unbranched heteroaliphatic; cyclic or acyclic, substituted or unsubstituted, branched or unbranched alkyl; cyclic or acyclic, substituted or unsubstituted, branched or unbranched alkenyl: substituted or unsubstituted alkynyl: substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, aliphaticoxy, heteroaliphaticoxy, alkyloxy, heteroalkyloxy, aryloxy, heteroaryloxy, aliphaticthioxy, heteroaliphaticthioxy, alkylthioxy, heteroalkylthioxy, arylthioxy, heteroarylthioxy, mono- or di-aliphaticamino, mono- or di-heteroaliphaticamino, mono- or di-alkylamino, mono- or di-heteroalkylamino, mono- or di-arylamino, or mono- or di-heteroarylamino; or two R.sup.X1 groups taken together form a 5- to 6-membered heterocyclic ring. Exemplary acyl groups include aldehydes (CHO), carboxylic acids (CO.sub.2H), ketones, acyl halides, esters, amides, imines, carbonates, carbamates, and ureas. Acyl substituents include, but are not limited to, any one of the substituents described herein, that result in the formation of a stable moiety (e.g., aliphatic, alkyl, alkenyl, alkynyl, heteroaliphatic, heterocyclic, aryl, heteroaryl, acyl, oxo, imino, thiooxo, cyano, isocyano, amino, azido, nitro, hydroxyl, thiol, halo, aliphaticamino, heteroaliphaticamino, alkylamino, heteroalkylamino, arylamino, heteroarylamino, alkylaryl, arylalkyl, aliphaticoxy, heteroaliphaticoxy, alkyloxy, heteroalkyloxy, aryloxy, heteroaryloxy, aliphaticthioxy, heteroaliphaticthioxy, alkylthioxy, heteroalkylthioxy, arylthioxy, heteroarylthioxy, acyloxy, and the like, each of which may or may not be further substituted).

(413) The term carbonyl refers a group wherein the carbon directly attached to the parent molecule is sp.sup.2 hybridized, and is substituted with an oxygen, nitrogen or sulfur atom, e.g., a group selected from ketones (C(O)R.sup.aa), carboxylic acids (CO.sub.2H), aldehydes (CHO), esters (CO.sub.2R.sup.aa, C(O)SR.sup.aa, C(S)SR.sup.aa), amides (C(O)N(R.sup.bb).sub.2, C(O)NR.sup.bbSO.sub.2R.sup.aa, C(S)N(R.sup.bb).sub.2), and imines (C(NR.sup.bb)R.sup.aa, C(NR.sup.bb)OR.sup.aa), C(NR.sup.bb)N(R.sup.bb).sub.2), wherein R.sup.aa and R.sup.bb are as defined herein.

(414) The term silyl refers to the group Si(R.sup.aa).sub.3, wherein R.sup.aa is as defined herein.

(415) The term oxo refers to the group O, and the term thiooxo refers to the group S.

(416) Nitrogen atoms can be substituted or unsubstituted as valency permits, and include primary, secondary, tertiary, and quaternary nitrogen atoms. Exemplary nitrogen atom substituents include, but are not limited to, hydrogen, OH, OR.sup.aa, N(R.sup.cc).sub.2, CN, C(O)R.sup.aa, C(O)N(R.sup.cc).sub.2, CO.sub.2R.sup.aa, SO.sub.2R.sup.aa, C(NR.sup.bb)R.sup.aa, C(NR.sup.cc)OR.sup.aa, C(NR.sup.cc)N(R.sup.cc).sub.2, SO.sub.2N(R.sup.cc).sub.2, SO.sub.2R.sup.cc, SO.sub.2OR.sup.cc, SOR.sup.aa, C(S)N(R.sup.cc).sub.2, C(O)SR.sup.cc, C(S)SR.sup.cc, P(O)(OR.sup.cc).sub.2, P(O)(R.sup.aa).sub.2, P(O)(N(R.sup.cc).sub.2).sub.2, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, heteroC.sub.1-10alkyl, heteroC.sub.2-10alkenyl, heteroC.sub.2-10alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two R.sup.11 groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups, and wherein R.sup.aa, R.sup.bb, R.sup.cc and R.sup.dd are as defined above.

(417) In certain embodiments, the substituent present on the nitrogen atom is a nitrogen protecting group (also referred to herein as an amino protecting group). Nitrogen protecting groups include, but are not limited to, OH, OR.sup.aa, N(R.sup.cc).sub.2, C(O)R.sup.aa, C(O)N(R.sup.cc).sub.2, CO.sub.2R.sup.aa, SO.sub.2R.sup.aa, C(NR.sup.cc)R.sup.aa, C(NR.sup.cc)OR.sup.aa, C(NR.sup.cc)N(R.sup.cc).sub.2, SO.sub.2N(R.sup.cc).sub.2, SO.sub.2R.sup.cc, SO.sub.2OR.sup.cc, SOR.sup.aa, C(S)N(R.sup.cc).sub.2, C(O)SR.sup.cc, C(S)SR.sup.cc, C.sub.1-10 alkyl (e.g., aralkyl, heteroaralkyl), C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, heteroC.sub.1-10 alkyl, heteroC.sub.2-10 alkenyl, heteroC.sub.2-10 alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups, and wherein R.sup.aa, R.sup.bb, R.sup.cc, and R.sup.dd are as defined herein. Nitrogen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3.sup.rd edition, John Wiley & Sons, 1999, incorporated herein by reference.

(418) For example, nitrogen protecting groups such as amide groups (e.g., C(O)R.sup.aa) include, but are not limited to, formamide, acetamide, chloroacetamide, trichloroacetamide, trifluoroacetamide, phenylacetamide, 3-phenylpropanamide, picolinamide, 3-pyridylcarboxamide, N-benzoylphenylalanyl derivative, benzamide, p-phenylbenzamide, o-nitophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (N-dithiobenzyloxyacylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o-nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanamide, 2-methyl-2-(0-phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl-3-nitrobutanamide, o-nitrocinnamide, N-acetylmethionine derivative, o-nitrobenzamide, and o-(benzoyloxymethyl)benzamide.

(419) Nitrogen protecting groups such as carbamate groups (e.g., C(O)OR.sup.aa) include, but are not limited to, methyl carbamate, ethyl carbamante, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluoroenylmethyl carbamate, 2,7-di-t-butyl-[9-(10,10-dioxo-10,10,10,10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1-(1-adamantyl)-1-methylethyl carbamate (Adpoc), 1,1-dimethyl-2-haloethyl carbamate, 1,1-dimethyl-2,2-dibromoethyl carbamate (DB-t-BOC), 1,1-dimethyl-2,2,2-trichloroethyl carbamate (TCBOC), 1-methyl-1-(4-biphenylyl)ethyl carbamate (Bpoc), 1-(3,5-di-t-butylphenyl)-1-methylethyl carbamate (t-Bumeoc), 2-(2- and 4-pyridyl)ethyl carbamate (Pyoc), 2-(N,N-dicyclohexylcarboxamido)ethyl carbamate, t-butyl carbamate (BOC or Boc), 1-adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl carbamate (Alloc), 1-isopropylallyl carbamate (Ipaoc), cinnamyl carbamate (Coc), 4-nitrocinnamyl carbamate (Noc), 8-quinolyl carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate, benzyl carbamate (Cbz), p-methoxybenzyl carbamate (Moz), p-nitobenzyl carbamate, p-bromobenzyl carbamate, p-chlorobenzyl carbamate, 2,4-dichlorobenzyl carbamate, 4-methylsulfinylbenzyl carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl carbamate, 2-methylthioethyl carbamate, 2-methylsulfonylethyl carbamate, 2-(p-toluenesulfonyl)ethyl carbamate, [2-(1,3dithianyl)]methyl carbamate (Dmoc), 4-methylthiophenyl carbamate (Mtpc), 2,4-dimethylthiophenyl carbamate (Bmpc), 2-phosphonioethyl carbamate (Peoc), 2-triphenylphosphonioisopropyl carbamate (Ppoc), 1,1-dimethyl-2-cyanoethyl carbamate, m-chloro-p-acyloxybenzyl carbamate, p-(dihydroxyboryl)benzyl carbamate, 5-benzisoxazolylmethyl carbamate, 2-(trifluoromethyl)-6-chromonylmethyl carbamate (Tcroc), m-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate, o-nitrobenzyl carbamate, 3,4-dimethoxy-6-nitrobenzyl carbamate, phenyl(o-nitrophenyl)methyl carbamate, t-amyl carbamate, S-benzyl thiocarbamate, p-cyanobenzyl carbamate, cyclobutyl carbamate, cyclohexyl carbamate, cyclopentyl carbamate, cyclopropylmethyl carbamate, p-decyloxybenzyl carbamate, 2,2-dimethoxyacylvinyl carbamate, o-(N,N-dimethylcarboxamido)benzyl carbamate, 1,1-dimethyl-3-(N,N-dimethylcarboxamido)propyl carbamate, 1,1-dimethylpropynyl carbamate, di(2-pyridyl)methyl carbamate, 2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl carbamate, isobutyl carbamate, isonicotinyl carbamate, p-(p-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl carbamate, 1-methylcyclohexyl carbamate, 1-methyl-1-cyclopropylmethyl carbamate, 1-methyl-1-(3,5-dimethoxyphenyl)ethyl carbamate, 1-methyl-1-(p-phenylazophenyl)ethyl carbamate, 1-methyl-1-phenylethyl carbamate, 1-methyl-1-(4-pyridyl)ethyl carbamate, phenyl carbamate, p-(phenylazo)benzyl carbamate, 2,4,6-tri-t-butylphenyl carbamate, 4-(trimethylammonium)benzyl carbamate, and 2,4,6-trimethylbenzyl carbamate.

(420) Nitrogen protecting groups such as sulfonamide groups (e.g., S(O).sub.2R.sup.ee) include, but are not limited to, p-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6-trimethyl-4-methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6-dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5,6-tetramethyl-4-methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6-trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc), methanesulfonamide (Ms), -trimethylsilylethanesulfonamide (SES), 9-anthracenesulfonamide, 4-(4,8-dimethoxynaphthylmethyl)benzenesulfonamide (DNMBS), benzylsulfonamide, trifluoromethylsulfonamide, and phenacylsulfonamide.

(421) Other nitrogen protecting groups include, but are not limited to, phenothiazinyl-(10)-acyl derivative, N-p-toluenesulfonylaminoacyl derivative, N-phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl-3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-1,1,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted 1,3-dimethyl-1,3,5-triazacyclohexan-2-one, 5-substituted 1,3-dibenzyl-1,3,5-triazacyclohexan-2-one, 1-substituted 3,5-dinitro-4-pyridone, N-methylamine, N-allylamine, N-[2-(trimethylsilyl)ethoxy]methylamine (SEM), N-3-acetoxypropylamine, N-(1-isopropyl-4-nitro-2-olio-3-pyroolin-3-yl)amine, quaternary ammonium salts. N-benzylamine, N-di(4-methoxyphenyl)methylamine, N-5-dibenzosuberylamine, N-triphenylmethylamine (Tr), N-[(4-methoxyphenyl)diphenylmethyl]amine (MMTr), N-9-phenylfluorenylamine (PhF), N-2,7-dichloro-9-fluorenylmethyleneamine, N-ferrocenylmethylamino (Fcm), N-2-picolylamino N-oxide, N-1,1-dimethylthiomethyleneamine, N-benzylideneamine, N-p-methoxybenzylideneamine, N-diphenylmethyleneamine, N-[(2-pyridyl)mesityl](methyleneamine, N(N,N-dimethylaminomethylene)amine, N,N-isopropylidenediamine, N-p-nitrobenzylideneamine, N-salicylideneamine, N-5-chlorosalicylideneamine, N-(5-chloro-2-hydroxyphenyl)phenylmethyleneamine, N-cyclohexylideneamine, N-(5,5-dimethyl-3-oxo-1-cyclohexenyl)amine, N-borane derivative, N-diphenylborinic acid derivative, N-[phenyl(pentaacylchromium- or tungsten)acyl]amine, N-copper chelate, N-zinc chelate, N-nitroamine, N-nitrosoamine, amine N-oxide, diphenylphosphinamide (Dpp), dimethylthiophosphinamide (Mpt), diphenylthiophosphinamide (Ppt), dialkyl phosphoramidates, dibenzyl phosphoramidate, diphenyl phosphoramidate, benzenesulfenamide, o-nitrobenzenesulfenamide (Nps), 2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide, triphenylmethylsulfenamide, and 3-nitropyridinesulfenamide (Npys).

(422) In certain embodiments, the substituent present on an oxygen atom is an oxygen protecting group (also referred to herein as an hydroxyl protecting group). Oxygen protecting groups include, but are not limited to, R.sup.aa, N(R.sup.bb).sub.2, C(O)SR.sup.aa, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, C(NR.sup.bb)R.sup.aa, C(NR.sup.bb)OR.sup.aa, C(NR.sup.bb)N(R.sup.bb).sub.2, S(O)R.sup.aa, SO.sub.2R.sup.aa, Si(R.sup.aa).sub.3, P(R.sup.cc).sub.2, P(R.sup.cc).sub.3.sup.+X.sup., P(OR.sup.cc).sub.2, P(OR.sup.cc).sub.3.sup.+X.sup., P(O)(R.sup.aa).sub.2, P(O)(OR.sup.cc).sub.2, and P(O)(N(R.sup.bb).sub.2).sub.2, wherein X.sup., R.sup.aa, R.sup.bb, and R.sup.cc are as defined herein. Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3.sup.rd edition, John Wiley & Sons, 1999, incorporated herein by reference.

(423) Exemplary oxygen protecting groups include, but are not limited to, methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), t-butylthiomethyl, (phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p-methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM), guaiacolmethyl (GUM), t-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl, 2-methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl, bis(2-chloroethoxy)methyl, 2-(trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3-bromotetrahydropyranyl, tetrahydrothiopyranyl, 1-methoxycyclohexyl, 4-methoxytetrahydropyranyl (MTHP), 4-methoxytetrahydrothiopyranyl, 4-methoxytetrahydrothiopyranyl S,S-dioxide, 1-[(2-chloro-4-methyl)phenyl]-4-methoxypiperidin-4-yl (CTMP), 1,4-dioxan-2-yl, tetrahydrofuranyl, tetrahydrothiofuranyl, 2,3,3a, 4,5,6,7,7a-octahydro-7,8,8-trimethyl-4,7-methanobenzofuran-2-yl, 1-ethoxyethyl, 1-(2-chloroethoxy)ethyl, 1-methyl-1-methoxyethyl, 1-methyl-1-benzyloxyethyl, 1-methyl-1-benzyloxy-2-fluoroethyl, 2,2,2-trichloroethyl, 2-trimethylsilylethyl, 2-(phenylselenyl)ethyl, t-butyl, allyl, p-chlorophenyl, p-methoxyphenyl, 2,4-dinitrophenyl, benzyl (Bn), p-methoxybenzyl, 3,4-dimethoxybenzyl, o-nitrobenzyl, p-nitrobenzyl, p-halobenzyl, 2,6-dichlorobenzyl, p-cyanobenzyl, p-phenylbenzyl, 2-picolyl, 4-picolyl, 3-methyl-2-picolyl N-oxido, diphenylmethyl, p,p-dinitrobenzhydryl, 5-dibenzosuberyl, triphenylmethyl, -naphthyldiphenylmethyl, p-methoxyphenyldiphenylmethyl, di(p-methoxyphenyl)phenylmethyl, trip-methoxyphenyl)methyl, 4-(4-bromophenacyloxyphenyl)diphenylmethyl, 4,4,4-tris(4,5-dichlorophthalimidophenyl)methyl, 4,4,4-tris(levulinoyloxyphenyl)methyl, 4,4,4-tris(benzoyloxyphenyl)methyl, 3-(imidazol-1-yl)bis(4,4-dimethoxyphenyl)methyl, 1,1-bis(4-methoxyphenyl)-1-pyrenylmethyl, 9-anthryl, 9-(9-phenyl)xanthenyl, 9-(9-phenyl-10-oxo)anthryl, 1,3-benzodithiolan-2-yl, benzisothiazolyl S,S-dioxido, trimethylsilyl (TMS), triethylsilyl (TES), triisopropylsilyl (TIPS), dimethylisopropylsilyl (IPDMS), diethylisopropylsilyl (DEIPS), dimethylthexylsilyl, t-butyldimethylsilyl (TBDMS), 1-butyldiphenylsilyl (TBDPS), tribenzylsilyl, trip-xylylsilyl, triphenylsilyi, diphenylmethylsilyl (DPMS), t-butylmethoxyphenylsilyl (TBMPS), formate, benzoylformate, acetate, chloroacetate, dichloroacetate, trichloroacetate, trifluoroacetate, methoxyacetate, triphenylmethoxyacetate, phenoxyacetate, p-chlorophenoxyacetate, 3-phenylpropionate, 4-oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate (levulinoyldithioacetal), pivaloate, adamantoate, crotonate, 4-methoxycrotonate, benzoate, p-phenylbenzoate, 2,4,6-trimethylbenzoate (mesitoate), methyl carbonate, 9-fluorenylmethyl carbonate (Fmoc), ethyl carbonate, 2,2,2-trichloroethyl carbonate (Troc), 2-(trimethylsilyl)ethyl carbonate (TMSEC), 2-(phenylsulfonyl) ethyl carbonate (Psec), 2-(triphenylphosphonio) ethyl carbonate (Peoc), isobutyl carbonate, vinyl carbonate, ally) carbonate, t-butyl carbonate (BOC or Boc), p-nitrophenyl carbonate, benzyl carbonate, p-methoxybenzyl carbonate, 3,4-dimethoxybenzyl carbonate, o-nitrobenzyl carbonate, p-nitrobenzyl carbonate, S-benzyl thiocarbonate, 4-ethoxy-1-napththyl carbonate, methyl dithiocarbonate, 2-iodobenzoate, 4-azidobutyrate, 4-nitro-4-methylpentanoate, o-(dibromomethyl)benzoate, 2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl, 4-(methylthiomethoxy)butyrate, 2-(methylthiomethoxymethyl)benzoate, 2,6-dichloro-4-methylphenoxyacetate, 2,6-dichloro-4-(1,1,3,3-tetramethylbutyl)phenoxyacetate, 2,4-bis(1,1-dimethylpropyl)phenoxyacetate, chlorodiphenylacetate, isobutyrate, monosuccinoate, (E)-2-methyl-2-butenoate, o-(methoxyacyl)benzoate, -naphthoate, nitrate, alkyl N,N,N,N-tetramethylphosphorodiamidate, alkyl N-phenylcarbamate, borate, dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate, sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts).

