Adeno-associated virus vectors encoding modified G6PC and uses thereof

12440580 ยท 2025-10-14

Assignee

Inventors

Cpc classification

International classification

Abstract

Modified G6PC (glucose-6-phosphatase, catalytic subunit) nucleic acids and glucose-6-phosphatase- (G6Pase-) enzymes with increased phosphohydrolase activity are described. Also described are vectors, such as adeno-associated virus (AAV) vectors, and recombinant AAV expressing modified G6Pase-. The disclosed AAV vectors and rAAV can be used for gene therapy applications in the treatment of glycogen storage disease, particularly glycogen storage disease type Ia (GSD-Ia), and complications thereof.

Claims

1. A method of promoting glucose homeostasis in a subject diagnosed with glycogen storage disease type Ia (GSD-Ia), comprising: selecting a subject with GSD-Ia; and intravenously administering to the subject a therapeutically effective amount of a recombinant AAV (rAAV) comprising a nucleic acid molecule encoding a modified glucose-6-phosphatase- (G6Pase-) operably linked to a promoter, wherein the modified G6Pase- comprises a serine to cysteine substitution at amino acid 298 of human G6Pase- set forth as SEQ ID NO: 2.

2. The method of claim 1, wherein the amino acid sequence of the modified G6Pase- comprises or consists of SEQ ID NO: 8.

3. The method of claim 1, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 6 or SEQ ID NO: 7.

4. The method of claim 1, wherein the rAAV is rAAV8.

5. The method of claim 1, wherein the promoter comprises a G6PC promoter.

6. The method of claim 5, wherein the G6PC promoter comprises nucleotides 182-3045 of SEQ ID NO: 4 or nucleotides 182-3045 of SEQ ID NO: 5.

7. The method of claim 1, wherein the nucleic acid molecule comprises nucleotides 182-4441 of SEQ ID NO: 4 or nucleotides 182-4441 of SEQ ID NO: 5.

8. The method of claim 1, wherein the nucleic acid molecule comprises nucleotides 17-4819 of SEQ ID NO: 4 or nucleotides 17-4819 of SEQ ID NO: 5.

9. The method of claim 1, wherein the rAAV is administered at a dose of about 110.sup.10 to about 110.sup.14 viral particles (vp)/kg.

10. The method of claim 1, wherein administering the rAAV comprises administration of a single dose of rAAV.

11. The method of claim 1, wherein administering the rAAV comprises administration of multiple doses of rAAV.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 is an alignment of the canine (SEQ ID NO: 1) and human (SEQ ID NO: 2) G6Pase- protein sequences. The 18 amino acid residues that differ between the canine and human sequences are indicated by arrows.

(2) FIG. 2 depicts human G6Pase-, which is anchored into the endoplasmic reticulum membrane by 9 helices, H1 to H9 (Pan et al J Biol Chem 273:6144-6148, 1998). The amino acid differences between human and canine G6Pase- are listed.

(3) FIG. 3 is a graph showing hepatic microsomal G6Pase- activity in 4-week-old GSD-Ia (G6pc.sup./) mice transduced at age 2 weeks with a recombinant AAV8-GPE vector (10.sup.13 vg/kg) expressing human G6PC (AAV-G6PC), codon-optimized (co) human G6PC (AAV-co-G6PC), human G6PC-S298C mutant (AAV-G6PC-S298C), or co-human G6PC-S298C mutant (AAV-co-G6PC-S298C). Hepatic microsomal G6Pase- activity in 4-week-old wild type mice averaged 227.517.6 nmol/min/mg. Data are presented as the meanSEM. **P<0.005.

(4) FIG. 4 shows the nucleotide sequence of the G6PC cDNA (SEQ ID NO: 11), with the location of each of the 18 human G6PC mutants indicated. For site-directed mutagenesis, 20-nucleotide sense and antisense primers were designed such that the codon to be mutated was located in the middle of each primer.

(5) FIG. 5 is a graph showing hepatic G6Pase- activity in 24-day-old G6pc.sup./ mice transduced at age 10 days with 510.sup.11 vg/kg AAV-co-G6PC vector (n=3) or rAAV8-co-G6PC-S298C vector (n=3). Wild-type hepatic G6Pase activity averaged 17418.3 nmol/min/mg. Data represent the meanSEM. **P<0.005.

