Enzyme nanoparticles with methane oxidation activity
12442022 ยท 2025-10-14
Assignee
Inventors
Cpc classification
C12N9/0071
CHEMISTRY; METALLURGY
C12N11/04
CHEMISTRY; METALLURGY
C12N9/96
CHEMISTRY; METALLURGY
International classification
C12N11/04
CHEMISTRY; METALLURGY
Abstract
The present invention relates to novel enzyme nanoparticles capable of converting methane into methanol, in which key active sites of methane-oxidizing bacteria are fused with each other and expressed on a protein that can be self-assembled in cells to form nanoparticles, and specifically to enzyme nanoparticles including a protein having methane monooxygenase (MMO) activity and active sites of the methane oxidase, a method for production thereof, a recombinant microorganism into which a nucleic acid encoding the protein and the active site of the methane oxidase is introduced, and immobilized enzyme nanoparticles including the enzyme nanoparticles loaded on a carrier.
Claims
1. An enzyme nanoparticle comprising: a first active domain of a methane monooxygenase (MMO) comprising the amino acid sequence of SEQ ID NO: 2 and a second active domain of the MMO comprising the amino acid sequence of SEQ ID NO: 3; and a human ferritin heavy-chain protein, wherein the first active domain and the second active domain are fused to a surface of the human ferritin heavy-chain protein, wherein the enzyme nanoparticle converts methane to methanol, and wherein the MMO and the human ferritin heavy-chain protein are linked by a peptide linker.
2. An enzyme nanoparticle comprising: a first active domain of a methane monooxygenase (MMO) comprising the amino acid sequence of SEQ ID NO: 4 and a second active domain of the MMO comprising the amino acid sequence of SEQ ID NO: 3; and a human ferritin heavy-chain protein, wherein the first active domain and the second active domain are fused to a surface of the human ferritin heavy-chain protein, wherein the enzyme nanoparticle converts methane to methanol, and wherein the MMO and the human ferritin heavy-chain protein are linked by a peptide linker.
3. An enzyme nanoparticle comprising: a first active domain of a methane monooxygenase (MMO) comprising the amino acid sequence of SEQ ID NO: 5 and a second active domain of the MMO comprising the amino acid sequence of SEQ ID NO: 3; and a human ferritin heavy-chain protein, wherein the first active domain and the second active domain are fused to a surface of the human ferritin heavy-chain protein, wherein the enzyme nanoparticle converts methane to methanol, and wherein the MMO and the human ferritin heavy-chain protein are linked by a peptide linker.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
MODE FOR CARRYING OUT INVENTION
(8) Unless otherwise defined, all technical and scientific terms used in this specification have the same meaning as commonly understood by an expert skilled in the art, to which the present invention pertains (those skilled in the art). In general, the nomenclature used in this specification is well known and commonly used in the art.
(9) The inventors of the present application have found a recombinant system that can synthesize enzyme nanoparticles, which include a first active site (pmoB1) or its variant of a methane oxidase as a heterologous enzyme and a second active site (pmoB2) of the methane oxidase, with high yield, while maintaining a structure having a catalytic function in E. coli, by using a protein adapted to be self-assembled in cells to form nanoparticles such as ferritin heavy chain protein (huHF).
(10) Specifically, under control of one promoter, a system including: a first vector that operatively links a nucleic acid encoding huHF and a nucleic acid encoding pmoB1 and pmoB2, which are active sites of pMMO, or operatively links the nucleic acid encoding huHF and a nucleic acid encoding pmoB1 or a variant thereof; and a second vector that operatively links the nucleic acid encoding huHF and a nucleic acid encoding pmoB2, was constructed. For example, referring to
(11) As a result of introducing these vectors into host cells and culturing the same, it was confirmed that the enzyme nanoparticles were successfully expressed. The enzyme nanoparticles are those in which pmoB1 and pmoB2 are fused with and expressed in a ferritin scaffold that formed heterodimeric nanoparticles through self-assembly in cells, and it was confirmed that enzyme nanoparticles are expressed with high efficiency and MMO activity is exhibited, thereby producing methanol by oxidizing methane through an enzymatic reaction.
(12) Therefore, in one aspect, the present invention relates to an enzyme nanoparticle having methane monooxygenase (MMO) activity, wherein a first active site and a second active site of the methane oxidase are fused with each other and expressed on the surface of a protein adapted to be self-assembled in cells to form nanoparticles.
(13) In another aspect, the present invention relates to a recombinant microorganism having enzyme nanoparticle generation ability, into which: i) a nucleic acid encoding a protein adapted to be self-assembled in cells to form nanoparticles: ii) a nucleic acid encoding a first active site of a methane oxidase; and iii) a nucleic acid encoding a second active site of the methane oxidase are introduced, wherein MMO activity is exhibited by fusion and expression of the first active site and the second active site on the surface of the protein nanoparticles.
(14) In another aspect, the present invention relates to a method for production of enzyme nanoparticles, which includes: generating nanoparticles having methane oxidase activity by culturing the recombinant microorganism, wherein a first active site and a second active site of the methane oxidase are fused with each other and expressed on the surface of a protein adapted to be sell-assembled in cells to form nanoparticles; and recovering the generated nanoparticles.
(15) In the present invention, the methane oxidase may be an active membrane enzyme that includes a periplasmic catalytic domain present in the membrane bilayer through trans-membrane a-helices, and it was confirmed that, when constructing a molecular environment similar to transmembrane o-helices present in natural membranes, the methane oxidase of the present invention could be rearranged into a desired structure while maintaining the catalytic activity thereof.