(424) As used herein, a leaving group (LG) is an art-understood term referring to a molecular fragment that departs with a pair of electrons in heterolytic bond cleavage, wherein the molecular fragment is an anion or neutral molecule. As used herein, a leaving group can be an atom or a group capable of being displaced by a nucleophile. See, for example, Smith, March Advanced Organic Chemistry 6th ed. (501-502). Exemplary leaving groups include, but are not limited to, halo (e.g., chloro, bromo, iodo), OR.sup.aa (when the O atom is attached to a carbonyl group, wherein R.sup.aa is as defined herein), O(CO)R.sup.LG, or O(SO).sub.2R.sup.LG (e.g., tosyl, mesyl, besyl), wherein R.sup.LG is optionally substituted alkyl, optionally substituted aryl, or optionally substituted heteroaryl. In some cases, the leaving group is a halogen. In some embodiments, the leaving group is I.

(425) A counterion or anionic counterion is a negatively charged group associated with a positively charged group in order to maintain electronic neutrality. An anionic counterion may be monovalent (i.e., including one formal negative charge). An anionic counterion may also be multivalent (i.e., including more than one formal negative charge), such as divalent or trivalent. Exemplary counterions include halide ions (e.g., F.sup., Cl.sup., Br.sup., I.sup.), NO.sub.3.sup., ClO.sub.4.sup., OH.sup., H.sub.2PO.sub.4.sup., HCO.sub.3.sup., HSO.sub.4.sup., sulfonate ions (e.g., methansulfonate, trifluoromethanesulfonate, p-toluenesulfonate, benzenesulfonate, 10-camphor sulfonate, naphthalene-2-sulfonate, naphthalene-1-sulfonic acid-5-sulfonate, ethan-1-sulfonic acid-2-sulfonate, and the like), carboxylate ions (e.g., acetate, propanoate, benzoate, glycerate, lactate, tartrate, glycolate, gluconate, and the like), BF.sub.4.sup., PF.sub.4.sup., PF.sub.6.sup., AsF.sub.6.sup., SbF.sub.6.sup., B[3,5-(CF.sub.3).sub.2C.sub.6H.sub.3].sub.4.sup., B(C.sub.6F.sub.5).sub.4.sup., BPh.sub.4.sup., Al(OC(CF.sub.3).sub.3).sub.4.sup., and carborane anions (e.g., CB.sub.11H.sub.12.sup. or (HCB.sub.11Me.sub.5Br.sub.6).sup.). Exemplary counterions which may be multivalent include CO.sub.3.sup.2, HPO.sub.4.sup.2, PO.sub.4.sup.3, B.sub.4O.sub.7.sup.2, SO.sub.4.sup.2, S.sub.2O.sub.3.sup.2, carboxylate anions (e.g., tartrate, citrate, fumarate, maleate, malate, malonate, gluconate, succinate, glutarate, adipate, pimelate, suberate, azelate, sebacate, salicylate, phthalates, aspartate, glutamate, and the like), and carboranes.

(426) As used herein, use of the phrase at least one instance refers to 1, 2, 3, 4, or more instances, but also encompasses a range, e.g., for example, from 1 to 4, from 1 to 3, from 1 to 2, from 2 to 4, from 2 to 3, or from 3 to 4 instances, inclusive.

(427) A non-hydrogen group refers to any group that is defined for a particular variable that is not hydrogen.

(428) These and other exemplary substituents are described in more detail in the Detailed Description, Examples, and Claims. The invention is not intended to be limited in any manner by the above exemplary listing of substituents.

(429) As used herein, the term salt refers to any and all salts, and encompasses pharmaceutically acceptable salts.

(430) The term pharmaceutically acceptable salt refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response, and the like, and are commensurate with a reasonable benefit/risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, Berge et at describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19, incorporated herein by reference. Pharmaceutically acceptable salts of the compounds of this disclosure include those derived from suitable inorganic and organic acids and bases. Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids, such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid, and perchloric acid or with organic acids, such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid, or malonic acid or by using other methods known in the art such as ion exchange. Other pharmaceutically acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, p-toluenesulfonate, undecanoate, valerate salts, and the like. Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium, and N.sup.+(C.sub.1-4 alkyl).sub.4.sup. salts. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like. Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate, and aryl sulfonate.

(431) The term solvate refers to forms of the compound, or a salt thereof, that are associated with a solvent, usually by a solvolysis reaction. This physical association may include hydrogen bonding. Conventional solvents include water, methanol, ethanol, acetic acid, DMSO. THF, diethyl ether, and the like. The compounds described herein may be prepared, e.g., in crystalline form, and may be solvated. Suitable solvates include pharmaceutically acceptable solvates and further include both stoichiometric solvates and non-stoichiometric solvates. In certain instances, the solvate will be capable of isolation, for example, when one or more solvent molecules are incorporated in the crystal lattice of a crystalline solid. Solvate encompasses both solution-phase and isolatable solvates. Representative solvates include hydrates, ethanolates, and methanolates.

(432) The term hydrate refers to a compound that is associated with water. Typically, the number of the water molecules contained in a hydrate of a compound is in a definite ratio to the number of the compound molecules in the hydrate. Therefore, a hydrate of a compound may be represented, for example, by the general formula R.xH.sub.2O, wherein R is the compound, and x is a number greater than 0. A given compound may form more than one type of hydrate, including, e.g., monohydrates (x is 1), lower hydrates (x is a number greater than 0 and smaller than 1, e.g., hemihydrates (R.0.5 H.sub.2O)), and polyhydrates (x is a number greater than 1. e.g., dihydrates (R.2H.sub.2O) and hexahydrates (R.6H.sub.2O)).

(433) The term tautomers or tautomeric refers to two or more interconvertible compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa). The exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may be catalyzed by acid or base. Exemplary tautomerizations include keto-to-enol, amide-to-imide, lactam-to-lactim, enamine-to-imine, and enamine-to-(a different enamine) tautomerizations.

(434) It is also to be understood that compounds that have the same molecular formula but differ in the nature or sequence of bonding of their atoms or the arrangement of their atoms in space are termed isomers. Isomers that differ in the arrangement of their atoms in space are termed stereoisomers.

(435) Stereoisomers that are not mirror images of one another are termed diastereomers and those that are non-superimposable mirror images of each other are termed enantiomers. When a compound has an asymmetric center, for example, it is bonded to four different groups, a pair of enantiomers is possible. An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Calm and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or ()-isomers respectively). A chiral compound can exist as either individual enantiomer or as a mixture thereof. A mixture containing equal proportions of the enantiomers is called a racemic mixture.

(436) The term polymorph refers to a crystalline form of a compound (or a salt, hydrate, or solvate thereof). All polymorphs have the same elemental composition. Different crystalline forms usually have different X-ray diffraction patterns, infrared spectra, melting points, density, hardness, crystal shape, optical and electrical properties, stability, and solubility. Recrystallization solvent, rate of crystallization, storage temperature, and other factors may cause one crystal form to dominate. Various polymorphs of a compound can be prepared by crystallization under different conditions.

(437) The term co-crystal refers to a crystalline structure composed of at least two components. In certain embodiments, a co-crystal contains a compound of the present disclosure and one or more other component, including but not limited to, atoms, ions, molecules, or solvent molecules. In certain embodiments, a co-crystal contains a compound of the present disclosure and one or more solvent molecules. In certain embodiments, a co-crystal contains a compound of the present disclosure and one or more acid or base. In certain embodiments, a co-crystal contains a compound of the present disclosure and one or more components related to said compound, including not limited to, an isomer, tautomer, salt, solvate, hydrate, synthetic precursor, synthetic derivative, fragment or impurity of said compound.

(438) The term prodrugs refers to compounds that have cleavable groups and become by solvolysis or under physiological conditions the compounds described herein, which are pharmaceutically active in vivo. Such examples include, but are not limited to, choline ester derivatives and the like, N-alkylmorpholine esters and the like. Other derivatives of the compounds described herein have activity in both their acid and acid derivative forms, but in the acid sensitive form often offer advantages of solubility, tissue compatibility, or delayed release in the mammalian organism (see, Bundgard, H., Design of Prodrugs, pp. 7-9, 21-24, Elsevier, Amsterdam 1985). Prodrugs include acid derivatives well known to practitioners of the art, such as, for example, esters prepared by reaction of the parent acid with a suitable alcohol, or amides prepared by reaction of the parent acid compound with a substituted or unsubstituted amine, or acid anhydrides, or mixed anhydrides. Simple aliphatic or aromatic esters, amides, and anhydrides derived from acidic groups pendant on the compounds described herein are particular prodrugs. In some cases it is desirable to prepare double ester type prodrugs such as (acyloxy)alkyl esters or ((alkoxycarbonyl)oxy)alkylesters. C.sub.1-C.sub.8 alkyl, C.sub.2-C.sub.8 alkenyl, C.sub.2-C.sub.8 alkynyl, aryl, C.sub.7-C.sub.12 substituted aryl, and C.sub.7-C.sub.12 arylalkyl esters of the compounds described herein may be preferred.

(439) The terms composition and formulation are used interchangeably.

(440) A subject to which administration is contemplated refers to a human (i.e., male or female of any age group, e.g., pediatric subject (e.g., infant, child, or adolescent) or adult subject (e.g., young adult, middle-aged adult, or senior adult)) or non-human animal. In certain embodiments, the non-human animal is a mammal (e.g., primate (e.g., cynomolgus monkey or rhesus monkey), commercially relevant mammal (e.g., cattle, pig, horse, sheep, goat, cat, or dog), or bird (e.g., commercially relevant bird, such as chicken, duck, goose, or turkey)). In certain embodiments, the non-human animal is a fish, reptile, or amphibian. The non-human animal may be a male or female at any stage of development. The non-human animal may be a transgenic animal or genetically engineered animal Disease. disorder, and condition are used interchangeably herein.

(441) The term biological sample refers to any sample including tissue samples (such as tissue sections and needle biopsies of a tissue); cell samples (e.g., cytological smears (such as Pap or blood smears) or samples of cells obtained by microdissection); samples of whole organisms (such as samples of yeasts or bacteria); or cell fractions, fragments or organelles (such as obtained by lysing cells and separating the components thereof by centrifugation or otherwise). Other examples of biological samples include blood, serum, urine, semen, fecal matter, cerebrospinal fluid, interstitial fluid, mucous, tears, sweat, pus, biopsied tissue (e.g., obtained by a surgical biopsy or needle biopsy), nipple aspirates, milk, vaginal fluid, saliva, swabs (such as buccal swabs), or any material containing biomolecules that is derived from a first biological sample.

(442) The term administer, administering, or administration refers to implanting, absorbing, ingesting, injecting, inhaling, or otherwise introducing a compound described herein, or a composition thereof, in or on a subject.

(443) The terms condition, disease, and disorder are used interchangeably.

(444) As used herein, and unless otherwise specified, the terms treat, treating and treatment contemplate an action that occurs while a subject is suffering from the specified disease or condition, which reduces the severity of the disease or condition, or retards or slows the progression of the disease or condition (i.e., therapeutic treatment), and also contemplates an action that occurs before a subject begins to suffer from the specified disease or condition (i.e., prophylactic treatment).

(445) An effective amount of a compound described herein refers to an amount sufficient to elicit the desired biological response. An effective amount of a compound described herein may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the condition being treated, the mode of administration, and the age and health of the subject. In certain embodiments, an effective amount is a therapeutically effective amount. In certain embodiments, an effective amount is a prophylactic treatment. In certain embodiments, an effective amount is the amount of a compound described herein in a single dose. In certain embodiments, an effective amount is the combined amounts of a compound described herein in multiple doses.

(446) As used herein the term inhibit or inhibition in the context of enzymes, for example, in the context of MbtA.sub.tb, refers to a reduction in the activity of the enzyme. In some embodiments, the term refers to a reduction of the level of enzyme activity, e.g., MbtA.sub.tb activity, to a level that is statistically significantly lower than an initial level, which may, for example, be a baseline level of enzyme activity. In some embodiments, the term refers to a reduction of the level of enzyme activity, e.g., MbtA.sub.tb activity, to a level that is less than 75%, less than 50%, less than 40%, less than 30%, less than 25%, less than 20%, less than 10%, less than 9%, less than 8%, less than 7%, less than 6%, less than 5%, less than 4%, less than 3%, less than 2%, less than 1%, less than 0.5%, less than 0.1%, less than 0.01%, less than 0.001%, or less than 0.0001% of an initial level, which may, for example, be a baseline level of enzyme activity.

(447) As used herein the term infectious microorganism refers to a species of infectious fungi, bacteria, or protista, or to a virus. In certain embodiments, the infectious microorganism is a fungi. In certain embodiments, the infectious microorganism is a bacteria. In certain embodiments, the infectious microorganism is a protista. In certain embodiments, the infectious microorganism is a virus.

(448) An infection or infectious disease refers to an infection with a microorganism, such as a fungus, bacteria, or virus. In certain embodiments, the infection is an infection with a fungus, i.e., a fungal infection. In certain embodiments, the infection is an infection with a virus, i.e., a viral infection. In certain embodiments, the infection is an infection with bacteria, i.e., a bacterial infection. Various infections include, but are not limited to, skin infections, GI infections, urinary tract infections, genito-urinary infections, sepsis, blood infections, and systemic infections. In some embodiments, the infectious disease is tuberculosis.

(449) As used herein, the term siderophore are small, high-affinity iron-chelating compounds secreted by microorganisms such as bacteria and fungi and serving to transport iron across cell membranes. Exemplary siderophores include, but are not limited to mycobactin, yersiniabactin, pyochelin, enterobactin, bacillibactin, vibriobactin, petrobactin, aerobactin, salmochelin, pyoverdin, alcaligin, and staphyloferrin A.

(450) As used herein, the term bifunctional enzyme salicyl-AMP ligase or MbtA.sub.tb refers to an enzyme converts salicylic acid to mycobactin (MBT) siderophores. MbtA.sub.tb may also refer to the encoding RNA and DNA sequences of the MbtA.sub.tb protein. In some embodiments, a MbtA.sub.tb inhibitor provided herein is specific for a MbtA.sub.tb from a species. The term MbtA.sub.tb further includes, in some embodiments, sequence variants and mutations (e.g., naturally occurring or synthetic MbtA.sub.tb sequence variants or mutations), and different MbtA.sub.tb isoforms. In some embodiments, the term MbtA.sub.tb includes protein or encoding sequences that are homologous to a MbtA.sub.tb protein or encoding sequence, for example, a protein or encoding sequence having at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity with a MbtA.sub.tb sequence, for example, with a MbtA.sub.tb sequence provided herein. MbtA.sub.tb protein and encoding gene sequences are well known to those of skill in the art, and exemplary protein sequences include, but are not limited to, the following sequences. Additional MbtA.sub.tb sequences, e.g., MbtA.sub.1b homologues from other bacteria species, will be apparent to those of skill in the art, and the disclosure is not limited to the exemplary sequences provided herein.

(451) TABLE-US-00005 (SEQIDNO:1) MPPKAADGRRPSPDGGLGGFVPFPADRAASYRAAGYWSGRTLDTVLSDAA RRWPDRLAVADAGDRFGHGGLSYAELDQRADRAAAALHGLGITPGDRVLL QLPNGCQFAVALFALLRAGAIPVMCLPGHRAAELGHFAAVSAATGLVVAD VASGFDYRPMARELVADHPTLRHVIVDGDPGPFVSWAQLCAQAGTGSPAP PADPGSPALLLVSGGTTGMPKLIPRTHDDYVFNATASAALCRLSADDVYL VVLAAGHNFPLACPGLLGAMTVGATAVFAPDPSPEAAFAAIERHGVTVTA LVPALAKLWAQSCEWEPVTPKSLRLLQVGGSKLEPEDARRVRTALTPGLQ QVFGMAEGLLNFTRIGDPPEVVEHTQGRPLCPADELRIVNADGEPVGPGE EGELLVRGPYTLNGYFAAERDNERCFDPDGFYRSGDLVRRRDDGNLVVTG RVKDVICRAGETIAASDLEEQLLSHPAIFSAAAVGLPDQYLGEKICAAVV FAGAPITLAELNGYLDRRGVAAHTRPDQLVAMPALPTTPIGKIDKRAIVR QLGIATGPVTTQRCH

(452) As used herein, the term anthranilate-CoA synthetase or PqsA refers to an enzyme of the menaquinone biosynthesis pathway which converts anthranilic acid to anthranilyl-S-CoA. PqsA may also refer to the encoding RNA and DNA sequences of the PqsA protein. In some embodiments, a PqsA inhibitor provided herein is specific for a PqsA from a species, e.g., for P. aeruginosa PqsA. The term PqsA further includes, in some embodiments, sequence variants and mutations (e.g., naturally occurring or synthetic PqsA sequence variants or mutations), and different PqsA isoforms. In some embodiments, the term PqsA includes protein or encoding sequences that are homologous to a PqsA protein or encoding sequence, for example, a protein or encoding sequence having at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity with a PqsA sequence, for example, with a PqsA sequence provided herein. PqsA protein and encoding gene sequences are well known to those of skill in the art, and exemplary protein sequences include, but are not limited to, the following sequences. Additional PqsA sequences, e.g., PqsA homologues from other bacteria species, will be apparent to those of skill in the art, and the disclosure is not limited to the exemplary sequences provided herein.