(6) FIGS. 6A-6E show data demonstrating correction of hepatic G6Pase- deficiency by rAAV-G6PC. L-G6pc.sup./ mice were treated 110.sup.12 vg/kg of rAAV-G6PC at age 10 weeks and analyzed at age 18 weeks. FIG. 6A is a graph showing hepatic G6Pase- activity in control (n=7), L-G6pc.sup./ (n=7) and AAV mice (n=8). FIG. 6B shows images of representative H&E-stained livers of control, L-G6pc.sup./ and AAV mice. FIG. 6C is a graph showing fasting glucose tolerance (FGT) of control (n=13), L-G6pc.sup./ (n=6) and AAV mice (n=8). FIG. 6D is a graph showing liver weights of control, L-G6pc.sup./ and AAV mice (n=8). FIG. 6E is a graph showing hepatic contents of glycogen and triglyceride of control, L-G6pc.sup./ and AAV mice (n=8). Data represent the meanSEM. *P<0.05, **P<0.005.

SEQUENCE LISTING

(7) The nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and single letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. In the accompanying Sequence Listing: SEQ ID NO: 1 is the amino acid sequence of canine G6Pase- protein. SEQ ID NO: 2 is the amino acid sequence of human G6Pase- protein. SEQ ID NO: 3 is the nucleotide sequence of pTR-GPE-human G6PC having the following features: ITRnucleotides 17-163 G6PC promoter/enhancernucleotides 182-3045 Stuffernucleotides 3051-3184 Intronnucleotides 3185-3321 Stuffernucleotides 3322-3367 G6PC coding sequencenucleotides 3368-4441 ITR nucleotides 4674-4819. SEQ ID NO: 4 is the nucleotide sequence of pTR-GPE-human G6PC-S298C having the following features: ITR nucleotides 17-163 G6PC promoter/enhancernucleotides 182-3045 Stuffernucleotides 3051-3184 Intronnucleotides 3185-3321 Stuffernucleotides 3322-3367 G6PC coding sequencenucleotides 3368-4441 S298C mutationnucleotides 4259-4261 (TCT to TGC) ITR nucleotides 4674-4819. SEQ ID NO: 5 is the nucleotide sequence of pTR-GPE-codon optimized (co) G6PC-S298C having the following features: ITR nucleotides 17-163 G6PC promoter/enhancernucleotides 182-3045 Stuffernucleotides 3051-3184 Intronnucleotides 3185-3321 Stuffernucleotides 3322-3367 Codon-optimized G6PC coding sequencenucleotides 3368-4441 S298C mutationnucleotides 4259-4261 (AGC to TGC) ITR nucleotides 4674-4819. SEQ ID NO: 6 is the nucleotide sequence of a modified human G6PC encoding S298C G6Pase-. SEQ ID NO: 7 is the nucleotide sequence of a codon-optimized, modified human G6PC encoding S298C G6Pase-. SEQ ID NO: 8 is the amino acid sequence of modified human S298C G6Pase-. SEQ ID NO: 9 is the amino acid sequence of modified human S298C/A301V G6Pase-. SEQ ID NO: 10 is an amino acid consensus sequence based on alignment of human and canine G6Pase-. SEQ ID NO: 11 is the nucleotide sequence of the human G6PC coding region.

DETAILED DESCRIPTION

I. Abbreviations

(8) AAV adeno-associated virus CBA chicken -actin CMV cytomegalovirus co codon optimized FGT fasting glucose tolerance G6P glucose-6-phosphate G6Pase- glucose-6-phosphatase- G6PC glucose-6-phosphatase, catalytic subunit G6PT glucose-6-phosphate transporter GPE G6PC promoter/enhancer GSD glycogen storage disease HCA hepatocellular adenoma HCC hepatocellular carcinoma ITR inverted terminal repeat ORF open reading frame rAAV recombinant AAV SEM standard error of the mean vg viral genomes vp viral particles WT wild type

II. Terms and Methods

(9) Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes V, published by Oxford University Press, 1994 (ISBN 0-19-854287-9); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8).