(16) In this respect, the protein may function as a support capable of providing the molecular environment similar to a trans membrane, and may be used without limitation as long as it can be self-assembled in cells to form nanoparticles. For example, ferritin, ferritin-like protein, magnetosome constituent protein, Escherichia coli DNA binding protein, human a-tocopherol transfer protein, human PERK chaperone, hepatitis B virus capsid protein, proteosome, or tobacco mosaic virus coat protein may be used.
(17) In particular, ferritin may be used as the protein, and in a specific embodiment according to the present invention, ferritin may be subjected to a self-assembly of 24 protein monomers having a molecular weight of 21 kDa to form spherical nanoparticles having a diameter of about 12 nm. Ferritin may have a molecular weight of about 500,000 Da, may consist of 24 identical protein subunits composed of heavy and light chains, and may form a hollow shell in vivo. The protein bound to iron may have iron storage and iron detoxification functions. The protein may function as a cytoprotective protein that maintains iron balance in cells for the growth and survival of most tissues and minimizes a formation of oxygen-free radicals due to the binding of iron in the cells.
(18) Full-length ferritin, ferritin heavy chain or ferritin light chain may be used to produce nanoparticles, but preferably ferritin heavy chain protein may be used. Specifically, it was confirmed that, when using the heavy chain protein of ferritin, it might function as a support (i.e., scaffold) capable of providing the molecular environment similar to that of a trans membrane, and may have self-assembly ability to form spherical particles. Enzyme nanoparticles (pMMO-mimics) were prepared using ferritin heavy chain protein (huHF) as an active site introduction agent of methane oxidase, wherein the huHF may be expected to have optimum efficacy when a heterogeneous material is fused due to site-specific expression.
(19) The enzyme nanoparticles having methane oxidation activity according to the present invention was prepared by introducing an active site of a methane oxidase at a specific position (C-terminal) on the surface of ferritin protein nanoparticles. The C-terminal portion of ferritin forms a 4-fold axis (a structure where four axes are gathered), while the introduction of a foreign protein such as pmoB1 or pmoB2 to the above portion has an advantage of enabling the surface of the introduction agent to be expressed.
(20) The nanoparticles (pMMO-mimics) of the present invention are recombinant protein nanoparticles formed by self-assembly and exhibit a uniform distribution of active sites of the methane oxidase. Nanoparticles (pMMO-mimics) according to the present invention may have a diameter of about 20 to 26 nm.
(21) A new form of enzyme nanoparticles having methane oxidation activity may be produced by the recombinant microorganism according to the present invention, wherein key active sites of microfine methane oxidase existing on a cellular membrane of methane-oxidizing bacteria are genetically expressed on the surface of human ferritin heavy chains which are nanoparticles composed of protein. The nanoparticles according to the present invention demonstrate activity of actually converting methane gas into methanol through the injection of methane gas.
(22) The methane oxidase needs to identify the smallest structural unit for activation. At this time, it should be necessary to include the minimum methane oxidase unit while providing a desirable binding site using a catalytically inactivated and structurally stable scaffold, while the active methane oxidase unit needs to be structurally maintained in the re-constructed form in order to keep catalytic activity.
(23) Methane monooxygenase (MMO) has an 333 quaternary structure, wherein three subunits are named pmoB, pmoA and pmoC, respectively. Two water-soluble periplasmic domains of pmoB (pmoB1 and pmoB2) are connected by two transmembrane a helices (TH1 and TH2). There is a controversy about the active site of pMMO, but now the peripheral cytoplasmic domain of pmoB is generally known as the active site.
(24) In this aspect, the first active site and the second active site of the methane oxidase may be selected from the group consisting of pmoB1 or a variant thereof and pmoB2 or a variant thereof, and the first active site and the second active site may be different from each other.
(25) Specifically, the first active site of the methane oxidase may be pmoB1 or a variant thereof, and the second active site may be pmoB2 or a variant thereof. In the present invention, the pmoB1 and pmoB2 were used as active sites for production of the enzyme nanoparticles. The first active site of the methane oxidase may include the sequence of SEQ ID NO: 2, while the second active site of the methane oxidase may include the sequence of SEQ ID NO: 3. The pmoB1 and pmoB2 were recombined on the scaffold replacing the transmembrane TH1 and TH2 of pmoB.
(26) However, pmoA and/or pmoC, which are subunits other than pmoB of methane oxidase, may be included as an active site, and in some cases, pmoB1 or a variant thereof. Further, the second active site may use pmoA and/or pmoC replacing the pmoB2 or a variant thereof.
(27) The variant may include one or more selected from the group consisting of H33N, E135Q, H137A, H139A, H48N, and H72N. According to a specific embodiment of the present invention, as the variant of pmoB1, a variant of site-A mutant m3 pmoB1 (H33N, H137A, and H139A) or a variant of site-B mutant m3 pmoB1 (H48N, and H72N) may be included. The variant of pmoB1 may include the sequence of SEQ ID NO: 4 or SEQ ID NO: 5.
(28) As a scaffold, apo-type ferritin protein that does not contain iron while having a nano-scale in the form of a spherical cage composed of 24 identical units may be used. Each ferritin subunit contains four anti-parallel alpha helix huHFA to huHFD and a c-terminal alpha helix, that is, huHFE, wherein the huHFE may be used as a conjugation site for pmoB1 and pmoB2.
(29) In order to fuse and express the first active site and the second active site on the surface of the protein nanoparticle, a vector to which: i) the nucleic acid encoding the protein adapted to be self-assembled in cells to form nanoparticles; ii) the nucleic acid encoding the first active site of the methane oxidase; and iii) the nucleic acid encoding the second active site of the methane oxidase are operatively linked may be introduced. Specifically, a nucleic acid encoding a ferritin heavy chain protein, a nucleic acid encoding pmoB1 or a variant thereof, and a nucleic acid encoding pmoB2 or a variant thereof are operatively linked to one vector, whereby ferritin nanoparticles with pmoB1 and pmoB genetically expressed on the surface thereof may be produced.