(453) TABLE-US-00006 (SEQIDNO:2) MSTLANLTEVLFRLDFDPDTAVYHYRGQTLSRLQCRTYILSQASQLARLL KPGDRVVLALNDSPSLACLFLACIAVGAIPAVINPKSREQALADIAADCQ ASLVVREADAPSLSGPLAPLTLRAAAGRPLLDDFSLDALVGPADLDWSAF HRQDPAAACFLQYTSGSTGAPKGVMHSLRNTLGFCRAFATELLALQAGDR LYSIPKMFFGYGMGNSLFFPWFSGASALLDDTWPSPERVLENLVAFRPRV LFGVPAIYASLRPQARELLSSVRLAFSAGSPLPRGEFEFWAAHGLEICDG IGATEVGHVFLANRPGQARADSTGLPLPGYECRLVDREGHTIEEAGRQGV LLVRGPGLSPGYWRASEEQQARFAGGWYRTGDLFERDESGAYRHCGREDD LFKVNGRWVVPTQVEQAICRHLPEVSEAVLVPTCRLHDGLRPTLFVTLAT PLDDNQILLAQRIDQHLAEQIPSHMLPSQLHVLPALPRNDNGKLARAELR HLADTLYHDNLPEERAC

EXAMPLES

(454) In order that the invention described herein may be more fully understood, the following examples are set forth. The examples described in this application are offered to illustrate the compounds, pharmaceutical compositions, and methods provided herein and are not to be construed in any way as limiting their scope.

(455) General Materials and Methods

(456) Reagents were obtained from Aldrich Chemical (www.sigma-aldrich.com) or Acros Organics (www.fishersci.com) and used without further purification. Optima or HPLC grade solvents were obtained from Fisher Scientific (www.fishersci.com), degassed with Ar, and purified on a solvent drying system as described.1 All reactions were performed in flame-dried glassware under positive Ar pressure with magnetic stirring unless otherwise noted. Liquid reagents and solutions were transferred thru rubber septa via syringes flushed with Ar prior to use. TLC was performed on 0.25 mm E. Merck silica gel 60 F254 plates and visualized under UV light (254 nm). Silica flash chromatography was performed on E. Merck 230-400 mesh silica gel 60. Lyophilization of samples was performed using a Labconco Freezone 2.5 instrument.

(457) IR spectra were recorded on a Broker Optics Tensor 27 FTIR spectrometer using an attenuated total reflection (ATR) attachment with peaks reported in cm-1. NMR spectra were recorded on a Bruker UltraShield Plus 500 MHz Avance III NMR or UltraShield Plus 600 MHz Avance III NMR with DCH CryoProbe at 24 C. Chemical shifts are expressed in ppm relative to TMS (1H, 0 ppm) or solvent signals: CDCl3 (1H, 7.24 ppm; 13C, 77.23 ppm), or CD3OD (1H, 3.31 ppm; 13C, 49.15 ppm); coupling constants are expressed in Hz. NMR spectra were processed using Bruker TopSpin, Mnova (www.mestrelab.com/software/mnova-nmr), software. High resolution mass spectra were obtained at the MSKCC Analytical Core Facility on a Waters Acuity Premiere XE TOF LC-MS by electrospray ionization (ESI).

(458) Compound Salicyl-AMS (1) was synthesized by WuXi AppTec (Ferreras, J. A., et al. (2005) Nat. Chem. Biol. 1, 29-32) and salicyl-AMSN (4a) was synthesized according to published literatures procedures (Somu, R. V., et at (2006) J. Med. Chem. 49, 31-34). Salicyl-AMSN (4a) was converted to the sodium salt by ion exchange as described for salicyl-AMSNMe (4b) below.

Example 1A: Synthesis of salicyl-AMSNMe (4b)

(459) ##STR00319## ##STR00320##

(460) Cbz=benzyloxycarbonyl; DIAD=diisopropyl azodicarboxylate; DMAP=4-dimethylaminopyridine; DPPA=diphenylphosphoryl azide; EDC=1-ethyl-3-(3-dimethylamino-propyl)carbodiimide hydrochloride; TFA=2,2,2-trifluoroacetic acid.

(461) ##STR00321##

tert-Butyl (9-((3aR,4R,6S,6aS)-6-formyl-2,2-dimethyltetrahydrofuro[3,4-d][1,3]dioxol-4-yl)-9H-purin-6-yl)carbamate (S2)

(462) In a 100-mL roundbottom flask, N.sup.6-Boc-2,3-O-isopropylideneadenosine (S1).sup.22 (1.34 g, 3.29 mmol, 1.0 equiv.) was dissolved in CH.sub.2Cl.sub.2 (30 mL). Dess-Martin periodinane (1.67 g, 3.95 mmol, 1.2 equiv.) was added and the mixture was stirred at room temperature for 1.5 h. A mixture of saturated aqueous NaHCO.sub.3 (30 mL) and saturated aqueous Na.sub.2S.sub.2O.sub.3 (30 mL) was added and the mixture was stirred for 20 min. The organic layer was separated, washed with brine (30 mL), dried (Na.sub.2SO.sub.4), filtered, and concentrated by rotary evaporation to afford aldehyde S2 (1.14 g, 85%) as a white solid, which was used without further purification.

(463) TLC: R/0.26 (1:19 MeOH/CH.sub.2Cl.sub.2). .sup.1H-NMR (600 MHz, CDCl.sub.3) 9.24 (s, 1H), 8.40 (s, 1H), 8.01 (s, 1H), 6.18 (s, 1H), 5.48 (dd, J=6.1, 1.8 Hz, 1H), 5.27 (d, J=6.1 Hz, 1H), 4.62 (d, J=1.8 Hz, 1H), 1.53 (s, 3H), 1.49 (s, 9H), 1.33 (s, 3H). .sup.13C-NMR (151 MHz): 199.4, 152.9, 150.4, 149.7, 149.6, 142.0, 122.3, 114.5, 93.1, 92.3, 84.7, 83.6, 82.5, 53.5, 28.1, 26.6, 25.0. IR (ATR): 2982, 2936, 1750, 1611, 1590, 1525, 1370, 1329, 1144, 1077, 854, 731. HRMS calculated for C.sub.18H.sub.26N.sub.5O.sub.7 ([M+H.sub.2O+H].sup.+) 424.1827, found 424.1841.

(464) ##STR00322##

tert-Butyl (9-((3aR,4R,6R,6aR)-2,2-dimethyl-6((methylamino)methyl)tetrahydrofuro[3,4-d][1,3]dioxol-4-yl)-9H-purin-6-yl)carbamate (S3)

(465) In a 100-mL roundbottom flask, aldehyde S2 (1.02 g, 2.51 mmol, 1.0 equiv.) was dissolved in MeOH (30 mL). Methylamine (2 M in THF, 6.28 mL, 12.57 mmol, 5.0 equiv.) and acetic acid (287 ELL, 5.02 mmol, 2.0 equiv.) were added, followed by solid sodium cyanoborohydride (316 mg, 5.02 mmol, 2.0 equiv.). The mixture was stirred at room temperature for 16 h. The solvent was removed by rotary evaporation and the residue was partitioned between CH.sub.2Cl.sub.2 (30 mL) and saturated aqueous NaHCO.sub.3 (30 mL). The organic layer was washed with brine (30 mL), dried (Na.sub.2SO.sub.4), filtered, and concentrated by rotary evaporation to afford methylamine S3 (1.05 g, 100%), which was used without further purification.

(466) TLC: R.sub.f 0.18 (1:9 MeOH/CH.sub.2Cl.sub.2). .sup.1H-NMR (600 MHz, CDCl.sub.3) 9.70 (br s, 1H), 9.53 (br s, 1H), 8.63 (s, 1H), 8.23 (s, 1H), 6.15 (d, J=2.8 Hz, 1H), 5.24 (dd, J=6.5, 2.7 Hz, 1H), 5.13 (dd, J=6.5, 3.6 Hz, 1H), 4.65 (app dt, J=10.2, 3.4 Hz, 1H), 3.82 (dd, J=13.0, 10.2 Hz, 1H), 3.46 (dd, J=13.0, 3.2 Hz, 1H), 2.88 (s, 3H), 1.62 (s, 3H), 1.59 (s, 9H), 1.37 (s, 3H). .sup.13C-NMR (125 MHz): 153.0, 150.3, 150.1, 149.7, 141.8, 122.3, 114.8, 91.0, 85.1, 83.5, 82.4, 82.3, 53.1, 36.2, 28.2, 27.2, 25.4. IR (ATR): 2980, 2936, 1746, 1611, 1583, 1532, 1369, 1325, 1232, 1143, 1075, 909, 866, 773. HRMS m/z calculated for C.sub.19H.sub.29N.sub.6O.sub.5 ([M+H].sup.+) 421.2199, found 421.2200.

(467) ##STR00323##

Benzyl (N-(((3aR,4R,6R,6aR)-6-(6-((tert-butoxycarbonyl)amino)-9H-purin-9-yl)-2,2-di-methyltetrahydrofuro[3,4-d][1,3]dioxol-4-yl)methyl)-N-methylsulfamoyl)carbamate (S4)

(468) In a 100-mL roundbottom flask, crude methylamine S3 (1.05 g, 2.51 mmol, 1.0 equiv) was dissolved in CH.sub.2Cl.sub.2 (30 mL). Solid ((benzyloxy)carbonyl)((4-(dimethyliminio)pyridin-1 (4H)-yl)sulfonyl)-amide.sup.2 (1.09 g, 3.27 mmol, 1.3 equiv) was added and the mixture was stirred at room temperature for 16 h. The mixture was diluted with CH.sub.2Cl.sub.2 (20 mL), washed with 0.2 N HCl (30 mL) and brine (30 mL), dried (Na.sub.2SO.sub.4), filtered, and concentrated by rotary evaporation. Purification by silica flash chromatography (0.fwdarw.3 100% EtOAc/hexanes) provided Cbz-protected sulfamide S4 (0.54 g, 34%) as a white solid.

(469) TLC: R.sub.f 0.46 (1:9 MeOH/EtOAc). .sup.1H-NMR (600 MHz, CDCl.sub.3) 9.45 (d, J=13.3H, 1H), 8.93 (s, 1H), 8.42 (br s, 1H), 8.01 (s, 1H), 7.28-7.20 (m, 5H), 5.85 (d, J=4.9 Hz, 1H), 5.22 (dd, J=6.2, 4.9 Hz, 1H), 5.14 (d, J=12.1 Hz, 1H), 5.04-5.01 (m, 2H), 4.57 (m, 1H), 3.53-3.49 (m, 4H), 3.41 (m, 1H), 1.63 (s, 3H), 1.49 (s, 9H), 1.35 (s, 3H). .sup.13C-NMR (151 MHz): 154.8, 153.4, 152.3, 151.2, 150.6, 142.1, 134.6, 128.6, 128.5, 128.3, 128.0, 114.9, 93.4, 82.7, 82.5, 82.3, 81.6, 68.2, 45.4, 35.0, 28.0, 27.5, 25.2. IR (ATR): 3242, 2987, 1712, 1583, 1455, 1420, 1358, 1221, 1156, 1091, 854, 735. HRMS m/z calculated for C.sub.27H.sub.36N.sub.7O.sub.9S ([M+H].sup.+) 634.2295, found 634.2294.

(470) ##STR00324##

tert-Butyl (9-((3aR,4R,6R,6aR)-2,2-dimethyl-6-((methyl(sulfamoyl)amino)methyl)-tetra-hydrofuro[3,4-d][1,3]dioxol-4-yl)-9H-purin-6-yl)carbamate (S5)

(471) In a 50-mL roundbottom flask, Cbz-protected sulfamide S4 (540 mg, 0.85 mmol, 1.0 equiv.) was dissolved in degassed MeOH (10 mL). Solid 10% palladium on carbon (50 mg) was added and the mixture was purged with hydrogen gas and stirred at room temperature under hydrogen atmosphere (balloon) for 16 h. The catalyst was removed by filtration through Celite and the filtrate was concentrated by rotary evaporation to afford sulfamide S5 (349 mg, 82%) as a white solid, which was used without further purification.

(472) TLC: R.sub.f 0.07 (1:4 MeOH/EtOAc). .sup.1H-NMR (600 MHz, CDCl.sub.3) 8.85 (s, 1H), 8.09 (s, 1H), 7.98 (dd, J=7.9.3.5 Hz, 1H), 5.86 (d, J=4.6 Hz), 5.29 (dd, J=6.3, 4.6 Hz, 1H), 5.11 (dd, J=6.3, 2.3 Hz, 1H), 4.81 (br s, 2H), 4.49 (m, 1H), 3.55-3.48 (m, 5H), 1.64 (s, 3H), 1.52 (s, 9H), 1.35 (s, 3H). .sup.13C-NMR (151 MHz): 154.8, 153.4, 152.0, 150.9, 142.3, 128.0, 115.0, 92.9, 83.2, 82.5, 82.4, 81.4, 45.2, 35.1, 28.1, 27.4, 25.2. IR (ATR): 3266, 2984, 1714, 1581, 1456, 1419, 1356, 1320, 1216, 1154, 1091, 911, 854, 765. HRMS m/z calculated for C.sub.19H.sub.30N.sub.7O.sub.7S ([M+H].sup.+) 500.1927, found 500.1904.

(473) ##STR00325##

tert-Butyl (9-((3aR,4R,6R,6aR)-6-(((N-(2-(benzyloxy)benzoyl)sulfamoyl)(methyl)amino)-methyl)-2,2-dimethyltetrahydrofuro[3,4-d][1,3]dioxol-4-yl)-9H-purin-6-yl)carbamate (S6)

(474) In a 25-mL roundbottom flask, sulfamide S5 (300 mg, 0.60 mmol, 1.0 equiv.) and 2-benzyloxybenzoic acid (274 mg, 1.20 mmol, 2.0 equiv.) were dissolved in CH.sub.3CN (6 mL). Solid EDC (230 mg, 1.20 mmol, 2.0 equiv.) was added, followed by DMAP (73 mg, 0.60 mmol, 1.0 equiv.). The mixture was stirred at room temperature for 16 h. The solvent was removed by rotary evaporation and the residue was partitioned between CH.sub.2Cl.sub.2 (30 mL) and saturated aqueous NH.sub.4Cl (30 mL). The organic layer was washed with brine (30 mL), dried (Na.sub.2SO.sub.4), filtered, and concentrated by rotary evaporation. Purification by silica flash chromatography (30.fwdarw.100% EtOAc/hexanes) afforded acyl sulfamide S6 (312 mg, 73%) as a white solid.

(475) TLC: R.sub.f 0.36 (1:1 EtOAc/hexanes). .sup.1H-NMR (600 MHz, CDCl.sub.3) 10.17 (s, 1H), 9.32 (d, J=9.36, 1H), 8.94 (s, 1H), 8.04 (dd, J=7.8, 1.8 Hz, 1H), 7.90 (s, 1H), 7.45 (ddd, J=8.7, 7.3, 1.9 Hz, 1H), 7.42-7.37 (m, 3H), 7.37-7.34 (m, 2H), 7.01 (dt, J=8.0, 2.2 Hz, 2H), 5.75 (d, J=5.0 Hz, 1H), 5.21-5.16 (m, 3H), 4.95 (dd, J=6.1, 1.7 Hz, 1H), 4.43 (app q, J=2.3 Hz, 1H), 3.45 (s, 3H), 3.35-3.25 (m, 2H), 1.55 (s, 3H), 1.42 (s, 9H), 1.26 (s, 3H). .sup.13C-NMR (125 MHz): 162.8, 157.0, 154.9, 153.5, 152.6, 150.8, 141.9, 134.8, 134.6, 132.8, 129.2, 129.1, 128.2, 127.9, 112.0, 119.4, 114.7, 113.0, 93.6, 82.8, 82.4, 82.2, 81.8, 71.9, 45.5, 35.0, 28.1, 27.6, 25.2. IR (ATR): 3300, 3075, 2984, 2935, 1713, 1684, 1456, 1421, 1357, 1316, 1219, 1156, 1126, 1091, 1044, 1022, 990, 910, 893, 855, 756, 733. HRMS m/z calculated for C.sub.33H.sub.39N.sub.7O.sub.9S ([M+H].sup.+) 710.2608, found 710.2612.

(476) ##STR00326##

tert-Butyl (9-((3aR,4R,6R,6aR)-6-(((N-(2-hydroxybenzoyl)sulfamoyl)(methyl)amino)-methyl)-2,2-dimethyltetrahydrofuro[3,4d][1,3]dioxol-4-yl)-9H-purin-6-yl)carbamate (S7)

(477) In a 100-mL roundbottom flask, acyl sulfamide S6 (780 mg, 1.10 mmol, 1.0 equiv.) was dissolved in MeOH (30 mL). Solid 10% palladium on carbon (80 mg) was added and the mixture was purged with hydrogen gas and stirred at room temperature under hydrogen atmosphere (balloon) for 16 h. The catalyst was removed by filtration through Celite and the filtrate was concentrated by rotary evaporation to afford salicyl sulfamide S7 (662 mg, 97%) as a white solid, which was used without further purification.

(478) TLC: R.sub.f 0.50 (1:9 MeOH/CH.sub.2Cl.sub.2). .sup.1H-NMR (600 MHz, CDCl.sub.3) 8.90 (s, 1H), 7.86 (br s, 1H), 7.51 (app d, J=8.0 Hz, 1H), 7.35 (app t, J=7.9 Hz, 1H), 6.87 (app d, J=8.4 Hz, 1H), 6.79 (app t, J=7.9 Hz, 1H), 5.80 (d, J=2.0 Hz, 1H), 5.22 (dd, J=6.4, 2.0 Hz, 1H), 4.47 (dd, J=6.4, 3.3 Hz, 1H), 3.58 (m, 1H), 3.46-3.42 (m, 4H), 1.54 (s, 3H), 1.46 (s, 9H), 1.28 (s, 3H). .sup.13C-NMR (151 MHz): 167.6, 160.7, 154.5, 153.8, 152.4, 150.9, 142.3, 135.7, 128.0, 127.9, 119.6, 118.6, 114.9, 93.0, 83.6, 82.9, 82.8, 81.8, 45.8, 35.3, 28.2, 27.4, 25.2. IR (ATR): 3258, 3109, 2984, 2395,1716, 1653, 1582, 1461, 1420, 1358, 1216, 1158, 1091, 854, 758. HRMS m/z calculated for C.sub.26H.sub.33N.sub.7O.sub.9S ([M+H].sup.+) 620.2139, found 620.2113.

(479) ##STR00327##

N(N-(((2R,3S,4R,5R)-5-(6-Amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl)-methyl)-N-methylsulfamoyl)-2-hydroxybenzamide (salicyl-AMSNMe, 4b)

(480) In a 25-mL roundbottom flask, salicyl sulfamide S7 (600 mg, 0.97 mmol, 1.0 equiv.) was dissolved in 10 mL 4:1 TFA/water and stirred at room temperature for 16 h. The solvent was removed by rotary evaporation and the oily residue was purified by silica flash chromatography (0.fwdarw.100% MeOH/EtOAc) to provide salicyl-AMSNMe (4b) (357 mg, 77%) as a white solid. This compound was converted to its corresponding sodium salt by ion exchange as follows. A Dowex 50WX8 (200-400 mesh, H+ form) cation exchange column was prepared by sequentially washing with 5 column volumes each of water, MeOH, water, then 1 N NaOH to generate the sodium salt form of the resin. The resin was flushed with water until the eluent reached pH 7. In a 4 mL scintillation vial, the compound was dissolved in a minimal amount of a water/CH.sub.3CN (1 M, 1:1 water/CH.sub.3CN) and cooled to 0 C. Triethylamine (1.1 equiv) was added dropwise and the reaction was stirred for 10 minutes. The resulting mixture was flash frozen with liquid nitrogen, and concentrated by lyophilization to obtain the triethylammonium salt of the compound as a white solid. The triethylammonium salt was dissolved in a minimal amount of water (1 M) and loaded onto the Dowex column, then incubated with the resin for 10 min before eluting with water. Appropriate fractions were combined and flash frozen with liquid nitrogen, and concentrated by lyophilization to obtain the sodium salt the analogue as a white solid. The sodium salt was purified by preparative HPLC (5%.fwdarw.65% CH.sub.3CN in H2O with 0.1% TFA). Appropriate fractions were combined and flash frozen with liquid nitrogen, and concentrated by lyophilization to yielded pure sodium salt of the compound as a white solid.

(481) TLC: R.sub.f 0.35 (3:7 methanol/ethyl acetate). .sup.1H-NMR (600 MHz, CD.sub.3OD) 8.40 (s, 1H), 8.23 (s, 1H), 7.96 (dd, J=7.9, 1.8 Hz, 1H), 7.30 (ddd, J=8.7, 7.2, 1.8 Hz, 1H), 6.85-6.67 (m, 2H), 6.07 (d, J=5.2 Hz, 1H), 4.78 (t, J=5.2 Hz, 1H), 4.59 (brs, 2H), 4.51 (t, J=4.8 Hz, 1H), 4.28 (app q, J=5.1 Hz, 1H), 3.65 (dd, J=14.8, 5.0 Hz, 1H), 3.58 (dd, J=14.8, 5.6 Hz, 1H), 2.87 (s, 3H). .sup.13C-NMR (151 MHz, CD.sub.3OD) 174.2, 161.8, 157.3, 154.0, 150.8, 141.3, 134.1, 131.2, 121.0, 120.4, 119.2, 117.8, 89.7, 85.2, 75.0, 73.0, 54.3, 38.3. IR (ATR): 3204, 1685, 1608, 1559, 1541, 1507, 1465, 1355, 1202, 1150, 977, 897, 848, 800, 759, 724. HRMS m/z calculated for C.sub.18H.sub.22N.sub.7O.sub.7S ([M+H].sup.+) 480.1296, found 480.1267.

Example 1B. Synthesis of salicyl-6-MeO-AMSN(6)

(482) ##STR00328## ##STR00329##

(483) Compound 6 lacks a C6-substituent hydrogen-bond donor but also maintains the adenine tautomeric form (NI lone pair). Notably, initial attempts to synthesize the corresponding sulfamate analogue, salicyl-6-MeO-AMS (not shown), were thwarted by product instability, necessitating replacement with the more stable sulfamide in 6 (Somu JMC 2006, 49, 31). Thus, salicyl-6-MeO-AMSN (6) was synthesized.

(484) ##STR00330##

((3aR,4R,6R,6aR)-2,2-Dimethyl-6-(6-oxo-1,6-dihydro-9H-purin-9-yl)tetrahydrofuro[3,4-d][1,3]dioxol-4-yl)methyl acetate (5-acetyl-2,3-O-isopropylideneinosine, S9)

(485) In a 500-mL roundbottom flask, inosine (S8) (10.0 g, 37.4 mmol, 1.0 equiv.) was suspended in acetone (370 mL) and cooled to 0 C. A solution of 70% perchloric acid (5.5 mL) was added dropwise over a period of 5 min. The reaction was stirred at room temperature for 3.5 h, then neutralized to pH 7 with concentrated NH.sub.4OH. The resulting gel was vigorously stirred at room temperature for 12 h until a solid white precipitate formed. The solvent was removed by rotary evaporation and the crude mixture was dissolved 50 mL pyridine. Neat acetic anhydride (73 mL) was added and the reaction was stirred at room temperature for 25 min. The mixture was diluted with 20 mL toluene and concentrated by rotary evaporation to afford a brown oil, which was redissolved in 20 mL ethanol and concentrated by rotary evaporation. Purification by silica flash chromatography (0.fwdarw.10% MeOH/CH.sub.2Cl.sub.2) afforded protected inosine S9 (13.84 g, 99%) as a white solid.

(486) TLC: R.sub.f 0.40 (1:9 MeOH/CH.sub.2Cl.sub.2). .sup.1H-NMR (500 MHz, CD.sub.3OD): 8.20 (s, 1H), 8.10 (s, 1H), 6.20 (d, J=2.3 Hz, 1H), 5.42 (dd, J=6.3, 2.3 Hz, 1H), 5.04 (dd, J=6.3, 3.2 Hz, 1H), 4.45 (ddd, J=5.9, 4.6, 3.2 Hz, 1H), 4.26 (m, 2H), 1.97 (s, 3H), 1.58 (s, 3H), 1.37 (s, 3H). .sup.13C-NMR (125 MHz): 172.4, 159.0, 149.6, 147.1, 141.1, 126.2, 115.7, 92.2, 86.3, 85.9, 83.1, 65.3, 27.6, 25.6, 20.7. IR (ATR): 3434, 3116, 2990, 2074, 1742, 1699, 1588, 1549, 1419, 1215, 1157, 1105, 1076, 868. HELMS m/z calculated for C.sub.15H.sub.18N.sub.4O.sub.6 ([M+H].sup.+) 351.1305; found 351.1297.

(487) ##STR00331##

((3aR,4R,6R,6aR)-6-(6-Chloro-9H-purin-9-yl)-2,2-dimethyltetrahydrofuro[3,4-d][1,3]-dioxol-4-yl)methyl acetate (S10)

(488) In a 100 mL flask fitted with a reflux condenser, protected inosine S9 (3.69 g, 10.52 mmol, 1.0 equiv.) and tetraethylammonium chloride (3.49 g, 21.04 mmol, 2.0 equiv.) were dissolved in CH.sub.3CN (21 mL). Neat N,N-dimethylaniline (1.33 mL, 10.52 mmol, 1.0 equiv.) and phosphorus oxychloride (5.87 mL, 63.10 mmol, 6.0 equiv.) were added and the reaction was heated to reflux in a sand bath for 20 min. The reaction was cooled to room temperature and concentrated by rotary evaporation to afford a yellow oil. The crude mixture was dissolved in 60 mL CH.sub.2Cl.sub.2 and quenched by vigorous stirring with 30 g crushed ice for 15 min. The aqueous layer was extracted with CH.sub.2Cl.sub.2 (560 mL), and the combined organic extracts were washed with saturated aqueous NaHCO.sub.3 (260 mL), dried (MgSO.sub.4), filtered, and concentrated by rotary evaporation. Purification by silica flash chromatography (0.fwdarw.5% MeOH/CH.sub.2Cl.sub.2) afforded chloride S10 (3.06 g, 80%) as a light brown foam.

(489) TLC: R.sub.f 0.68 (1:9 MeOH/EtOAc). .sup.1H-NMR (500 MHz, CDCl.sub.3): 8.59 (s, 1H), 8.18 (s, 1H), 6.07 (d, 1H, J=2.2 Hz), 5.29 (dd, 1H, J=6.3, 2.2 Hz), 4.88 (1H, dd, J=6.3, 3.4 Hz), 4.36 (m, 1H), 4.16 (dd, 1H, J=12.0, 4.2 Hz), 4.06 (dd, 1H, J=12.0, 5.8 Hz), 1.80 (s, 3H), 1.45 (s, 3H), 1.22 (s, 3H). .sup.13C-NMR (125 MHz): 170.0, 151.9, 151.1, 150.8, 144.3, 132.2, 114.7, 91.2, 84.8, 84.0, 81.3, 63.7, 27.0, 25.2, 20.5. IR (ATR): 3405, 2999, 2941, 1744, 1592, 1562, 1493, 1439, 1384, 1339, 1215, 1158, 1138, 1104, 1078937, 863. HRMS m/z calculated for C.sub.15H.sub.17N.sub.4O.sub.5Cl ([M+H].sup.+) 369.0966, found 369.0956.

(490) ##STR00332##

((3aR,4R,6R,6aR)-6-(6-Methoxy-9H-purin-9-yl)-2,2-dimethyltetrahydrofuro[3,4-d][1,3]-dioxol-4-yl)methanol (S11)

(491) In a 25-mL roundbottom flask, chloride S10 (104 mg, 0.28 mmol, 1.0 equiv.) was dissolved in MeOH (5 mL). Solid K.sub.2CO.sub.3 (78 mg, 0.56 mmol, 2.0 equiv.) was added and the mixture was stirred at room temperature for 20 min. The solution was diluted with 20 mL CHCl.sub.3, filtered through Celite, and concentrated by rotary evaporation. Purification by silica flash chromatography (0.fwdarw.10% MeOH/CH.sub.2Cl.sub.2) afforded protected 6-O-methylinosine S11 (78 mg, 86%) as a white powder.

(492) TLC: R.sub.f 0.46 (1:9 MeOH/CH.sub.2Cl.sub.2). .sup.1H-NMR (500 MHz, CD.sub.3OD): 8.52 (s, 1H), 8.48 (s, 1H), 6.25 (d, 1H, J=3.2 Hz), 5.34 (dd, 1H, J=6.1, 3.2 Hz), 5.08 (dd, 1H, J=6.1, 2.5 Hz), 4.41 (m, 1H), 4.18 (s, 3H), 3.81 (dd, 1H, J=12.0, 3.7 Hz), 3.75 (dd, 1H, J=12.0, 4.2 Hz), 1.64 (s, 3H), 1.40 (s, 3H). .sup.13C-NMR (125 MHz): 162.3, 153.3, 152.3, 143.7, 122.5, 115.3, 92.8, 88.5, 85.6, 83.0, 63.5, 55.0, 27.6, 25.7. IR (ATR): 2360, 2341, 1599, 1479, 1350, 1319, 1214, 1157, 1110, 1074, 952, 851, 800. HRMS m/z calculated for C.sub.14H.sub.19N.sub.4O.sub.5 ([M+H].sup.+) 323.1255: found 323.1357.

(493) ##STR00333##

9-((3aR,4R,6R,6aR)-6-(Azidomethyl)-2,2-dimethyltetrahydrofuro[3,4-d][1,3]dioxol-4-yl)-6-methoxy-9H-purine (S12)

(494) In a 250-mL roundbottom flask, DIAD (0.71 mL, 3.63 mmol, 1.5 equiv.) was dissolved in THE (62 mL) and cooled to 0 C. A solution of triphenylphosphine (952 mg, 3.63 mmol, 1.5 equiv.) in 12 mL THE was added and the resulting solution was stirred at 0 C. for 10 min. A solution of alcohol S11 (780 mg, 2.42 mmol, 1.0 equiv.) in 12 mL THE was added and the reaction mixture was stirred at 0 C. for an additional 10 min. Neat DPPA was added (1.04 mL, 4.84 mmol, 2.0 equiv.) and the reaction was stirred at 0 C. for 10 min. The reaction mixture was warmed to room temperature and stirred for an additional 1.5 h. The solvent was removed by rotary evaporation. Purification by silica flash chromatography (20.fwdarw.9 40% EtOAc/CH.sub.2Cl.sub.2) yielded azide S12 (770 mg, 92%) as an off-white chalky solid.

(495) TLC: R.sub.f 0.35 (3:7 EtOAc/CH.sub.2Cl.sub.2). .sup.1H-NMR (600 Hz, CDCl.sub.3): 8.59 (s, 1H), 8.10 (s, 1H), 6.18 (d, J=2.4 Hz, 1H), 5.46 (dd, J=6.4, 2.3 Hz, 1H), 5.09 (dd, J=6.4, 3.5 Hz), 4.42 (dt, J=5.5, 3.5 Hz, 1H), 4.23 (s, 3H), 3.62 (d, J=5.5 Hz, 2H), 1.65 (s, 3H), 1.42 (s, 3H). .sup.13C-NMR (151 MHz): 161.3, 152.5, 151.0, 141.4, 122.2, 115.0, 90.7, 85.5, 84.1, 81.9, 54.4, 52.3, 27.2, 25.3. IR (ATR): 2988, 2941, 2100, 1725, 1597, 1578, 1478, 1415, 1315, 1211, 1156, 867, 730. HRMS calculated for C.sub.14H.sub.17N.sub.7O.sub.4 ([M+H].sup.+) 348.1420, found 348.1415.

(496) ##STR00334##

((3aR,4R,6R,6aR)-6-(6-Methoxy-9H-purin-9-yl)-2,2-dimethyltetrahydrofuro[3,4-d][1,3]-dioxol-4-yl)methanamine (S13)

(497) In a 25-mL roundbottom flask, azide S12 (280 mg, 0.81 mmol, 1.0 equiv.) was dissolved in 9:1 THE/water (2.4 mL). Solid triphenylphosphine (423 mg, 1.61 mmol, 2.0 equiv.) was added and the reaction mixture was stirred at room temperature for 15 h. The crude mixture was concentrated by rotary evaporation. Purification by silica flash chromatography (EtOAc, then 20.fwdarw.25% MeOH/EtOAc) and filtration through Celite afforded amine S13 (253 mg, 98%) as a white solid.

(498) TLC: R.sub.f 0.18 (1:9 MeOH/CH.sub.2Cl.sub.2). .sup.1H-NMR (600 MHz, CDCl.sub.3): 8.48 (s, 1H), 7.99 (s, 1H), 6.01 (d, J=3.1), 5.39 (dd, J=6.5, 3.1 Hz, 1H), 4.96 (dd, J=6.5, 3.5 Hz, 1H), 4.20 (m, 1H), 4.12 (s, 3H), 2.96 (dd, J=13.4, 4.4 Hz, 1H), 2.88 (dd, J=13.4, 6.0 Hz, 1H), 1.56 (s, 3H), 1.33 (s, 6H). .sup.13C-NMR (125 MHz): 161.2, 152.3, 151.3, 141.5, 122.4, 114.7, 90.7, 87.6, 83.7, 81.8, 54.3, 43.9, 27.3, 25.4. IR (ATR): 3370, 2990, 2942, 1601,1579, 1480, 1385, 1349, 1319, 1214, 1076, 869. HRMS m/z calculated for C.sub.14H.sub.19N.sub.5O.sub.4 ([M+H].sup.+) 322.1515. found 322.1521.

(499) ##STR00335##

Benzyl (N-(((3aR,4R,6R,6aR)-6-(6-methoxy-9N-purin-9-yl)-2,2-dimethyltetrahydrofuro-[3,4-d][1,3]dioxol-4-yl)methyl)sulfamoyl)carbamate (S14)

(500) In a 250-mL roundbottom flask, amine S13 (500 mg, 1.56 mmol, 1.0 equiv.) was dissolved in CH.sub.2Cl.sub.2 (100 mL). Solid ((benzyloxy)carbonyl)((4-(dimethyliminio)pyridin-1 (4H)-yl)sulfonyl)amide.sup.2 (678 mg, 2.02 mmol, 1.3 equiv.) was added and the reaction was stirred at room temperature for 16. The crude mixture was concentrated by rotary evaporation, dissolved in EtOAc, filtered through Celite, and purified by silica flash chromatography (0.fwdarw.5% MeOH/EtOAc) to afford Cbz-protected sulfamide S14 (740 mg, 89% yield) as a white solid.

(501) TLC: R.sub.f 0.36 (1:9 MeOH/CH.sub.2Cl.sub.2) .sup.1H-NMR (60 (1 MHz, CDCl.sub.3): 9.66 (d, J=9.7 Hz, 1H), 8.75 (s, 1H), 8.55 (br s, 1H), 7.95 (s, 1H), 7.28-7.20 (m, 5H), 5.85 (d, J=4.9 Hz), 5.21 (dd, J=6.2, 4.9 Hz, 1H), 5.16 (d, J=12.1 Hz, 1H), 5.04 (m, 1H), 4.58 (dd, J=2.3, 2.2 Hz, 1H), 4.17 (s, 3H), 3.54 (ddd, J=12.5, 9.7.2.4 Hz, 1H), 3.43 (m, 1H), 1.64 (s, 3H), 1.36 (s, 3H). .sup.13C-NMR (151 MHz): 161.5, 153.0, 151.2, 150.1, 141.7, 134.6, 128.6, 128.5, 128.2, 122.8, 114.9, 93.4, 82.8, 82.6, 81.7, 68.2, 54.5, 45.5, 27.5, 25.2. IR (ATR): 3066, 2870, 1742, 1600, 1479, 1455, 1418, 1375, 1355, 1318, 1263, 1216, 1156, 1124, 1068, 991, 909, 852, 799, 771, 727, 698. HRMS m/z calculated for C.sub.22H.sub.27N.sub.6O.sub.8S ([M+H].sup.+) 535.1611, found 535.1596.