(30) Further, (a) a first vector to which i) the nucleic acid encoding the protein adapted to be self-assembled in cells to form nanoparticles, and ii) the nucleic acid encoding the first active site of the methane oxidase are operatively linked; and (b) a second vector to which ii) the nucleic acid encoding the protein adapted to be self-assembled in cells to form nanoparticles, and iii) the nucleic acid encoding the second active site of the methane oxidase are operatively linked may be introduced.
(31) Specifically, a first vector to which: a nucleic acid encoding a ferritin heavy chain protein; a nucleic acid encoding pmoB1 or a variant thereof; and a nucleic acid encoding pmoB2 or a variant thereof are operatively linked, or to which a nucleic acid encoding a ferritin heavy chain protein and a nucleic acid encoding pmoB1 or a variant thereof are operatively linked; as well as a second vector to which a nucleic acid encoding a ferritin heavy-chain protein and a nucleic acid encoding pmoB2 or a variant thereof are operatively linked may be introduced, whereby ferritin nanoparticles with pmoB1 and pmoB2 genetically expressed on the surface thereof may be produced.
(32) In one embodiment, the recombinant microorganism may further include a nucleic acid encoding a peptide linker between i) the nucleic acid encoding the protein adapted to be self-assembled in cells to form nanoparticles and ii) the nucleic acid encoding the first active site of the methane oxidase, or between ii) the nucleic acid encoding the first active site of the methane oxidase and iii) the nucleic acid encoding the second active site of the methane oxidase.
(33) According to a specific embodiment of the present invention, a nucleic acid sequence having the sequence of SEQ ID NO: 6 or a peptide sequence having the sequence of SEQ ID NO: 7 may be included as a linker. When expressed in the presence of one promoter, the peptide sequence having the sequence of SEQ ID NO: 7 is included as a linker between the nucleic acid encoding a ferritin heavy-chain protein and the nucleic acid encoding pmoB1 or a variant thereof. Further, the nucleic acid sequence having the sequence of SEQ ID NO: 6 may be included as a linker between the nucleic acid encoding pmoB1 and the nucleic acid encoding pmoB2. Further, when using two vectors, a the nucleic acid sequence having the sequence of SEQ ID NO: 6 may be included between the nucleic acid encoding a ferritin heavy chain protein and the nucleic acid encoding pmoB1 or a variant thereof.
(34) The term operatively linked refers to a functional linkage between a regulatory sequence associated with nucleic acid expression (e.g., a promoter, a signal sequence, or a transcriptional regulatory factor, etc.) and another nucleic acid, whereby the regulatory sequence may regulate transcription and/or translation of the another nucleic acid.
(35) Suitable molecules (e.g., transcriptional activating proteins) may be nucleic acids and regulatory sequence(s) that are bound to the regulatory sequence(s) in a manner of enabling nucleic acid expression. For example, a nucleic acid for a pre-sequence or secretion leader is operatively linked to a nucleic acid for a polypeptide when expressed as a pre-protein that participates in secretion of the polypeptide: a promoter or enhancer is operatively linked to a coding sequence if it affects sequence transcription; a ribosome binding site is operatively linked to a coding sequence if it affects the sequence transcription; or the ribosome binding site is operatively linked to the coding sequence if arranged to facilitate translation.
(36) In general, the term operatively linked means that the linked nucleic acid sequence is in contact, and specifically, is in contact and is present inside a reading frame in the case of a secretion leader. However, the enhancer does not need to contact. Connection between these sequences is performed by ligation (linkage) at convenient restriction enzyme sites. If such a site does not exist, a synthetic oligonucleotide adapter or linker according to the conventional method is used. In the present invention, it means that the nucleic acid sequence is operatively linked, such that the first active site and the second active site of the methane oxidase can be fused with each other and expressed on the surface of the protein nanoparticle.
(37) Specifically, the ferritin protein nanoparticles in which the active sites (pmoB1, and pmoB2) of the methane oxidase according to the present invention are fused may be produced by a manufacturing method which includes: a) obtaining a gene clone derived from a nucleic acid encoding a ferritin protein; b) obtaining a gene clone derived from a nucleic acid encoding active sites (pmoB1, and pmoB2) of the methane oxidase to be expressed on the surface of the ferritin protein; c) preparing an expression vector through ligation of the prepared gene clones; and d) expressing recombinant enzyme nanoparticles (pMMO-mimics) by transforming the expression vector into a host.
(38) Vectors used for over-expression of nucleic acids may be any expression vector known in the art. The term vector is used to refer to DNA fragment(s), nucleic acid molecules, etc., which are delivered into cells. The vectors replicate DNA and may be reproduced independently in host cells. The term carrier is often used interchangeably with the vector. The term expression vector refers to a recombinant DNA molecule including a coding sequence of interest and an appropriate nucleic acid sequence essential for expressing the coding sequence operatively linked in a specific host organism.
(39) The expression vector may be used in the form compatible with the host cell, and may include, for example, BLUESCRIPT vector (Stratagene), T7 expression vector (Invitrogen), pET vector (Novagen), etc., but it is not limited thereto.
(40) The expression vector preferably includes one or more selectable markers. The marker is typically a nucleic acid sequence having a characteristic that the marker can be selected by a chemical method, and any nucleic acid capable of distinguishing a transformed cell from a non-transgenic cell may be applicable. For example, antibiotic-tolerant nucleic acids such as kanamycin, G418, bleomycin, hygromycin, chloramphenicol, etc. may be included, but it is not limited thereto.
(41) The vector may include a promoter. The term promoter means a region of DNA upstream from a structural nucleic acid and refers to a DNA molecule to which an RNA polymerase is bound to initiate transcription. The promoter according to the present invention is a promoter capable of initiating transcription in a host, for example, E. coli, and may include lac, trp, tac, PL, T7, etc. for protein expression in the host, but it is not limited thereto.
(42) The nucleic acid may be linked to a tag for isolation and/or purification or a nucleic acid sequence encoding the tag. As an example, the tag may be appropriately selected from the group consisting of small peptide tags such as His tag, Flag tag, S tag, etc., glutathione S-transferase (GST) tag, maltose binding protein (MBP) tag, or the like, but it is not limited thereto.
(43) Since an expression amount and modification of protein differ depending on the host cell of the recombinant microorganism, the most suitable host cell for the purpose may be selected and used. The host cell may include prokaryotic host cells such as E. coli (Escherichia coli) Bacillus subtilis, Streptomyces, Pseudomonas, Proteus mirabilis or Staphylococcus, but it is not limited thereto. Further, lower eukaryotic cells such as lungi (e.g., Aspergillus), yeast (e.g., Pichia pastoris), Saccharomyces cerevisiae, Schizosaccharomyces, Neurospora crassa, etc., insect cells, plant cells, cells derived from higher eukaryotes mammals, or the like may be used as host cells.
(44) In the present invention, as an introduction method into the host cells, a commonly known genetic manipulation method may be used. Further, non-viral delivery methods may include cell puncturing, lipofection, microinjection, a ballistic method, virosome, liposome, immunoliposome, multivalent cation or lipids: nucleic acid conjugates, naked DNA, artificial virons and chemical-promoting DNA influx or the like. Sonoporation, for example, a method with Sonitron 2000 system (Rich-Mar) may also be used for delivery of nucleic acids, and other representative nucleic acid delivery systems may include methods with use of Amaxa Biosystems (Cologne, Germany), Maxcyte, Inc. (Rockville, Maryland) and BTX Molecular Delivery System (Holliston, MA).
(45) According to the present invention, the active sites (pmoB1, and pmoB2) of methane oxidase are introduced in series or parallel to ferritin c-terminal so that the active sites on the surface of ferritin particles may be genetically re-assembled. This enabled mass production of the enzyme nanoparticles having activity by E. coli.
(46) Meanwhile, the inventors of the present application have constructed a new reaction system by immobilizing the enzyme nanoparticles on a three-dimensional porous hydrogel, and have demonstrated that the activity of the enzyme nanoparticles due to water content of the hydrogel is maintained for a long period of time to allow the enzyme nanoparticles to be repeatedly used. In a specific example according to the present invention, a new enzymatic reaction system has been developed, in which enzyme nanoparticles are immobilized and evenly distributed inside porous hydrogel. It could be seen that the hydrogel-based reaction system may not only include a large amount of enzyme nanoparticles in a certain volume of space, but also reuse the activity of the nanoparticles stably and repeatedly for a long period of time due to excellent water retention ability of the hydrogel.
(47) Accordingly, in another aspect, the present invention relates to immobilized enzyme nanoparticles including the enzyme nanoparticles loaded on a carrier, and specifically, to immobilized enzyme nanoparticles in which the enzyme nanoparticles are encapsulated in a polymer and uniformly distributed therein.
(48) Further, the present invention relates to a method for production of immobilized enzyme nanoparticles, which includes: reacting enzyme nanoparticles with a polymer, wherein the enzyme nanoparticles are loaded on a carrier, for example, encapsulated in the polymer so as to be uniformly distributed therein.
(49) The carrier may include chitosan, gelatin, collagen, poly-L-lysine, poly-L-histidine, poly-L-arginine, hyaluronic acid, polygamma-glutamic acid, alginate, carboxymethyl cellulose, glycogen, amylose, dextran, poly acrylic acid, polyacrylamide, polymethacrylic acid, polyhydroxyethyl methacrylate fluran, beta glucan, starch, hydroxyethyl cellulose, carboxymethyl cellulose, polyvinylpyrrolidone, polyvinylpyrrolidone copolymer, polyethyleneglycol, polyvinylalcohol, polyvinylalkylether, polydimethylaminoethyl methacrylate, poly N,N-ethylaminoethyl methacrylate, polylactic acid, glycolic acid, polylactic glycolic acid or polycaprolactone, but it is not limited thereto.
(50) The carrier loaded with the enzyme nanoparticles may react the enzyme nanoparticles with the carrier by any conventional method, thereby preparing the carrier encapsulated and loaded with the enzyme nanoparticles.
(51) For example, a solution containing enzyme nanoparticles may be added to a polymer free of moisture to swell the same so as to load the enzyme nanoparticles on the polymer; enzyme nanoparticles may be added to a polymer solution and mixed, followed by further reacting the mixture with a crosslinking agent so as to load the enzyme nanoparticles on the polymer; otherwise, a functional group may be introduced into a terminal of the enzyme nanoparticle, followed by polymerization of the enzyme nanoparticles, into which the functional groups are introduced, with polymer monomers, thereby loading the enzyme nanoparticles on the polymer, but it is not limited thereto.
(52) The crosslinking agent is not particularly limited to triphosphate as long as it is a material capable of binding enzyme nanoparticles among polymers, and may include, for example, sodium, sodium citrate, sodium oxalate, sodium pyrophosphate, sodium sulfate, sodium tartrate, sodium malate, sodium malonate, sodium methylene diphosphate, potassium citrate, potassium oxalate, potassium pyrophosphate, potassium sulfate, potassium tartrate, potassium malate, potassium malonate, epichlorohydrin, epibromohydrin, or criethylenetetraamine, but it is not limited thereto.