(502) ##STR00336##

((3aR,4R,6R,6aR)-6-(6-Methoxy-9H-purin-9-yl)-2,2-dimethyltetrahydrofuro[3,4-d][1,3]-dioxol-4-yl)methyl)sulfamide (S15)

(503) In a 250-mL roundbottom flask, Cbz-protected sulfamide S13 (740 mg, 1.39 mmol, 1.0 equiv.) was dissolved in degassed methanol (47 mL). Solid 10% palladium on carbon (110 mg) was added and the reaction mixture was purged with hydrogen for 10 min, then stirred for 18 h under hydrogen atmosphere (balloon). The reaction mixture was filtered through Celite and concentrated by rotary evaporation. Purification by silica flash chromatography (1:19 MeOH/EtOAc) afforded sulfamide S15 (430 mg, 78%) as a fluffy white solid.

(504) TLC: R.sub.f 0.48 (1:9 MeOH/CH.sub.2Cl.sub.2).sup.1H-NMR (600 MHz, CDCl.sub.3): 8.68 (s, 1H), 7.98 (s, 1H), 5.87 (d, J=4.7 Hz, 1H), 5.29 (dd, J=6.3, 4.7 Hz, 1H), 5.15 (dd, J=6.4, 2.2 Hz, 1H), 4.60 (m, 1H), 4.22 (s, 3H), 3.58 (m, 2H), 1.66 (s, 3H), 1.39 (s, 3H). .sup.13C-NMR (151 MHz): 161.7, 152.7, 150.3, 141.7, 123.0, 115.0, 93.1, 83.0, 82.6, 81.4, 54.6, 45.2, 27.5, 25.2. IR (ATR): 3261, 3110, 2935, 1662, 1602, 1583, 1481, 1418, 1387, 1320, 1221, 1157, 1093, 856, 800. HRMS m/z calculated for C.sub.14H.sub.20N.sub.6O.sub.6S ([M+H].sup.+) 401.1243, found 401.1227.

(505) ##STR00337##

N(N-(((2R,3S,4R,5R)-3,4-Dihydroxy-5-(6-methoxy-9H-purin-9-yl)tetrahydrofuran-2-yl)methyl)sulfamoyl)-2-hydroxybenzamide (salicyl-6-MeO-AMSN, 6)

(506) In a 10-mL roundbottom flask, sulfamide S15 (20 mg, 50.0 mol, 1.0 equiv.) was dissolved in DMF (1.7 mL) and cooled to 0 C. O-MOM-protected salicyl-NHS ester.sup.23 (42 mg, 150 mol, 3.0 equiv.) was added, followed by Cs.sub.2CO.sub.3 (24.4 mg, 74.9 mol, 1.5 equiv.). The reaction mixture was stirred at room temperature for 3 h. The solution was diluted with EtOAc, filtered through Celite, and the filtrate was concentrated by rotary evaporation to afford a clear oil. The crude mixture contained both MOM-protected (R=MOM) and MOM-deprotected (RH) acyl sulfamides S16. The mixture was partially purified by silica flash chromatography (1:19 MeOH/EtOAc), and all fractions containing either MOM-protected (R=MOM) or MOM-deprotected (RH) acyl sulfamides S16 were combined. In a 25-mL roundbottom flask, the acyl sulfamides S16 were cooled to 0 C. ice bath, then dissolved in 4:1 TFA/water (1.2 mL). The reaction mixture was stirred at 0 C. for 1 h. TFA was removed by rotary evaporation (12 C. water bath). The crude mixture was diluted with water (5 mL), flash frozen with liquid nitrogen, and concentrated by lyophilization. Purification by silica flash chromatography (12% MeOH/EtOAc) afforded salicyl-6-MeO-AMSN 6 (8 mg, 36%) as a white solid.

(507) TLC: R.sup.1 0.15 (1:9 MeOH/EtOAc). .sup.1H-NMR (600 MHz, CD.sub.3OD): 8.73 (s, 1H), 8.40 (s, 1H), 7.83 (dd, 1H, J=8.3, 1.7 Hz), 7.43 (app dt, J=8.3, 1.7 Hz, 1H), 6.94-6.92 (m, 2H), 5.93 (d, 1H, J=6.9 Hz), 4.91 (dd, J=6.9, 1.7 Hz, 1H), 4.33 (dd, J=5.4, 2.9 Hz, 1H), 4.30 (app q, J=3.1 Hz, 1H), 4.21 (s, 3H), 3.51 (dd, 1H, J=13.6, 3.7 Hz, 1H), 3.37 (dd, J=13.6, 3.1 Hz). .sup.13C-NMR (151 MHz): 167.8, 162.5, 160.0, 153.9, 152.1, 144.6, 136.3, 131.0, 123.1, 121.0, 116.8, 115.8, 91.9, 86.0, 74.4, 73.3, 55.0, 46.6. IR (ATR): 2076, 1681, 1609, 1484, 1352, 1207, 1073, 980, 725. HRMS m/z calculated for C.sub.18H.sub.6O.sub.8S ([M+H].sup.+) 481.1142, found 481.1126.

(508) The structure of compound 6 as well as other relevant compounds used herein appear in Table 1.

(509) TABLE-US-00007 TABLE 1 Salicyl-AMS Compounds embedded image Cmpd. X R.sup.1 R.sup.2 R.sup.3 1 O OH H NH.sub.2 4a N OH H NH.sub.2 4b NMe OH H NH.sub.2 6 N OH H OMe

Example 2. Overexpression and Purification of H.SUB.10.MbtA.SUP.opt

(510) The gene mbtA.sub.tb was subjected to analysis for codon optimization for protein expression in E. coli using GenScript OptimumGene. Nucleotide changes suggested by this analysis were introduced into a synthetic mbtA.sub.tb (GenScript Corp.). The synthetic DNA (1,707 bp) included a 5-end NdeI site that contained mbtA.sup.opt's start codon and a 3-end BamHI site following the stop codon. The synthetic DNA was cloned into pET15b linearized by NdeI-BamHI digestion to generate pH.sub.6MbtA.sup.opt, which expresses N-terminally His.sub.6-tagged MbtAopt (H.sub.6MbtA.sup.opt). To construct the remaining nine pET15b derivatives, the mbtAopt segment of pH6MbtA.sup.opt was PCR amplified with specific primer pairs (Table 6) to generate nine alternative MbtA.sup.opt-polyhistidine tag fusions. The primers incorporated the appropriate tag, a stop codon when needed, and flanking NcoI and BamHI sites. Each of the amplicons was first cloned into pCR2.1-Topo, then excised from the pCR2.1 Topo construct using NcoI and BamHI, and recloned into pET15b linearized by NcoI-BamHI digestion to generate the protein-expression plasmids.

(511) Mtb MbtA (UniProtKB P71716), codon-optimized for expression in E. coli with an N-terminal His.sub.10 tag (H.sub.10MbtA.sup.opt, SEQ ID NO: 3 and SEQ ID NO: 4) was overproduced in E. coli BL21(DE3)pLysS carrying plasmid pH.sub.10MbtA.sup.opt (strains and plasmids used in this study are shown in Table 2A and Table 2B respectively). The strain was cultured in Luria-Bertani broth (Sambrook, J., et al. (2001) Molecular cloning: A laboratory manual, 3.sup.rd ed., Cold Spring Harbor Pres, Cold Spring Harbor, NY) in Fernsbach baffled flasks (wide-mouth, 2.8-L capacity) under rotary agitation (220 rpm) at 25 C. to OD.sub.600=0.3. The temperature was then reduced to 20 C. and incubation was continued. Protein overproduction was induced by addition of 1 mM IPTG (isopropyl -D-1-thiogalactopyranoside) at OD.sub.6000.6. After 16 h of additional incubation, the cultures were chilled on ice and the cells were harvested by centrifugation. The cells were resuspended in 20 mL of lysis buffer per liter of culture (50 mM Tris.Math.HCl, pH 8; 10 mM imidazole, 0.5 M NaCl; 20% sucrose: 1 mM -mercaptoethanol; 1 mM PMSF; 0.1% IGEPAL). Lysozyme (300 g/ml), DNase I (100 g/ml), and MgCl.sub.2 (25 mM) were added to the cell suspension, which was then incubated at 0 C. for 30 min and subsequently subjected to a freeze/thaw cycle for lysis. The lysate was then sonicated (Branson Ultrasonics Digital Sonifier; 230 sec, 90% intensity), diluted 1.3 times in lysis buffer, subjected to high-speed centrifugation (1 h, 20,000 g), filtered (2.7-m pore size Whatman filter paper), and degassed under reduced pressure. H.sub.10MbtA.sup.opt was purified from the cleared lysate by Ni.sup.2+-column chromatography using Ni-NTA Superflow resin according to the manufacturer's instructions (Qiagen) and an KTA Purifier UPC 10 FPLC System (GE Healthcare). The loaded column (7 mL) was washed with 5 column volumes of wash buffer (75 mM Tris-HCl, pH 8; 20 mM imidazole, 0.5 M NaCl; 5% glycerol) and proteins were eluted using an imidazole gradient [solvent A: wash buffer; solvent B: elution buffer (75 mM Tris.Math.HCl, pH 8; 0.8 M imidazole; 0.2 M NaCl; 5% glycerol)]. H.sub.10MbtA.sub.opt eluted at 0.36 M imidazole. Fractions containing H.sub.10MbtA.sup.opt were then dialyzed (Slide-A-Lyzer Dialysis cassettes; Pierce) into dialysis buffer (25 mM Tris.Math.HCl, pH 8; 0.2 M NaCl; 2 mM DTT; 5% glycerol), aliquoted, flash-frozen, and stored at 80 C. Protein fraction quality and protein concentration were determined by SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) analysis (Sambrook, J., et al. (2001) Molecular cloning: A laboratory manual, 3.sup.rd ed., Cold Spring Harbor Pres, Cold Spring Harbor, NY) and Bio-Rad Protein Assay (Bio-Rad Laboratories, Inc.), respectively.

(512) TABLE-US-00008 (SEQIDNO:3) ATGGGCAGCAGCCATCATCATCATCATCATCATCATCATCACAGCAGCGG CCTGGTGCCGCGCGGCAGCCATATGCCGCCGAAAGCGGCGGATGGTCGTC GTCCGAGCCCGGATGGTGGTCTGGGTGGTTTTGTGCCGTTCCCGGCGGAT CGTGCGGCGAGCTACCGTGCGGCGGGTTATTGGAGCGGCCGTACCCTGGA CACCGTGCTGAGCGATGCGGCGCGTCGTTGGCCGGATCGTCTGGCGGTTG CGGATGCGGGTGATCGTCCGGGCCACGGTGGCCTGAGCTACGCGGAACTG GACCAGCGTGCGGATCGTGCTGCGGCGGCGCTGCACGGTCTGGGTATCAC CCCGGGCGATCGTGTGCTGCTGCAGCTGCCGAACGGTTGCCAATTCGCGG TTGCGCTGTTTGCGCTGCTGCGTGCGGGTGCGATTCCGGTGATGTGCCTG CCGGGTCATCGTGCGGCGGAACTGGGTCACTTTGCGGCGGTGAGCGCGGC GACCGGCCTGGTGGTTGCGGATGTTGCGAGCGGTTTTGATTATCGTCCGA TGGCGCGTGAGCTGGTTGCGGACCACCCGACCCTGCGTCACGTGATCGTT GACGGTGATCCGGGTCCGTTTGTTAGCTGGGCGCAGCTGTGCGCGCAAGC GGGCACCGGCAGCCCGGCTCCGCCGGCGGACCCGGGCAGCCCGGCGCTGC TGCTGGTTAGCGGTGGCACCACCGGTATGCCGAAGCTGATTCCGCGTACC CACGACGATTATGTGTTTAACGCGACCGCGAGCGCGGCGCTGTGCCGTCT GAGCGCGGACGATGTTTATCTGGTGGTTCTGGCGGCGGGTCACAACTTTC CGCTGGCGTGCCCGGGTCTGCTGGGTGCGATGACCGTGGGTGCGACCGCG GTTTTTGCGCCGGACCCGAGCCCGGAGGCGGCGTTTGCGGCGATTGAACG TCACGGTGTTACCGTTACCGCGCTGGTGCCGGCGCTGGCGAAACTGTGGG CGCAGAGCTGCGAGTGGGAACCGGTGACCCCGAAGAGCCTGCGTCTGCTG CAAGTTGGTGGCAGCAAACTGGAGCCGGAAGATGCGCGTCGTGTGCGTAC CGCGCTGACCCCGGGCCTGCAGCAAGTTTTCGGTATGGCGGAAGGCCTGC TGAACTTTACCCGTATCGGTGACCCGCCGGAAGTGGTTGAACACACCCAA GGTCGTCCGCTGTGCCCGGCGGACGAGCTGCGTATTGTGAACGCGGATGG TGAACCGGTTGGTCCGGGCGAGGAAGGTGAACTGCTGGTGCGTGGCCCGT ACACCCTGAACGGTTATTTCGCGGCGGAGCGTGACAACGAACGTTGCTTC GACCCGGATGGTTTTTACCGTAGCGGCGATCTGGTTCGTCGTCGTGACGA TGGCAACCTGGTGGTTACCGGTCGTGTGAAGGACGTTATCTGCCGTGCGG GTGAAACCATTGCGGCGAGCGATCTGGAGGAACAGCTGCTGAGCCATCCG GCGATTTTCAGCGCTGCGGCGGTTGGCCTGCCGGACCAATACCTGGGTGA AAAAATCTGCGCGGCGGTGGTTTTTGCGGGTGCGCCGATTACCCTGGCGG AGCTGAACGGCTATCTGGACCGTCGTGGTGTGGCGGCGCACACCCGTCCG GATCAACTGGTTGCGATGCCGGCGCTGCCGACCACCCCGATCGGCAAGAT TGATAAACCTGCGATTGTTCGTCAACTGGGTATTGCGACCGGCCCGGTTA CCACCCAACGCTGCCACTAA (SEQIDNO:4) MGSSHHHHHHHHHHSSGLVPRGSHMPPKAADGRRPSPDGGLGGFVPFPAD RAASYRAAGYWSGRTLDTVLSDAARRWPDRLAVADAGDRPGHGGLSYAEL DQRADRAAAALHGLGITPGDRVLLQLPNGCQFAVALFALLRAGAIPVMCL PGHRAAELGHFAAVSAATGLVVADVASGFDYRPMARELVADHPTLRHVIV DGDPGPFVSWAQLCAQAGTGSPAPPADPGSPALLLVSGGTTGMPKLIPRT HDDYVFNATASAALCRLSADDVYLVVLAAGHNFPLACPGLLGAMTVGATA VFAPDPSPEAAFAAIERHGVTVTALVPALAKLWAQSCEWEPVTPKSLRLL QVGGSKLEPEDARRVRTALTPGLQQVFGMAEGLLNFTRIGDPPEVVEHTQ GRPLCPADELRIVNADGEPVGPGEEGELLVRGPYTLNGYFAAERDNERCF DPDGFYRSGDLVRRRDDGNLVVTGRVKDVICRAGETIAASDLEEQLLSHP AIFSAAAVGLPDQYLGEKICAAVVFAGAPITLAELNGYLDRRGVAAHTRP DQLVAMPALPTTPIGKIDKRAIVRQLGIATGPVTTQRCH

(513) MbtA.sub.tb catalyzes formation of the first covalent acyl-enzyme intermediate during MBT aryl-chain assembly (Quadri, L. E., et al. (1998) Chem. Biol. 5, 631-645) and is the molecular target of the antibacterial lead compound salicyl-AMS (1) (Ferreras, J. A., et al. (2005) Nat. Chem. Biol. 1, 29-32) (FIGS. 1A-C). Previous approaches for purification of recombinant MbtA.sub.tb expressed in E. coli have been characterized by low yields (0.1-2 mg/L) due to low expression, poor solubility, inefficient affinity tag removal, and/or the need of multiple purification steps (Ferreras, J. A., et al. (2005) Nat. Chem. Biol. 1, 29-32; Quadri, L. E., et al. (1998) Chem. Biol. 5, 631-645; Somu, R. V., et al. (2006) J. Med. Chem. 49, 7623-7635). Codon optimization, alternative polyhistidine-tag fusion strategies, and changes in expression and purification conditions were explored. Codon optimization was carried out, which led to changes in 322 of the 566 codons of mbtA.sub.tb (FIG. 2). Then ten different polyhistidine affinity tag strategies (vis. alternative tag lengths and locations, double tags, and a tandem tag) for the codon-optimized MbtA.sub.tb (MbtA.sup.opt) were evaluated (FIG. 3A). This included unconventional tags that have been shown to be advantageous with other problematic recombinant proteins (Khan, F., et al. (2006) Anal. Chem. 78, 3072-3079; Lee, J., et al. (2009) Protein. Expr. Purif. 63, 58-61). Pilot experiments for assessment of protein expression, solubility, and binding to Ni.sup.2+-charged resin revealed that N-terminal deca-His tagged MbtA.sup.opt (H.sub.10MbtA.sup.opt) had the best properties overall (not shown). Thus, H.sub.10MbtA.sup.opt was advanced to larger-scale overproduction and purification experiments that ultimately led to the final methodology used to obtain the enzyme for the biochemical and inhibition studies described herein. Overall, the optimizations and methodological improvements shortened the purification protocol by eliminating the need for tag cleavage and size exclusion chromatography, rendered purified H.sub.10MbtA.sup.opt with purity levels comparable to those reported for other recombinant MbtA.sub.tb variants (FIG. 3B), and permitted final yields of up to 8 mg/L. This represents a 4-fold increase relative to the highest yield previously reported for MbtA.sub.tb (Somu, R. V., et al. (2006) J. Med Chem. 49, 7623-7635).