(53) In one embodiment according to the present invention, a polymer-based hydrogel, in which the enzyme nanoparticles were immobilized and uniformly distributed, may be prepared. Specifically, a functional group, for example, a vinyl group, an acrylic group or an acrylic group unsubstituted or substituted with alkyl having 1 to 30 carbon atoms, for example, 1 to 6 carbon atoms, was introduced into the terminal of the enzyme nanoparticle, thereby allowing the terminal of the enzyme nanoparticle to be substituted with the above functional group.
(54) The enzyme nanoparticles to which the functional groups are bound may be subjected to polymerization with polymer monomers, for example, polymeric monomers such as acrylic acid, acrylamide, hydroxyethyl methacrylate, ethylene glycol, N,N-ethylaminoethyl methacrylate, hyaluronic acid or chitosan. For example, an amine group expressed on the surface of the enzyme nanoparticles may react with N-succinimidylacrylate (NSA) to prepare enzyme nanoparticles having vinyl groups enabling polymerization.
(55) Meanwhile, the inventors of the present application have confirmed that, as a result of reaction of methane gas through the enzyme nanoparticles, methanol, which is an oxidation product of methane, was generated by an enzymatic reaction, followed by measuring a production amount and determining a cumulative production amount and a turnover number as shown in
(56) Accordingly, the present invention relates to a method for converting methane to methanol using the enzyme nanoparticles, the recombinant microorganism, or the immobilized enzyme nanoparticles.
EXAMPLE
(57) Hereinafter, the present invention will be described in more detail by means of examples. These examples are for illustrative purposes only, and it will be apparent to those skilled in the art that the scope of the present invention is not construed as being limited by these examples.
[Example 1] Preparation of Expression Vector for Biosynthesis of pMMO-Mimics Enzyme Nanoparticles
(58) PmoB12, ferritin-pmoB1, pMMO-mimics (pMMO-m1 to pMMO-m4), site-A mutant of pMMO-m3, site-B mutant of pMMO-m3, pmoB-free huHF particles with His6 and pmoB-free huHF particles without His6 were prepared according to the vector schematic diagram described in Table 1 below. All plasmid expression vectors prepared as described above were purified in agarose gel, followed by confirming a sequence through complete DNA sequencing.
(59) The resulting PCR products were sequentially inserted into vectors for expression of pT7-7 and pET28a (Novagen, U.S.A.) to construct expression vectors capable of expressing protein nanoparticles, respectively.
(60) Vectors for expression of different protein nanoparticles have proceeded with pT7-pmoB12, pT7-huHF-pmoB1, p17-pMMO-m1, pET28a-pMMO-m2-B1, pT7-pMMO-m2-B2, pET28a-pMMO-m3-B1, pT7-pMMO-m3-B2, pET28a-Mut-A-m3-B1, pT7-Mut-A-m3-B2, pET28a-Mul-B-m3-B1, pT7-Mut-B-m3-B2, pET28apMMO-m4-B1(R), pT7-pMMO-m4-B2, pT7-huFH and pT7-D4K-huHF, respectively (
(61) TABLE-US-00001 TABLE 1 Recombinant protein Expression vector pmoB12 NH.sub.2-Ndel-H.sub.6-pmoB1(H33-172)-S.sub.2(GKLGGG)-pmoB2(Q265-M414)- HindIII-COOH ferritin-pmoB1 NH.sub.2-Ndel-H.sub.6-huHF-BamHI-pmoB1-HindIII-COOH pMMO-m1 NH.sub.2-Ndel-H.sub.6-huHF-BamHI-pmoB1-S.sub.2-pmoB2-HindIII-COOH pMMO-m2 1. NH.sub.2-Ndel-huHF-BamHI-pmoB1-HindIII-COOH 2. NH.sub.3-Ndel-H.sub.6-huHF-BamHI-pmoB2-HindIII-COOH pMMO-m3 1. NH.sub.2-Ndel-huHF-S.sub.1(G3SG3TG3SG3)-BamHI-pmoB1-HindIII-COOH 2. NH.sub.2-Ndel-H.sub.6-huHF-BamHI-pmoB2-HindIII-COOH site-A mutant of 1. NH.sub.2-Ndel-huHF-S.sub.2-BamHI-pmoB1(H33N, H137A, H139A)-HindIII- pMMO-m3 COOH 2. NH.sub.3-Ndel-H.sub.6-huHF-BamHI-pmoB2-HindIII-COOH site-B mutant of 1. NH.sub.2-Ndel-huHF-S.sub.2-BamHI-pmoB1(H48N, H72N)-HindIII-COOH pMMO-m3 2. NH.sub.2-Ndel-H.sub.6-huHF-BamHI-pmoB2-HindIII-COOH pMMO-m4 1. NH.sub.2-Ndel-huHF-BamHI-pmoB1(R)-HindIII-COOH 2. NH.sub.2-Ndel-H.sub.6-huHF-BamHI-pmoB2-HindIII-COOH pmoB-free NH.sub.2-Ndel-H.sub.6-huHF-HindIII-COOH huHF particles with His.sub.6 pmoB-free NH.sub.2-Ndel-H.sub.6-D4K-HuHF-HindIII-COOH huHF particles without His.sub.6
(62) TABLE-US-00002 Name Sequence No. ferritin TSQVRQNYHQDEAAINRQINLELYASYVYLSMSYYFDRDDVALKNF 1 AKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIQKPDCDDWESGLN AMECALHLEKNVNQSLLELHKLATDKNDPHLCDPIETHYLNEQVKAI KELGDHVTNLRKMGAPESGLAEYLFDKHTLG pmoB1 HGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPE 2 (33-172) TVDEPDVAFLNVGMPGPVFIRKESYIGGQLLVPRSVRLEIGKIYDFRVV LKARRPGDWHVHTMMNVQGGPIIGPGKWITVEGSMSEFRNPVTT pmoB2 QAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNS 3 (265-414) PIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGET RTVDVTASDAAWEVYRLSDIYDPDSRFAGLLFFFDATGNRQVVQIDA PLIPSFM pmoB1 NQEKSQAAFMRMRIIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPE 4 (H33N,H137A, TVDEPDVAFLNVGMPGPVPIRKESYIGGQLVPRSVRLEIGKIYDFRVV H139A) KLARRPGDWAVATMMNVQGGGPIIGPGKWTTVEGSMSEFRNPVTT pmoB1 HGEKSQAAFMRMRTINWYDLSWSKEKVKINETVEIKGKFNVFEGWPE 5 (H48N,H72N) TVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTTDFRVV LKARRPGDWHVHTMMNVQGGGPIIGPGKWTTVEGSMSEFRNPVTT
[Example 2] Biosynthesis (Except for pmoB12) and Purification of Recombinant Protein Including pMMO-Mimmics
(63) E. coli strain BL21 (DE3) [F.sup.omp ThsdS.sub.B (rB.sup.mB.sup.)] was transformed using the prepared expression vectors, respectively. In particular, pMMO-m2, pMMO-m3, site-A mutant of pMMO-m3, site-B mutant of pMMO-m3, pMMO-m4 allowed two expression vectors to be simultaneously transformed on E. coli strain BL21, and a transformant resistant to ampicillin and kanamycin was selected. Transformed E. coli were cultured in a flask including 50 mL of Luria-Bertani (LB) medium (containing 100 mgL.sup.1 ampicillin, 100 mgL.sup.1 kanamycin and 0.2 mM CuSO.sub.4) (250 mL Erlenmeyer flasks, 37 C., 150 rpm). Other protein nanoparticles (ferritin-pmoB1, pMMO-m1, pmoB-free huHF particles with Hiss and pmoB-free huHF particles without Hiss) except for the above were selected for ampicillin-resistant transformants. The transformed E. coli were cultured in a flask (250 mL Erlenmeyer flasks, 37 C., 150 rpm) including 50 mL of Luria-Bertani (LB) medium (containing 100 mg L.sup.1 ampicillin and 0.2 mM CuSO.sub.4) (
(64) 1) Ni.sup.2+-NTA Affinity Chromatography
(65) In order to purify the recombinant protein, E. coli cultured in the same manner as specified above were recovered and cell pellets thereof were resuspended in 5 mL crushing solution (50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 10 mM imidazole, 0.2 mM CuSO.sub.4, pH 8.0), and the cells were crushed using an ultrasonic crusher. The crushed cell fluid was centrifuged at 13,000 rpm for 10 minutes to separate only the supernatant, and then the recombinant protein was separated using a Ni.sup.2+-NTA column (Quiagen, Hilden, Germany). (Wash buffer: 50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 10 mM imidazole, pH 8.0/Elution buffer: 50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 250 mM imidazole, pH 8.0).
(66) 2) Concentration and Buffer Exchange
(67) 2 mL of recombinant protein eluted through Ni.sup.2+-NTA affinity chromatography was put in an ultra-centrifugal filter (Amicon Ultra 100K, Millipore, Billerica, MA) and centrifuged at 5,000 rpm until 1 ml of solution remained on the column. Thereafter, buffer exchange was performed with Tris buffer (20 mM Tris-HCl, 250 mM NaCl, pH 8.0).
[Example 3] Biosynthesis, Purification and Refolding of Recombinant Protein pmoB12
(68) E. coli strain BL21 (DE3) [F.sup.omp ThsdS.sub.B (rB.sup.mB.sup.)] was transformed using the prepared expression vectors, respectively, and transformants resistant to ampicillin were selected. The transformed E. coli were cultured in a flask (250 mL Erlenmeyer flasks, 37 C., 150 rpm) containing 50 mL of Luria-Bertani (LB) medium (containing 100 mg L.sup.1 ampicillin). When the medium turbidity (OD.sub.600) reached about 0.6, isopropyl--D-thiogalactopyranosid (IPTG) (1 mM) was added to induce gene expression. After incubation at 37 C. for 6 hours, the cultured E. coli were centrifuged at 5,000 rpm for 5 minutes to recover cell precipitate, and then suspended in 5 mL of crushing solution (50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 10 mM imidazole. 0.2 mM CuSO.sub.4, pH 8.0) and crushed using an ultrasonic crusher (Branson Ultrasonics Corp., Danbury, CT, U.S.A). After crushing, centrifugation was performed at 13,000 rpm for 10 minutes, and the supernatant and insoluble aggregates were separated. The separated insoluble aggregate was first subjected to Ni.sup.2+-NTA affinity chromatography using binding of nickel and histidine fused with each other and expressed on a recombinant protein, and then the recombinant protein was refolded through dialysis. The refolded recombinant protein was concentrated thus to produce a purified recombinant protein. Each stage will be described in detail below.