(514) TABLE-US-00009 TABLE 2A Bacterial Strains Strain Characteristics Source or Reference Msm mc.sup.2155 Wild-type laboratory strain; EXO.sup.+ MBT.sup.+ Snapper, S., et al. (1990) Mol. Microbiol. 4, 1911-1919 Msm E Msm mc.sup.2155 with an in-frame, unmarked This study MSMG_0019 deletion; EXO.sup. MBT.sup.+ Msm M Msm mc.sup.2155 with an in-frame, unmarked Chavadi, S. S., et al. (2011) mbtA deletion; EXO.sup.+ MBT.sup. J. Bacterial. 193, 5905-5913 Msm EM Msm mc.sup.2155 with an in-frame, unmarked This study MSMG_0019 and mbtA deletions; EXO.sup. MBT.sup.+ Msm EM-pMbtA.sub.tb Msm EM carrying plasmid pMbtA.sub.tb; This study EXO.sup. MBT.sup.+ Msm EM-pMbtA.sub.sm Msm EM carrying plasmid pMbtA.sub.sm; This study EXO.sup. MBT.sup.+ E. coli DH5 Strain used for general cloning and Sambrook, J., et al. (2001) subcloning applications Molecular cloning: A laboratory manual, 3rd ed., Cold Spring Harbor Pres, Cold Spring Harbor, NY E. coli BL21(DE3)pLysS Strain used for high-efficienev recombinant Thermo Fisher Scientific Inc. protein overproduction

(515) TABLE-US-00010 TABLE 2B Plasmids Plasmid Characteristics Source or Reference pCR2.1-TOPO E. coli cloning vector Thermo Fisher Scientific Inc. pET15b E. coli gene expression vector Millipore Sigma pCP0 Mycobacterial expression vector Ferreras, J. A., et al. (2008). Chem. Biol. 15, 51-61 p2NIL Mycobacterial mutagenesis vector Parish, T., et al. (2000) Microbiology 146, 1969-1975 pGOAL19 Mycobacterial mutagenesis vector Parish, T., et al. (2000) Microbiology 146, 1969-1975 pH.sub.10MbtA.sup.opt pET15b derivative expressing N- This study terminally His.sub.10-tagged MbtA.sup.opt pH.sub.8MbEA.sup.opt pET15b derivative expressing N- This study terminally His.sub.8-tagged MbtA.sup.opt pH.sub.6MbtA.sup.opt pET15b derivative expressing-N- This study terminally His.sub.6-tagged MbtA.sup.opt pMbtA.sup.optH.sub.10 pET15b derivative expressing C- This study terminally His.sub.10-tagged MbtA.sup.opt pMbtA.sup.optH.sub.8 pET15b derivative expressing C- This study terminally His.sub.8-tagged MbtA.sup.opt pMbtA.sup.optH.sub.6 pET15b derivative expressing C- This study terminally His.sub.6-tagged MbtA.sup.opt pH.sub.6MbEA.sup.optH.sub.6 pET15b derivative expressing C- and This study N-terminally His.sub.6-tagged MbtA.sup.opt pH.sub.8MbtA.sup.optH.sub.8 pET15b derivative expressing C- and This study (N-terminally His.sub.8-tagged MbtA.sup.opt pH.sub.10MbtA.sup.optH.sub.10 pET15b derivative expressing C- and This study N-terminally His.sub.10-tagged MbtA.sup.opt pH.sub.62MbtA.sup.opt pET15b derivative expressing MbtA.sup.opt This study with an N-terminal His.sub.6-linker-His.sub.6 tag pMbtA.sub.tb pCP0 derivative expressing mbtA.sub.tb This study pMbtA.sub.ms pCP0 derivative expressing mbtA.sub.ms Chavadi, S. S., et al. (2011) J. Bacterial. 193, 5905-5913 p2NIL0019 p2NIL derivative carrying a MSMEG_0019 Tins study deletion cassette p0019 p2NIL0019-pGOAL19; MSMEG_0019 This study deletion cassette-delivery, suicide plasmid

Example 3. Assay or MbtA.SUB.tb .Activity and Inhibition

(516) The adenylation activity of H.sub.10MbtA.sup.opt and its inhibition were evaluated using a H.sub.10MbtA.sup.opt-optimized variation of the hydroxylamine-7-methyl-6-thioguanosine (HA-MesG) spectrophotometric assay (Wilson, D. J., et al. (2010) Anal. Biochem. 404, 56-63). The assay was carried out in a 96-well plate format as previously reported (Davis, T. D., et al. (2016) Bioorg. Med. Chem. Lett. 26, 5340-5345). The assay reaction mixture was optimized for H.sub.10MbtA.sub.opt activity. Optimization experiments included evaluation of various concentrations of Tris.Math.HCl (and pH), hydroxylamine, MesG, ATP, NaCl, MgCl.sub.2, glycerol, reducing agents (DTT and TCEP), and detergent (IGEPAL, CHAPS, and Triton-X100). Unless otherwise indicated for specific experiments, the optimized assay reaction mixture contained the following: 50 mM Tris.Math.HCl, pH 8.0; 3 mM MgCl.sub.2; 0.5 mM DTT; 0.1 U purine nucleoside phosphorylase (PNP); 0.04 U inorganic pyrophosphatase (PPT); 450 mM hydroxylamine; 0.4 mM MesG; 1 mM ATP; 300 M salicylic acid; 0.01% CHAPS buffer; 7.5% ultrapure glycerol; and H.sub.10MbtA.sup.opt at concentrations noted for specific experiments. When needed, MbtA inhibitors were added from 10% DMSO stock solutions, with a final DMSO concentration of 1% in both inhibitor-containing reactions and control reactions (no inhibitor). Reactions were preincubated for 10 min at 25 C. before being initiated by the addition of either salicylic acid for steady state kinetic analysis or H.sub.10MbtA.sup.opt for progress curve analysis. The phosphorolysis of MesG was measured continuously at either regular 1-min intervals (for steady state kinetic analysis) or 25-sec intervals (for progress curves analysis) for up to 45 min, at 360 nm and 25 C. in a DTX 880 multimode detector microplate reader (Beckman Coulter, Inc.). The concentration of active H.sub.10MbtA.sup.opt was validated by active-site titration (Copeland, R. A. (2013) Evaluation of enzyme inhibitors in drug discovery, pp 245-285, John Wiley & Sons, Inc.) using salicyl-AMS (1) as the reference inhibitor. The calculated concentration of total H.sub.10MbtA.sup.opt used in the assays was essentially indistinguishable from the concentration of active H.sub.10MbtA.sup.opt determined by active-site titration (not shown).

(517) The results of the first assessment of the activity of H.sub.10MbtA.sup.opt and its inhibition by salicyl-AMS (1) using the HA-MesG assay demonstrated enzyme activity and the expected TBI behavior for 1 (i.e. IC.sub.50 [E]) (FIG. 4A). Out of an abundance of caution, it was determined whether salicyl-AMS (1) had any inhibitory effect on the PPT-PNP coupling system of the HA-MesG assay. Four salicyl-AMS fragments that could possibly result from hydrolytic degradation of salicyl-AMS compounds and/or be present as trace contaminants were also tested (i.e., AMS (7, FIG. 1D), salicyl-sulfamate (8), salicylamide (9), and N.sup.3-5-cycloadenosine (10); Table 3) had a negative impact on the HA-MesG assay. It was found that salicyl-AMS compounds did not affect the PPT-PNP coupling system when tested at up to 40 M (10 times the maximum concentration of 1 used in the HA-MesG assay), and salicyl-sulfamate (8) depressed the H.sub.10MbtA.sup.opt-dependent signal in the HA-MesG assay, and only to a negligible extend (IC.sub.501 mM) (Table 3). Therefore, inhibition by an off-target effect of salicyl-AMS compounds or by potential trace amounts of fragments 7-10 is not an assay confounder.

(518) TABLE-US-00011 TABLE 3 Off-Target effect and nonspecific inhibition controls Effect of MbtA inhibitors on the activity of the PPT/PNP coupling system of the HA-MesG assay.sup.a Fractional velocity v.sub.1/v.sub.0 Inhib- Fractional velocity v.sub.1/v.sub.0 [inhibitor] = itor [inhibitor] = 4 M 40 UM 1 0.96 1.01 4a 0.94 0.96 4b 0.95 0.89 6 1.00 1.00 Effect of compounds shown on the MbtA.sub.tb-dependent Com- signal in the HA-MesG assay.sup.b pound Structure IC.sub.50 (mM) 7 embedded image >1 8 0embedded image 1 9 embedded image >1 10 embedded image >1

Example 4. IC.SUB.50 .Values

(519) The IC.sub.50 values were calculated by fitting the dose-response datasets (v.sub.i/v.sub.0 vs [inhibitor]; see FIGS. 4A-C for an exemplary graph resulting from a single experiment) to the sigmoidal equation v.sub.i/v.sub.0=b+a b/1+([I]/IC.sub.50).sup.s, where v.sub.i and v.sub.0 are initial reaction velocities of inhibitor-containing reactions and DMSO-containing reaction controls (no inhibitor), respectively, a and b are the top and bottom of the sigmoidal curve (solid line; R.sup.2 values 0.988), respectively, and s is the Hill coefficient. The data shown for each inhibitor (indicated in the label of the x axis) is derived from one of two independent dose-response experiments using H.sub.10MbtA.sup.opt at 250 nM. Resulting IC.sub.50 values are shown in Table 4.

(520) Pilot experiments were carried out to assess whether the tight-binding inhibitor behavior of the previously reported analogues (1, 4a) as per the ATP-PPi assay (Neres, J., et al. (2008) J Med. Chem. 51, 5349-5370; Somu, R. V., et al. (2006) J. Med. Chem. 49, 31-34; Somu, R. V., et al. (2006) J. Med. Chem. 49, 7623-7635; Vannada, J., et al. (2006) Org. Lett. 8, 4707-4710) was recapitulated under the conditions of the HA-MesG assay and whether the novel analogues salicyl-AMSNMe (4b) and salicyl-6-MeO-AMSN (6) were also a tight-binding inhibitor. Encouragingly, 6 displayed IC.sub.50 values [E], thus indicating tight-binding inhibitor behavior.

(521) TABLE-US-00012 TABLE 4 IC.sub.50 values Compound IC.sub.50 (nM) 1 117.2 0.3 4a 245.6 2.9 4b 174.6 4.3 6 288.9 16.4

Example 5. Progress Curves and Determination of Kinetic Parameters K.SUB.i..SUP.App., k.SUB.on..SUP.App., k.SUB.off., and t.SUB.R

(522) Reactions were pre-incubated for 10 min before being initiated by the addition of H.sub.10MbtA.sup.opt (1 M). The concentration range at which each inhibitor was tested was selected empirically by pilot experiments. The ranges were as follows: 4,000-1,041 nM range (1.4-fold dilution series) for 1, 4a, 4b, and 6. As done in similar studies, (Sikora, A. L., et al. (2010) Biochemistry 49, 3648-3657; McClerren, A. L., et al. (2005) Biochemistry 44, 16574-16583) the background-corrected spectrophotometric data were fitted to Eq. 2 (Morrison, J. F., et al. (1988) Adv. Enzymol. Relat. Areas Mol. Biol. 61, 201-301). In Eq. 2, A is the absorbance at time t, .sub.ps is the pre-steady state initial velocity, .sub.s is the steady-state velocity at equilibrium, and k.sub.obs is the rate constant for progression to steady state. The datasets of .sub.s vs. [I] derived from the progress curves were fitted to Eq. 1 to calculate the K.sub.i.sup.app values. The k.sub.obs values were determined with Eq. 2 for each inhibitor concentration. Each kinetic parameter reported is the average derived from a minimum of five independent experiments. Pearson correlation analysis between kinetic parameters was carried out using the statistical analysis package in Prism 6.01. Pearson correlation coefficients (PCCs) with Student's t-test p values 0.05 were considered statistically significant. Results are shown in Table 5 (K.sub.i.sup.app) and FIGS. 5A-6C.

(523) For each compound, the progress curves displayed a nonlinear profile of H.sub.10MbtA.sup.opt inhibition with the characteristic three phases of a time-dependent, slow-onset mechanism of inhibition (FIGS. 5A-C); i.e., an initial linear phase that extrapolates to a slope corresponding to a pre-equilibrium initial velocity (vps) at t=0; a final linear phase with a slope representing the equilibrium, steady-state velocity (vs): and an exponential phase that connects the two linear phases with a pseudo-first order rate constant (kobs) for the approach to the steady state (Morrison. J. F., et al. (1988) Adv. Enzymol. Relat. Areas Mol. Biol. 61, 201-301; Copeland, R. A. (2013) Evaluation of enzyme inhibitors in drug discovery, pp 203-244, John Wiley & Sons, Inc.). In contrast, the progress curves for uninhibited reactions (DMSO controls) showed the expected linear profile of the steady-state kinetics (FIGS. 5A-C). Thus, the results demonstrated that salicyl-AMS (1) and its analogs including salicyl-6-MeO-AMSN (6) are slow-onset inhibitors of H10MbtAopt. Encouragingly, the results also provided the first indication of the potent activity of salicyl-AMSNMe (4b) and salicyl-6-MeO-AMSN (6) against MbtA.sub.tb.

(524) Interestingly, salicyl-6-MeO-AMSN (6) remains a fairly potent inhibitor of MbtA.sub.tb, despite the lack of a hydrogen-bond donor on the C6-substituent and the presence of the sulfamide linker. This result was unexpected based on previous SAR studies (Neres, J., et al. (2008) J. Med. Chem. 51, 5349-5370), and is not readily rationalized based on protein structure analysis (May, J. J., et al. (2002) Proc. Natl. Acad. Sci. 99, 12120-12125; Labello, N. P., et al. (2008) J. Med. Chem. 51, 7154-7160). Nonetheless, it opens the door to further investigation of such C6-substituents.

(525) v i v 0 = 1 - ( [ E ] + [ I ] + K i app ) - ( [ E ] + [ I ] + K i app ) 2 - 4 [ E ] [ I ] 2 [ E ] Eq . 1 A = v s t + v ps - v s k obs [ 1 - e ( - k obs t ) ] Eq . 2

(526) TABLE-US-00013 TABLE 5 K.sub.i.sup.app values Compound K.sub.i.sup.app (nM) 1 26.6 2.5 4a 295.3 23.9 4b 158.5 8.1 6 277.1 12.2

Example 6. Bacterial Culturing and Recombinant DNA Manipulations

(527) Msm mc.sup.2155 (ATCC 700084) (Snapper, S. B., et al. (1990) Mol. Microbiol. 4, 1911-1919) and its derivatives were regularly cultured under standard conditions in Middlebrook 7H9 or 7H11 (Difco) supplemented as reported (Chavadi, S. S., et al. (2011) J. Bacterial. 193, 5905-5913). Msm strains were cultured in Fe-limiting GASTD medium or GASTD supplemented with 100 M FeCl3 (GASTD+Fe medium) (Ferreras, J. A., et al. (2005) Nat. Chem. Biol. 1, 29-32; Ferreras, J. A., et al. (2011) Bioorg. Med. Chem. Lett. 21, 6533-6537) for specific experiments as noted below. Routine culturing of E. coli strains was done under standard conditions in Luria-Bertani media (Sambrook, J., et al. (2001) Molecular cloning: A laboratory manual, 3.sup.rd ed., Cold Spring Harbor Pres, Cold Spring Harbor, NY). When required, kanamycin (30 g/ml), chloramphenicol (34 g/ml), ampicillin (100 g/ml), sucrose (2%), and/or 5-bromo-4-chloro-3-indolyl--D-galactopyranoside (X-gal, 70 g/ml) were added to the growth media. DNA manipulations were carried out using established protocols and E. coli DH5. as the primary cloning host (Sambrook, J., et al. (2001) Molecular cloning: A laboratory manual, 3.sup.rd ed., Cold Spring Harbor Pres, Cold Spring Harbor, NY). PCR-generated DNA fragments used in plasmid constructions were sequenced to verify fidelity. The oligonucleotides used in this study are shown in Table 6. Genomic DNA isolation, plasmid electroporation into Msm, and selection of Msm transformants were carried out as reported (Ferreras, J. A., et al. (2005) Nat. Chem. Biol. 1, 29-32.). Unless otherwise indicated, molecular biology, biochemical, and microbiology reagents were purchased from Sigma-Aldrich, Invitrogen, New England Biolabs, QIAGEN, or IDT.