(69) 1) Ni.sup.2+-NTA Affinity Chromatography
(70) In order to purify the recombinant protein pmoB12, E. coli cultured in the same manner as specified above were recovered and cell pellets thereof were re-suspended in 5 mL crushing solution (50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 10 mM imidazole, 0.2 mM CuSO.sub.4, pH 8.0), and the cells were crushed using an ultrasonic crusher. The crushed cell fluid was centrifuged at 13.000 rpm for 10 minutes to separate only insoluble aggregate, and then re-suspended in 5 mL modified solution (50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 6 M Gdn-HCl, pH 8.0) for 1 hour, followed by performing centrifugation at 13,000 rpm for 20 minutes to separate the supernatant only. Thereafter, the recombinant protein pmoB12 was separated using a Ni.sup.2+-NTA column (Quiagen, Hilden, Germany). (Wash buffer: 50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 6 M Gdn-HCl, pH 6.3/Elution buffer A: 50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 6 M Gdn-HCl, pH 5.9/Elution buffer B: 50 mM NaH.sub.2PO.sub.4, 300 mM NaCl, 6 M Gdn-HCl, pH 4.5).
(71) 2) Refolding of pmoB12 Through Dialysis Process
(72) In order to slowly remove Gdn-HCl, which induces protein denaturation, in 4 mL of the recombinant protein solution eluted through Ni.sup.2+-NTA affinity chromatography, pmoB12 was refolded by applying a stepwise dialysis procedure. That is, the recombinant protein was subjected to a dialysis process in a buffer solution (20 mM Tris-HCl, 250 mM NaCl, 1 mM CuSO.sub.4, 6 M Gon-HCl, pH 8.0) at 4 C. for 3 hours. A concentration of Gdn-HCl was reduced stepwise by 1M for total 6 times, and in the final step, the dialysis process was repeated three times using a buffer solution without Gdn-HCl (20 mM Tris-HCl, 250 mM NaCl, 1 mM CuSO.sub.4, pH 8.0), thereby completely removing Gan-HCl. Finally, the refolded pmoB12 was recovered alter completely removing the protein aggregates by centrifugation (13,000 rpm, 20 minutes, 4 C.).
(73) 3) Concentration
(74) The refolded pmoB12 obtained through the dialysis process was placed in an ultra-centrifugal filter (Amicon Ultra 100K, Millipore, Billerica, MA) and centrifuged at 5,000 rpm until 1 ml of solution remained on the column.
[Example 4] Analysis of Expression Rate of Recombinant Protein Including the Prepared nMMO-Mimics and Cytoplasm Solubility
(75) After performing the above process, an expression rate and cytosolic solubility of the purified recombinant protein nanoparticles were analyzed by SDS-PAGE. Crushed cell pellet solution (lysate) of the recombinant protein including pMMO-mimics, the supernatant (soluble fraction, sol) obtained by centrifugation of the crushed cell fluid, insoluble aggregates (insoluble fraction, insol), and purified or refolded recombinant protein were subjected to SDS-PAGE using 12% Tris-glycine precast gel (Invitrogen, California, U.S.A). Then, a gel was stained with Comasi Blue staining solution, and the stained protein band was analyzed for expression rate and cytosolic solubility of each recombinant protein through a densitometer (GS-800 Calibrated Densitometer, Bio-Rad, California, U.S.A.) (
[Example 5] Analysis of Structure of Recombinant Protein Including the Prepared pMMO-Mimics
(76) After performing the above process, transmission electron microscopy (TEM) was taken for structural analysis of the purified recombinant protein nanoparticles. To obtain stained images of protein nanoparticles, electron microscopy grids including naturally dried samples were incubated with 2% (w/v) aqueous uranyl acetate solution at room temperature for 1 hour. As a result of observing the protein nanoparticle image using a Tecnai 20 (FEI, Hillsboro, Oregon, U.S.A.) electron microscope operating at 200 kV, it was confirmed that spherical nanoparticles were formed. In addition, through dynamic light scattering (DLS) analysis, it was confirmed that spherical nanoparticles having a size of 26.33.1 nm, 20.83.3 nm. 23.93.3 nm, 21.93.3 nm, and 12.82.1 nm were formed by pMMO-m1, pMMO-m2, pMMO-m3, pMMO-m4, and pmoB-free huHF particle with His6, respectively. Further, through analysis of size-exclusion chromatography (SEC) equipped with HiLoad 16/600 Superdex 200 pg column (GE Healthcare, Illinois, U.S.A), it was confirmed that the nanoparticles formed by the pMMO-m3 had a size larger than huFH particles having a diameter of about 12 nm but smaller than HBVC particles having a diameter of 32 nm. To analyze a secondary structure and a melting point of the pMMO-m3, circular dichroism (CD) spectrometer (Jasco, Tokyo, Japan) was used. CD spectrum was measured at 200 to 250 nm (1 nm bandwidth, 100 nm/min scan rate), and the secondary structure of the pMMO-m3 was analyzed on the basis of the CD spectrum measured at 20 C. The melting point (Tm) of the pMMO-m3 was calculated through CD spectra measured at different temperatures (30, 40, 50, 60, 70, 80, and 90 C.) (
[Example 6] Proof of Methane Gas Oxidation Activity of Recombinant Protein Including the Prepared pMMO-Mimics
(77) To verify the methane gas oxidation activity of the purified recombinant protein nanoparticles, 1 mL of a recombinant protein solution containing duroquinol (0.35 mM) as a reducing agent was injected into 20 mL of septa-sealed vial (catalogue No. 5182-0837, Agilent). All of the injected pmoB12 (4.8 UM), ferritin-pmoB1 (0.2 M), pMMO-m1 (0.2 M), pMMO-m2 (0.4 M), pMMO-m3 (0.4 M), site-A mutant of pMMO-m3 (0.4 M), site-B mutant of pMMO-m3 (0.4 M) and pMMO-m4 (0.4 M) include the same number of moles of catalytically active sites (pmoB1, and pmoB2). A methane oxidation reaction through the recombinant protein was initiated by removing 19 mL of air in a headspace through a syringe and injecting 15 mL of methane gas and 4 mL of air. Thereafter, the vial was immediately subjected to an enzymatic reaction in an incubator at 45 C. for up to 20 hours. Further, an amount of methanol as an oxidation product produced by the enzymatic reaction, was measured through gas chromatography (7890B GC, Agilent) to measure a cumulative production amount and a turnover number (
[Example 7] Confirmation of Catalyst Function
(78) In E. coli culture supplemented with a copper salt (CuSO.sub.4, 0.0 to 0.3 mM) and/or iron salt (FeSO.sub.4, 0.2 mM), pMMO-m3 showing optimal methane oxidation activity confirmed through Example 6 was synthesized. An amount of methanol produced by pMMO-m3 synthesized in specific culture condition, as well as copper and iron contents in pMMO-m3, were measured. Measurement of the copper and iron contents was performed through ICP-MS (
(79) As a result, the copper content in pMMO-m3 and the cumulative methanol production amount by the pMMO-m3 reached the maximum level in 0.2 mM CuSO.sub.4, while the amount of copper added to pMMO-m3 could affect catalytic domains of pMMO-m3 (pmoB1 and pmoB2) (
[Example 8] Proof of Repetitive Methane Gas Oxidation Activity by a Reaction System Based on a Polyacrylamide Hydrogel Including the Prepared pMMO-Mimics
(80) pMMO-m3, which exhibits the optimal methane oxidation activity confirmed through Example 6, was immobilized on a three-dimensional porous hydrogel to establish a new reaction system. Further, whether the activity of the enzyme nanoparticles due to moisture contained in the hydrogel is maintained for a long period of time and whether the above activity may be repeatedly used were proved by the following experiments.