(528) TABLE-US-00014 TABLE6 Oligonucleotides Name Sequence(5.fwdarw.3) Comments OF0019 ACTTTGGTCGTCGGATTCCTGCTGGTGCG Primersusedforamplificationofthe5fragment IR0019soe CTATCCAGAAGCCACATCCGCGGTCACGTGCGAGCGTCC fortheMSMEG_0019deletioncassette OR0019 ACATTGGCTTCGCGCCATGGCACCGATTTT Primersusedforamplificationofthe3fragment IF0019soe CACGTGACCGCGGATGTGGCTTCTGGATAGTGGCCGGAA fortheMSMEG_0019deletioncassette IF0019 ATCTTCTGAACACGCTCAAGGC Primersusedforamplificationofinternal IR0019 AGGTAGTTGAACAGCAGTTGCG segmentofMSMEG_0019 mbtA.sub.tbF1 TAGTTAACGAGGAAACCCACATGCCACCGA PrimersusedforgenerationofRBS-mbtA.sub.tb mbtA.sub.tbR1 TAGCTAGCTCAATGGCAGCGCTGGGTCGTCA amplicon mbtAopt- TACCATGGGCATGCCGCCGAAAGCGGCGGAT mbtA.sup.optamplification;introductionof5-end F NcoIsite mbtAopt- TACCATGGGCAGCAGCCATCATCATCATCATCACAGC mbtA.sup.optamplification;additionofN-terminal H6F His.sub.6tagand5-endNcoIsite mbtAopt- TACCATGGGCAGCAGCCATCATCATCATCATCATCATCA mbtA.sup.optamplification;additionofN-terminal H8F CAGCAGCGGCC His.sub.8tagand5-endNcoIsite mbtAopt- TACCATGGGCAGCAGCCATCATCATCATCATCATCATCA mbtA.sup.optamplification;additionofN-terminal H10F TCATCACAGCAGCGGCC His.sub.10tagand5-endNcoIsite mbtAopt- TACCATGGGCAGCAGCCATCATCATCATCATCACAGCCG mbtA.sup.optamplification;additionofN-terminal H6X2F TGCGTGGCGTCATCCGCAGTTTGGCGGTCATCATCATCAT His.sub.6x2tagand5-endNcoIsite CATCACAGCAGCGGCC mbtAopt- CCGGATCCTTAGTGGCAGCGTTG mbtA.sup.optamplification;introductionof3-end R BamHIsite mbtAopt- CCGGATCCTTAGTGGTGGTGGTGGTGGTGCAGGCCGCTG mbtA.sup.optamplification;additionofC-terminal H6R CTGTGGCAGCGTTGGGTGGTAAC His.sub.6tagand3-endBamHIsite mbtAopt- CCGGATCCTTAGTGGTGGTGGTGGTGGTGGTGGTGCAGG mbtA.sup.optamplification;additionofC-terminal H8R CCGCTGCTGTGGCAGCGTTGGGTGGTAAC His.sub.8tagand3-endBamHIsite mbtAopt- CCGGATCCTTAGTGGTGGTGGTGGTGGTGGTGGTGGTGG mbtA.sup.optamplification;additionofC-terminal H10R TGCAGGCCGCTGCTGTGGCAGCGTTGGGTGGTAAC His.sub.10tagand3-endBamHIsite

Example 7. Generation of M. smegmatis Mutants E, EM, and EM pMbtA.SUB.tb

(529) Mutants were generated using the p2NIL/pGOAL 19-based flexible cassette method (Parish, T., et al. (2000) Microbiology 146, 1969-1975) as reported (Chavadi, S. S., et al. (2011) J. Bacteriol. 193, 5905-5913). Exochelin (EXO)-deficient Msm E carried an unmarked, in-frame deletion of MSMEG_0019 (SEQ ID NO: 5), encoding the peptide synthetase (7,523 amino acids, the largest protein in Msm (Mohan, A., et al. (2015) Genome Announc. 3) required for biosynthesis of EXO siderophores (Fiss, E. H., et al. (1994) Mol. Microbiol. 14, 557-569; Yu, S., et al. (1998) J. Bacteriol. 180, 4676-4685; Zhu, W., et al. (1998) Mol. Microbiol. 29, 629-639). A MSMEG_0019 deletion cassette-delivery, suicide plasmid (p0019) was used to generate the chromosomal deletion, which eliminated codons 5 through 7,519 of the gene. The deletion cassette contained from 5- to 3-end: the 984-bp segment upstream of the gene, the gene's first 4 codons, the gene's last 4 codons, the stop codon, and the 1,029-bp segment downstream of the gene. To generate the cassette, primer pair OF0019 and IR0019soe and primer pair IF0019soe and OR0019 were first used to generate the 5 fragment (1,011 bp) and the 3 fragment (1,059 bp) for the cassette, respectively, from genomic DNA template. The fragments, which had a 30-bp overlap at the splice site embedded in IF0019soe and IR0019soe, were then used together as a template for PCR with primers OF0019 and OR0019 to fuse the fragments. The PCR-generated cassette was cloned into pCR2.1Topo (TOPO TA Cloning Kit, Invitrogen, Thermo Fisher Scientific Inc.), then excised from the pCR2.1Topo construct using HindIII and EcoRV, and religated into p2NIL (Parish, T., et al. (2000) Microbiology 146, 1969-1975) linearized by HindIII-PmII digestion. The resulting plasmid (p2NIL0019) and pGOAL19 (Parish, T., et al. (2000) Microbiology 146, 1969-1975) were digested with PacI, and then the PacI marker cassette of pGOAL19 was ligated to the linearized p2NIL0019 to create p0019. Electroporation of p0019 into Msm wild-type (WT) and selection of potential single- and double-crossover mutants were conducted as reported (Chavadi, S. S., et al. (2011) J. Bacterial. 193, 5905-5913). The MSMEG_0019 deletion was screened for and confirmed by PCR using two primer pairs (OF0019 and OR0019: yielding an undetectable 24,585-bp amplicon for WT and a 2,040-bp amplicon for mutant: IF0019 and IR0019: yielding a 148-bp amplicon for WT and no amplicon for mutant) (not shown).

(530) TABLE-US-00015 (SEQIDNO:5) MTADSLDIAELLELWNNHSTPERTSTVPTLFAAQCALTPDEVAVVDGERRLTYRHLETHVAQ LAHAVRVAAGEGPEPIVAIGVPRSAEMVVCVLAAMMAGVAFVPLDPSWPAHRRRQVLADSGA VATFITREDESDWGVPGLRVDLGAWQFTAESPVLPQADVHPAQLAYVIFTSGSTGKPKGAMI RHDAIAERLQWQRDHILHFGKHDHTDASLFKAPLSFDISVNEILLPLVSGGRVVVAVPDGEK DPEYLLELIRTEQVTFVYLVSSMLDTLLELDRLATADGAPSSLASLRHVWCGGEVLTPGLFA RFRKQLTTTLYHGYGPAEATIGVSHVIYRDTAERIATSIGRPNPHTQLYVLDEYLRPVPPGV GGELYAAGFLLGRGYVNAPSLTASRFVANPFDGNGSRMYRTGDLARWTEDGSLEFLGRADNQ VKIGGRRVELEEIESQLADHPAVRHAVVDVHRQGGADVLVGYLVAADGVRNDAAWHAEVADW ARTRLPEYMVPKAFVALDQVPLTANGKTDRRALPAPDLERSGTVKPPRTPRETVLCQVFADA LDIDAVGVDEDFFALGGDSIVAIRVVSRLRAAGYTLRPRDMFAHRTVEALAPLLGDSDVRDT GPAVDPTGAATPTPILRWLDEVGTAGSVLNGFHQGMSLVTPADADENTLRAAIAATVRRHHV LWAPPGRTASDIDIPGTPPETRLLIADASDGIPAQAEKVARQLVSLLDTARIAFGWIRRPAA PGRLVVIADHTVIDGVSLRILAEDIATAYGLIAEGRAVELPTPHTSWRAWAQRLADTAAAGG FDADLEHWQQVCATTETPWGDRALDPAIDTVATESRLTVELPSAVTDAILTTVPDRIHGHVN DALVAALYLALRRWLHTRGVGADTLLVEMEGHGREGHLVDSDTAGLDLSNTVGWFTTLYPVA LRDAEFDWQAAVSGGPQLGAAVRSVKDQLRSVPSHGFSYGALRYLRDGTSGLEAAPQVLFNY LGRFGTADRPWALANDTTAVLEDRDPGMPLPRLLEVNAEAVTTADGSVLRATFSWPAHAVAE VDVRTLAGMWTDLLTAIASSDDVRGHSASDFDRVSVTADDVAELERRYPGLTDLLPLTPTQQ GIYFHSTFSRDRDPYVVQQIVDITGPLDTERFQRATESVAARHRALGAVFTTLSDGTPVAVH AATVAPDFDVLDARHAADPSTVVAQRARWERERRFDLAAAPLTRYTLVRRRDDLHTMIETVH HIVADGWSVPIVLDDLLTAYAGDDFDGPAPEFARFVDWLEQRDTDSDRAAWAPALEDITEPT RLAAADGARGRTTGSGFGTRTVTLQSRSAVADAANGAAVTVGTLLHTAWGLALGRLTGRDDV VFGTVVSGRGADVHGIESMVGLLVNTVPVRVAWSADDTGADVAGRLAAVESTLLEHHHLPLT EAHRLAGVGELFDTLVVIENLGATTHTRGDLTLGDIGVIEAPHYPLTLMISVRDTITVTVTN DREHVSDVLADTAVAAFTEVLTALTADPGVSPGDIALPAPQATAPPTQAPQTVTDLIAAAIA EHRDDIALVVGETEWTYGQLGARAGELAAALAEAGVRRGDIVALATARSADLVAAIWAIIAA GAAYLPVDLAYPRTRIEYMLRHARPTAVIADGVGAHVVSGALPADTIVVSTTATHAAVPFTP VPVDGADAVSVLYTSGSTGEPKAVVGTHAALANRLAWAVEAWPAATRIAKSPLSFIDGTTEL LAGLAAGARTVLAGDETARDGRRLAQLVAAHGVEQLLAVPSLAAVLADERTEDVAELNRWIV SGEALSPRHLHALRTACPTAEIVNSYGSSEVAGDVLAGVQDDAGITLGAAVPGAGIRILDSR LRQLPAGVIGEIYVTGGQLARGYLGRPGQTATRFVAAPGGERMYRTGDLGALLPGGRVVFAG RADDQLKINGHRVEPGEIESVLARQPGVREAAVIGTGTQLAAFVVLESDAPGAGDLLTAVSA ELPGHLVPSSLRPVDAIPLLPNGKRDNNALRSLLVPGESTGTAPTNDVERAVLDVMTGVLGR DPLGADDDFFAVGGDSISAIRVTSRLARAGYHIATEDVFRGRTAAGVAALVDTVESLAHDAA IEPFATVRLSPQTIDRIRESGQVEDIWAMSPLQLGVYYQSTLADAGPTYIAQNVFEFDRRID VDAMRRAFTALLRRHPQLRAGFRTVEHAEPEPAPDATPVVQVVVTDPPSDLTVVDLTDQDDP AAAQHIVDTDRTAPFDVATPPLLRLTVIRLPGGRDRMLFTYHFLLFDGWSRELVLRDLFALY DSDAQHGAIAPHGDLVVRHLQWLATDGDFQASGARDAWRDLLAGLTEPTLASGVSPDHPDAR PGTEPGRIVVRVPEDVTTQLHTCATAHGATLNSVVTAAVALVTGYHAGTTDVVIGTTVAGRP GHLVGIDETIGLFLNTVPVRVDMSPTRSVAAAMASIGEQRVAMMRHDHLGLGQIQRAAGDSG SALFDSLLVLQNFLDDDTFTDLESRHGIVDVSYKDTTHFPLTWVLTPGRELAIKLEHRVVDD ARATEMVEQLVTVLRTIAAEPDTAVGAVDLIGADRRAQLERRWSSTERPLEPVTIAELLARR AEQNPDDVALVFGAQSVTYREFDDRVSQFARHLRARGAAPETFVALALPRSIDMVVALFAVL RAGAAYLPLELDLPIDRLRTIIDNAEPVLLVTTTDRTELIGHARARGADVIALDDAETAATL ADTPAHPLTAGELGAFASDSTRLNHPAYLIYTSGSTGRPKGVLTGYAGLTNMYFNHREAIFA PTVARAGSAEQLRIAHTVSFSFDMSWEELFWLVEGHQVHVCDEELRRDAPALVAYCHRHRID VINVTPTYAHHLFDAGLLDDGAHTPPLVLLGGEAVGDGVWSALRDHPDSAGYNLYGPTEYTI NTLGGGTDDSDTPTVGQPIWNTRGYILDAALRPVPDGAVGELYIAGTGLALGYHRRAGLTAA TMVADPYVPGGRMYRTGDLVRRRPGSAELLDYLGRVDDQVKIRGYRVELGEIESVLTRADGV ARCAVVARATGANPPVKTLAAYVIPDRWPAEDAAFITGLRDHLARVLPGYMVPTRYGIVDTL PLTINGKLDVAALPEPIAATSGTGRTPRTDREATLLEIVASVLGIDGIGVDDDFFTLGGDSI SSISVCGRARKAGLNITPRDVFRRRTIAALAASADTTQTPESGPDTGTGAITATPMLAETAQ ANTPLTNFYQAMVLATPAGITAHEVQRVLQTVVDAHAMLRARLVTTATGWTLTVPDQTAAIG LTVRSGALTSDCVEAEKAAAAAELDPRAGNMVRAVWFDAPEASGQLLLVIHHLVIDGVSWRI LSEDLSRAWNDLAAGRDVAADAVPTSFHTWANALAQRTFDDESEYWADVLATPDPDLGSRPP DPAIDTADTVRSHEVTLASDVTEALLTSVPAAMHGGVNDVLLTGLAVALAQWRADRGHSQNT AAVISLEGHGRESDLVAADLDLSRTVGWFTSIYPVRIDPGPLEWDTVRSAGAELAAAAKAVK EQLRAVPNRGLGYGVLRHLHGALDGTPPQILFNYLGRFTGGSGNDWRPVAGIGALTEGVDPS NPAMSLEINALAEERPDGTVLSMTLAWPGGLLDADDVSELGSMWADVLVALTRCDALRGHTP SDFGLVTVSQDDIDGWDRLGEVEEVLPLLPLQEGMYFHSMFGDPATDTYRVQQIAQLSGPVD PEVLRTSLTVVMRRHQALRASFNELTDGRVAQVIWSDVPVQLTVVDTDDLESIAAEELARPF NLAEAPLVRYMLVRLGDDDHRLVQTMHHIIADGWSYPVLFGDIVDHYNAAIGVGSAPQPITV TLRDHIETVTDRDRGAARQAWEQALAGAEPTALVPRPDGAPVGEHRSVVRRLDSARTAAVGR AARVHGVTVGTVLHGAWGLMLGRLLGRNRVVFGSTVSGRGGDLAGTESIVGLLINTIPVPMS WEPHATLASALIDLQDQQSALLDAQQMGLAELARLAGVREFFDTMVIVENFPSTSSAEHTDP RAVAFRGFTGTDSPHYPVSFVAYADDQLTVEIKYDAGVVTPEQAERYAERVERILTAFAETP DLPVSRIDLRTNAERQFTAGHASRPGPGRTLGASFAEVAATYPDAVAVSCGDTRLTYRELDD RAAAVAATLAERGVGAESRVAIALPRSADLIVAVLAVIKAGGTYVPIDIGAPAARVQHILAD SAPVCLLTDTAERFTGVPHVILAEAAQNPARPQAPTVSPDHAAYVIYTSGSTGVPKGVEVTH RNVAALFAGTTSGLYDFGPDDVWTMFHSAAFDFSVWELWGPLLHGGRLVVVEHDVARDPERF VDLLARERVTVLNQTPSAFYPLLEADARLRRQLALRYVIFGGEALDVRRLAPWYANHESHSP RLVNMYGITETCVHVSHRALDTADTGAAGSVIGGPLPGLRIHLLDNNLQPVPAGVVGEMYIA GGQVARGYTGRPGLTATRFVANPFDGAGERLYRSGDLAMWTDAGELVYLGRSDAQVKVRGYR IELGEVEAALVTLPGVTNAAADVRHDDTGRARLIGYVVGDALDIGALRSTLAERLPDYMVPS VLLRLDVLPLTVNGKLDRAALPDPEPVEQAPAPVAGTGTASLLAGLCTEILGTTVGVEDDFF TAGGDSIIAIQLVNRARREGVRITPQQVFVHRTPAALASVLDTGSVAAPDATPDEDAGPDLG EVMLTPIVQRLAELGGTVTRFNQSELLRTPAGATVARLETAINAVIARHDALRIRLHRPAPM LWSLETTAAAPVSITRIDAHGFDDEQLRTVIATESDAAADRLDPENGVVVVAVWFDRGTDTQ GRLLLVVHHLAVDGVSWRILLDDLAEAYRQALSGQRVAPAPVTTSLRQYARTVNENAQHSSR LTEFEHWTEVLAPGGELVATADVVTLTVGATRDHEIRLSTEDTAPLLTTVPAAANADVTETL VAALHLAVSRWRAARGEAADAPLVLSLERHGRDGWPDDVDLSRTVGWFTSIAPVRLPAPGED LLNTLKAVKESLRAAPDGGLGFGQLRYCNPRTSAVLARLGTPQLLFNYLGRWAADACDDWAS APEVDALRTEPNPDLGTPYLVEVNAICDDTVDGPRLRATLTYADGELDEPSVAELGELWVAA LRELGSLATGGDAALTPSDLPLVTLTQEHIDRVTGAVPGNVETIWPLSPLQEGVYLQARYAT AAVYIVQNVFDFAEPVDTTALRTAYSAVMARNPVLRSAFWADDLPQPVAAIVADPVCEPRVV DLGGLPATQVERRVEEITADDRQQTFDLAAAPLARMTVLRTPDRDRLIFSYHFLLLDGWSRE QLLRELFAEYTAARGGAVAQLPAPTADFTDYLRWLARQDRDVSAREWSEALRDLEAPTLLVP DAVGTDPTLALRLEFLLSEADTAALTAAARSAGVTLNALISTALAMVLAYETGRDDVVFGST VAGRPTDLDGIDSVIGLFLNTVPTRVRLAPHRTVADTMRAVQSDRLRLMDHEYLGLGDIQRA VSTGGGPLFDSLYVLQNFLDDDTFTDMEAQYGIVGHDSIDASHYPLTWVASPGRRLWMKLEY RPDVVERDRAQGLLDRLRQVLLQVGTGVERPSAALTLPLPAEADHKRTRDAATEHDLPHASV LDLLAERAVQSGDLTALVCGGEFVDYAELLARVNRLAWVLRSRGIGPEDTVALAVPRSIDAV VALFAVLRAGAAYLPLELDYPDERLAVMLGDAEPVRVLVTGATAQRIARVASAPLTVLDAPD TCDELARARSDWDGYSPHPDQPAYVIYTSGSTGKPKGVVTPHRGLTNMHLNHREAIFAPTIA RAHGRRLKIAHTVSFSFDMSWEELLWLIEGHEVHICDEVLRRDATSLVRYCHDHRIDVINVT PTYAALLFEEGLLEQAGHPPVLVLLGGEAVSTTVWNRLRDSERWYGYNLYGPTEYTINTLGG GTDDSATPTVGTPIWNTRAHILDNWLRPVPDGVPGELYIAGAGLARGYLGQPGLTASRFVAN PFEPGRMYRTGDLVVRRADDNIDFLGRTDDQVKIRGYRVELGDIEAALVSHPGVSQAAVIAR PDTAGSSRLVAYVVPTTENPDVLDDLRMHLTATLPAYMVPTAMATLTEIPLTDNGKLDTRAL PDVAPIGRHGAGRAPQGAVEATLCSVFAEVLGLDGPDGLSVDDDFFDLGGHSLLTIRLISRI RSELGAELTLGDVFNSRTVAALARHVTADEGDNRRPRLVAGPRPQHIPASPAQRRMLMLDRL GETGSAYNYPLVFRVRGALDVDALRDALTAVVDRHEALRTVFDDRDGVYHQRILPRGTQPPL HVSDCPEHELATRADALVEHRFDLTGEIPLRVDVLRSGPEDHTVVMLLHHIAIDEWSDAVFL ADLDAAYAAHRAGTAAPLPEPVVQYADHTLWQRDVLAQLGDRQREFWRTALAGAPDELALPA DRPRPARPTGAGGTLDVEITAETASALRRLAADKQVSMLMVLHAAVAVLIHRLGAGDDIVVG TPVAGRDDAALDDVVGLFVNTVVLRADLAGNPTFTELLDRVRTADLAAFAHQDLPFDHLVEE LNPPRVAGRNPLFNLFVGYHLRSGTDSDMFGLPTEWTEPAVSAAMFDLGFTLVDHGGDESAS ITAEYAADLFDASTVHTLARRLVALLDHVVADAETRIGALDLLAPGEHDTLVVEHNATEHPL EPITLGALVSRQATSTPHATALRYEESELSYRDLDGWSDRLAAHLSARGAAPGTVVGVSLPR SVELVVALVAVAKSGAAFLPLDPEYPRERLEYMVSDARPITVLDDPDAVRRSRGEPDGELPR IDPAAWAYVLYTSGSTGRPKGVAVAHAGIVNRIACLQHAYPLGTDDRMLVKTPISFDTSVWE VFWPLSVGATLVVARPGGHREPAYLAAMIAEQCVTAVDFVPSMLEVFLDEVAGTCASLTRVT VGGEALTTELAARFAEAFPGVPLHNLYGPTEAAVDVLGWTADGGPVALGVPGWNVRAYVLDD YLNPVPAGAPGELYLAGIQLADGYLHRGALTAARFVASPFDQGARMYRTGDVVRWRADGQLE YLGRSDDQIKLRGVRIEPGEIETVLATHPAVSSVRVIARGGRLMAYYVPAGVEASAGELRDE LREHAAAALPSHMVPSGFVALTEFPLTPSGKLDRRALPEFAGATAGVPGRAPTTERQHRLCE LFSDVLGLEVTGIDDDFFVLGGHSLLLVRLAAALRREFSVDVPVADLMVSPTVADIDQRLDA AGSSVDSLAPVLPFRASGTDAPLFCVHPASGLSWQFAGLKRHLPRQIPIYGLQSPLFTGTPL PESIAELTARYADTIVAVAPSGPVRLLGWSFGGSMALLIAQELSRRGREVTFVGMLDARTDT ADPNAGFDPEAVLAGLLREMGFGVDPQARMTVADAVALVRDTDDAITVLDDEQIALVIENYV AAERLTADADYGRYDGDVFFVDATILEMDLAGVASRGWHDHVGGRLKVAELDCRHSELMDAE VLERLGPLIAAELRGGDVASG