(81) 1) Synthesis of Hydrogel Containing Immobilized pMMO-m3
(82) 10 mg of pMMO-m3 was first reacted with N-succinimidyl acrylate (NSA, 0.01 mg) dissolved in Tris buffer (20 mM Tris-HCl, 250 mM NaCl, pH 8.0) at 37 C. for 1 hour to obtain vinylated pMMO-m3. NSA remaining without participation in the reaction was removed through an ultra-centrifugal filter system (Amicon Ultra 100K, Millipore, Billerica, MA). Next. 709 L of vinylated pMMO-m3 (1.69 M) was mixed with 150 L of 30% acrylamide (29:1 w/w acrylamide:bis-acrylamide, BioRad, U.S.A), 130 l of 1 M Tris-HCl (pH 6.5), 10 l of 10% (w/v) ammonium persulfate (APS) and 1 l of 0.8 M tetramethylethylenediamine (TEMED), and the mixture was divided by 25 l followed by putting each of the divided mixtures in a transparent 384-well plate. Then, the mixture was allowed to stand at 25 C. for 16 hours so as to be copolymerized. As a result, an acrylamide-based hydrogel containing immobilized pMMO-m3 was produced. The hydrogel to which pMMO-m3 is immobilized was subjected to Pt coating and, through FE-SEM (quanta 250 FEG, FEI, Oregon, U.S.A), the porous structure and distribution of pMMO-m3 in the hydrogel were confirmed. The distribution of pMMO-m3 in the hydrogel was analyzed through FE-SEM by treating the hydrogel with a gold nanoparticle-labeled histidine antibody (anti-H6 antibody, Santa Cruz, Texas, U.S.A) for 2 hours, increasing a size of gold nanoparticles using a silver enhancement kit (Sigma Aldrich), followed by Pt coating.
(83) 2) Proof of Repetitive Methane Oxidation Activity by Application of Hydrogel Containing Immobilized pMMO-m3
(84) To verify methane oxidation activity of the hydrogel containing immobilized pMMO-m3 formed by the above process, duroquinol was used as a reducing agent. 2 mL of Tris buffer (20 mM Tris-HCl, 250 mM NaCl, pH 8.0), in which 20 hydrogels containing immobilized pMMO-m3 (total 610.sup.4 moles of pMMO-m3) are included, as well as duroquinol (0.35 mM) were injected into 20 mL of septa-sealed vial (catalogue No. 5182-0837, Agilent). A methane oxidation reaction was initiated by removing. 18 mL of air in the headspace through a syringe, and injecting 14.5 mL of methane gas and 4.5 mL of air. Thereafter, the vial was immediately subjected to an enzymatic reaction in an incubator at 45 C. for 20 hours. Then, an amount of methanol, which is an oxidation product obtained by the enzymatic reaction, was measured through gas chromatography (7890B GC, Agilent) to determine a cumulative production amount. In order to verify the repetitive methane oxidation reaction, a lid of the vial was opened while removing a shade thereof after 20 hours of reaction, followed by collecting 20 hydrogels containing immobilized pMMO-m3 and washing the same in Tris buffer three times. The washed hydrogels containing immobilized pMMO-m3 were put into a 20 mL septa-sealed vial and subjected to methane oxidation in the same manner. As a result, it was confirmed that about 6 times of repeated use is possible for about 120 hours (
INDUSTRIAL APPLICABILITY
(85) According to the present invention, the active sites (pmoB1, and pmoB2) of methane oxidase derived from methane-oxidizing bacteria are fused with each other and expressed so as to be expressed on the surface of a protein that can be self-assembled in cells to form nanoparticles, whereby the active sites of methane oxidase retain activity even on the surface of the protein nanoparticles and allow methane to be oxidized to methanol.
(86) As described above, a specific portion of the content of the present invention has been described in detail. For those skilled in the art, this specific technology is only a preferred embodiment, and it will be obvious that the scope of the present invention is not limited thereby. Accordingly, it will be understood that the substantial scope of the present invention is defined by the appended claims and equivalents thereof.
(87) Sequence Free Text
(88) Electronic file attached.