(531) EXO/MBT-deficient Msm EM carried the MSMEG_0019 deletion noted above and an unmarked, in-frame deletion of mbtA.sub.sm, encoding the salicyl-AMP ligase essential for MBT biosynthesis (Chavadi, S. S., et al. (2011) J. Bacteriol. 193, 5905-5913). The mbtA.sub.sm deletion (MSMEG_4516, SEQ ID NO: 6) left behind only the gene's start codon followed by the stop codon, and it was created in Msm E with the same approach reported for generation of the identical mbtA.sub.sm deletion in Msm WT to generate the mutant referred hereafter to as Msm M (Chavadi, S. S., et al. (2011) J. Bacteriol. 193, 5905-5913).

(532) TABLE-US-00016 (SEQIDNO:6) MTLTTPHPRPEQSESAAQSSLLAGFTPFPAERAQAYRAAGYWRDQLLDS VLRTAARTWPDHIAVIDADHRHTYAELDRLADRAAAGIAGLGIRPGDRV LVQLPNTAEFAVALFGLLRAGAVPVMCLPGHRLAELTHFAEVSSAVALV VADTAGGFDHRDLARELVRSHPDVRHVLVDGDAAEFLSWAEVTRAAPGP VPEIAPDPAAPALLLVSGGTTGAPKLIPRTHQDYVYNATASAELCRLTA DDVYLVALPAAHNFPLACPGLLGAMTVGATTVFTTDPSPEAAFAAIDEH GVTATALVPALAKLWAQACAWEPLAPKTLRLLQVGGAKLAAPDAALVRG ALTPGLQQVFGMAEGLLNYTRIGDPPEVLENTQGRPLSPDDEIRIVDEV GNEVPPGAEGELLVRGPYTLNGYFNAEAANERSFSPDGFYRSGDRVRRF ADGPLAGYLEVTGRIKDVIVRGGENVSALDLEEHLLTHPSVWAAAAVAL PDEFLGEKICAVVVFNGPPVSLAELHAHLEQRGVAAHSRPDALVPMPSL PTTAVGKIDKKAIVRQLGG

(533) A strain complemented with Mtb MBT, Msm EM-pMbtA.sub.tb was generated by transformation of Msm EM with pMbtA.sub.tb (expressing mbtA.sub.1b). To construct pMbtA.sub.tb, a DNA fragment encompassing mbtA of Mtb (mbtA.sub.tb, Rv2384, (Chavadi, S. S., et al. (2011) J. Bacteriol. 193, 5905-5913)) was generated by PCR from genomic DNA template using primer pair mbtA.sub.tbF1 and mbtA.sub.tbR1. The PCR product, which included an optimized ribosome-binding site (Ma, J., et al. (2002) J. Bacteriol. 184, 5733-5745) upstream of mbtA.sub.tb introduced by primer mbtAtbF1, was cloned into pCR2.1Topo. Subsequently, the insert was recovered from the pCR2.1Topo construct as a HpaI-NheI fragment and subcloned into the mycobacterial, low-copy number plasmid pCP0 (Ferreras, J. A., et al. (2008). Chem. Biol. 15, 51-61) linearized by HpaI-NheI digestion. This subcloning created pMbtA.sub.tb, in which mbtA.sub.tb is under the control of the constitutive mycobacterial hsp60 promoter located in pCP0.

(534) The study of the antimicrobial properties of tuberculosis lead compounds using Mtb is challenging due to the need for biosafety level 3 procedures and the bacterium's slow growth rate. Thus, to simplify the analysis of the antimicrobial properties of MbtA.sub.tb inhibitors, it was desired use the nonpathogenic, fast-replicating Msm model system. Msm has the MBT siderophore system, and we have shown that the MbtA.sub.tb orthologue in Msm (MbtA.sub.sm) (71% sequence identity) is essential for MBT biosynthesis (Chavadi, S. S., et al. (2011) J. Bacterial. 193, 5905-5913). However, Msm also has a second siderophore system that accounts for 90-95% of siderophore activity in the bacterium (i.e. the EXO system) (Ratledge, C., et al. (1996) Microbiology 142, 2207-2212; Sharman, G. J., et al. (1995) Biochem. J. 305, 187-196). It was hypothesized that production of EXOs would render Msm resistant to salicyl-AMS compounds, thus impeding the use of Msm for evaluation of MbtA inhibitors. To explore this hypothesis, the susceptibility of mutant strains Msm WT, Msm E (EXO.sup.), and Msm M (MBT, FIG. 7) to salicyl-AMS compounds in Fe-limiting and Fe-rich growth media were investigated (Table 7). Next, the possibility of developing a Msm EXO.sup. strain that is dependent upon MbtA.sub.tb, the primary intended target of salicyl-AMS compounds was explored. Transformation of Msm EM double mutant with pMbtA.sub.tb to enable heterologous expression of mbtA.sub.tb was carried out. The complemented transformant (Msm EM-pMbtA.sub.tb) regained MBT production (FIG. 7) and had the same pattern of susceptibility to salicyl-AMS (1) seen for Msm E (Table 7). Moreover, compound 1 inhibited MBT production in Msm EM-pMbtA.sub.tb (FIG. 7), a result paralleling that seen with Mtb (Ferreras, J. A., et al. (2005) Nat. Chem. Biol. 1, 29-32). Taken together, these results established that Msm EM-pMbtA.sub.tb has high, MbtA.sub.tb-dependent salicyl-AMS susceptibility, and thus the strain represents a convenient model system to assess and compare the antimycobacterial properties of the MbtA.sub.tb inhibitors.

(535) TABLE-US-00017 TABLE 7 Susceptibility of M. smegmatis strains to salicyl-AMS MIC (g/ml).sup.b Msm strain GASTD GASTD + Fe (EXO/MET).sup.a medium medium Msm WT (+/+) >1000 >1000 Msm E (/+) 0.5-1.0 >1000 Msm M (+/) >1000 >1000 Msm EM (/) no growth >1000 Msm EM-pMbtA.sub.tb (/+) 0.5-1.0 >1000

Example 8. Growth Inhibition Assays for Msm Strains

(536) Dose-response experiments using microdilution assays in a 96-well plate platform were performed as reported (Ferreras, J. A., et al. (2011) Bioorg. Med. Chem. Lett. 21, 6533-6537; Stirrett, K. L., et al. (2008) Bioorg. Med Chem. Lett. 18, 2662-2668). Msm strains were grown in GASTD or GASTD+Fe media. Cultures (200 L/well) were started at OD.sub.600=0.0005 (910.sup.4 CFU/well) from culture stocks prepared in GASTD medium as reported (Ferreras, J. A., et al. (2005) Nat. Chem. Biol. 1, 29-32.). Growth was assessed as ODD after 4 days of incubation (37 C., 170 rpm) using the DTX 880 microplate reader. Unless otherwise indicated in specific experiments, compounds were typically evaluated using a 0.031-64 g/ml range (2-fold dilution series format). Inhibitors were added from 10% DMSO stock solutions, with a final DMSO concentration of 0.5% in both inhibitor-treated cultures and DMSO controls (no inhibitor). Minimum inhibitory concentration (MIC) values were calculated as the lowest concentration tested that inhibited growth by 95% relative to DMSO controls. Data presented are derived from three independent experiments. Results are shown in Table 8.

(537) The results demonstrated potent antimicrobial activity for the novel salicyl-6-MeO-AMSN (6). Notably, (6) did not reach MIC when tested at up 64 g/mL in Fe-rich medium (Table 8). This selectivity is consistent with their expected mechanism of action in inhibition of MBT siderophore biosynthesis, and revealed that the structural features of the analogues setting them apart from the lead compound 1 did not lead to unintended off-target effects of significance in Msm.

(538) TABLE-US-00018 TABLE 8 Antimicrobial activity of MbtA.sub.tb, inhibitors in M. smegmatis EM-pMbtA.sub.tb MIC (g/ml).sup.a GASTB medium GASTD + Fe Cmpd range mean medium 1 .sup.0.5-1.0.sup.b 0.83 8.17 >64 4a 1.0 1.00 0 >64 4b 0.5-1.0 0.83 0.17 >64 6 4.0-8.0 5.33 1.33* >64

Example 9. Post-Antibiotic Effect (PAE) Assays

(539) Cells from mid-log growth phase cultures of Msm EM-pMbtA.sub.tb in GASTD medium (37 C., 170 rpm, OD.sub.6000.75) were harvested by centrifugation and washed in GASTD medium (3 times with I culture volume). The washed cells were resuspended in GASTD medium and transferred to U-bottom 96-well cell culture plates (Corning, Inc.) for inhibitor exposure at a cell density corresponding to OD.sub.600=1.0 (50 L/well). Cells were exposed to 5, 50, and 100 average MIC value, in line with reported studies with other antimycobacterial compounds (Chan, C. Y., et al. (2004) Agents Chemother. 48, 340-343). Inhibitors were added from 10% DMSO stock solutions, with a final DMSO concentration of 1% in both inhibitor-exposed cultures and DMSO controls (no inhibitor). After the exposure period (1 h, 37 C., 170 rpm), the cultures were diluted in pre-warmed, inhibitor-free medium to OD.sub.600=0.001 (1,000-fold dilution, bringing inhibitor concentrations to 0.005, 0.05, and 0.1 average MIC values) and reseeded into flat-bottom, 96-well culture plates (Corning, Inc.) at 200 l/well. The 96-well plates were incubated for culture growth at 37 C. in a FLUOstar Optima microplate reader (BMG Labtech, Inc.), and OD.sub.600 readings were taken every 30 min following plate shaking (5 min, 200 rpm) for 5 days. The growth vs. time datasets were analyzed to determine the time at which cultures reached an exponential growth phase threshold of OD.sub.600=0.05 (5% of maximal growth) (FIG. 8). The time-to-threshold data were used to calculate PAE as the difference between the time-to-threshold values of the inhibitor-exposed culture and the control cultures (Stubbings, W. J., et al. (2004) J. Antimicrob. Chemother. 54, 139-143). Data presented are derived from three independent experiments. Pearson correlation analysis between PAE and t.sub.R datasets was carried out using Prism v6.01, and PCCs with p values 0.05 were considered statistically significant. Results appear in Table 9.

(540) Notably, despite the relevance of PAE information to the lead optimization and prioritization phases of antibiotic development (Craig, W. A. (2007) Antimicrobial pharmacodynamics in theory and clinical practice, 2.sup.nd ed., pp 1-22, Informa Healthcare USA, Inc., New York, NY; Tonge, P. J. (2018) ACS Chem. Neurosci. 9, 29-39; MacKenzie, F. M., et al. (1993) J Antimicrob Chemother 32, 519-537), seemingly PAE studies have not been undertaken previously for salicyl-AMS (1) or any of its analogues.

(541) Encouragingly, the assessment of the in vitro PAE using washout experiments revealed that all the inhibitors, including (6) had a substantial PAE (Table 9). A concentration-dependent PAE trend was found for the eight inhibitors tested at different concentrations, showing 0-14 h, 12-30 h, and 19-50 h ranges for the 5, 50, and 100 MIC exposures, respectively. These results provide the first demonstration of PAE for MbtA.sub.tb inhibitors. Moreover, they validate Msm EM-pMbtAtb as a convenient model system for analyses of inhibitors of MbtA.sub.tb.

(542) TABLE-US-00019 TABLE 9 Post-antibiotic effect of MbtA.sub.tb inhibitors in M. smegmatis AEKT-pMbtA.sub.tb PAE (hours).sup.c Cmpd. 5 MIC 50 MIC 100 MIC 1 9.4 1.6 14.2 0.9 34.5 1.8 4a 10.6 2.7 18.7 1.3 23.1 3.1* 4b 13.4 2.6 17.4 4.7 10.4 2.2** 6 1185.3 2.8* ND ND

Example 10. Growth Inhibition Assays for M. tuberculosis H37Rv

(543) Lab strain Mycobacterium tuberculosis H37Rv was grown to mid-log phase in 7H9. Cells were washed three times using GAST-D media, then re-suspended in an equal volume of GAST-D. OD.sub.600 was measured, and an aliquot was diluted to OD.sub.600=0.001. To set up the MIC assay plate, two-fold serial dilutions were made using a 96-well plate, ranging from 16 to 0.0313 g/mL, in both GAST-D and GAST-D plus 100 M of FeCl.sub.3 media. 100 l of diluted bacterial suspension was added to wells and plate was incubated for 7 days at 37 C. Alamar Blue reagent was added to all wells and incubated for 16 h. The plate was read at Ex544 nm/Em590 nm using a fluorescence plate reader and the lowest concentration that yielded at least 90% inhibition was defined as MIC. Results are presented below in Table 10.

(544) TABLE-US-00020 TABLE 10 MIC Values for M. tuberculosis H37Rv MIC (g/mL) GAST-D GAST-D + Fe Compound medium medium 1 0.125-0.25 0.5-1.0 6 0.125-0.25 0.5-1.0

Example 11. In Vivo Efficacy Evaluation in DBA/2 Mouse Model

(545) Compound (1) was previously tested in an in vivo efficacy model in BABL/c mice as described in Lun, S. et al. Antimicrob. Agents Chemother. 2013, 57(10), 5138-40. Comparative results are generated in six-week-old female DBA/2 mice. Mice are aerosol-infected with Mtb H37Rv using an inhalation system (Glas-Col Inc., Terre Haute, IN). At day 1 post-infection, five mice are sacrificed to determine the Day 1 implantation by enumerating colony-forming-units (CFUs) in the lungs. From day 1 after infection, groups of five mice are treated with IP injection of test compound at 100 mg/kg (in biological saline), daily and 5 days a week for 4 weeks. Other controls may include Sal-AMS plus 5% AMS and Salicyl-AMS at various dose levels. Ethambutol at 100 mg/kg is administered as positive control and infected but untreated mice are used as negative controls. At Day 28 after treatment initiation, 5 mice from each treatment group are sacrificed and the lungs removed. Lungs are photographed for gross pathology. The lungs are homogenized, diluted, and plated on 7H11 selective agar plates to enumerate CFUs. Efficacy is analyzed based on CFU reduction compared with untreated control.

EQUIVALENTS AND SCOPE

(546) In the claims articles such as a, an, and the may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include or between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.

(547) Furthermore, the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Where elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements and/or features, certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements and/or features. For purposes of simplicity, those embodiments have not been specifically set forth in haec verba herein. It is also noted that the terms comprising and containing are intended to be open and permits the inclusion of additional elements or steps. Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub-range within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.

(548) This application refers to various issued patents, published patent applications, journal articles, and other publications, all of which are incorporated herein by reference. If there is a conflict between any one of the incorporated references and the instant specification, the specification shall control. In addition, any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Because such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the invention can be excluded from any claim, for any reason, whether or not related to the existence of prior art.

(549) Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation many equivalents to the specific embodiments described herein. The scope of the present embodiments described herein is not intended to be limited to the above Description, but rather is as set forth in the appended claims. Those of ordinary skill in the art will appreciate that various changes and modifications to this description may be made without departing from the spirit or scope of the present invention, as defined in the following claims.