(10) In order to facilitate review of the various embodiments of the disclosure, the following explanations of specific terms are provided:

(11) Adeno-associated virus (AAV): A small, replication-defective, non-enveloped virus that infects humans and some other primate species. AAV is not known to cause disease and elicits a very mild immune response. Gene therapy vectors that utilize AAV can infect both dividing and quiescent cells and can persist in an extrachromosomal state without integrating into the genome of the host cell. These features make AAV an attractive viral vector for gene therapy. There are currently 11 recognized serotypes of AAV (AAV1-11).

(12) Administration/Administer: To provide or give a subject an agent, such as a therapeutic agent (e.g. a recombinant AAV), by any effective route. Exemplary routes of administration include, but are not limited to, injection (such as subcutaneous, intramuscular, intradermal, intraperitoneal, and intravenous), oral, intraductal, sublingual, rectal, transdermal, intranasal, vaginal and inhalation routes.

(13) Codon-optimized: A codon-optimized nucleic acid refers to a nucleic acid sequence that has been altered such that the codons are optimal for expression in a particular system (such as a particular species or group of species). For example, a nucleic acid sequence can be optimized for expression in mammalian cells or in a particular mammalian species (such as human cells). Codon optimization does not alter the amino acid sequence of the encoded protein.

(14) Enhancer: A nucleic acid sequence that increases the rate of transcription by increasing the activity of a promoter.

(15) G6PC: A gene located on human chromosome 17q21 that encodes glucose phosphatase- (G6Pase-). G6Pase- is a 357 amino acid hydrophobic protein having 9 helices that anchor it in the endoplasmic reticulum (Chou et al., Nat Rev Endocrinol 6:676-688, 2010). G6Pase- is depicted in FIG. 2. The G6Pase- protein catalyzes the hydrolysis of glucose 6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis and is a key enzyme in glucose homeostasis. Deleterious mutations in the G6PC gene cause glycogen storage disease type Ia (GSD-Ia), which is a metabolic disorder characterized by severe fasting hypoglycemia associated with the accumulation of glycogen and fat in the liver and kidneys.

(16) Glycogen storage disease (GSD): A group of diseases that result from defects in the processing of glycogen synthesis or breakdown within muscles, liver and other tissues. GSD can either be genetic or acquired. Genetic GSD is caused by any inborn error of metabolism involved in these processes. There are currently 11 recognized glycogen storage diseases (GSD type I, II, III, IV, V, VI, VII, IX, XI, XII and XIII) GSD-I consists of two autosomal recessive disorders, GSD-Ia and GSD-Ib (Chou et al., Nat Rev Endocrinol 6:676-688, 2010). GSD-Ia results from a deficiency in glucose-6-phosphatase-. Deficiencies in the glucose-6-phosphate transporter (G6PT) are responsible for GSD-Ib.

(17) Glycogen storage disease type Ia (GSD-Ia): Also known as von Gierke disease, GSD-Ia is the most common glycogen storage disease, having an incidence of about 1 in 100,000 live births. GSD-Ia is a genetic disease resulting from deficiency of the enzyme glucose-6-phosphatase- (G6Pase-). Deficiency in G6Pase- impairs the ability of the liver to produce free glucose from glycogen and from gluconeogenesis. Patients affected by GSD-Ia are unable to maintain glucose homeostasis and present with fasting hypoglycemia, growth retardation, hepatomegaly, nephromegaly, hyperlipidemia, hyperuricemia, and lactic academia (Chou et al., Nat Rev Endocrinol 6:676-688, 2010). There is currently no cure for GSD-Ia.

(18) Intron: A stretch of DNA within a gene that does not contain coding information for a protein. Introns are removed before translation of a messenger RNA.

(19) Inverted terminal repeat (ITR): Symmetrical nucleic acid sequences in the genome of adeno-associated viruses required for efficient replication. ITR sequences are located at each end of the AAV DNA genome. The ITRs serve as the origins of replication for viral DNA synthesis and are essential cis components for generating AAV integrating vectors.

(20) Isolated: An isolated biological component (such as a nucleic acid molecule, protein, virus or cell) has been substantially separated or purified away from other biological components in the cell or tissue of the organism, or the organism itself, in which the component naturally occurs, such as other chromosomal and extra-chromosomal DNA and RNA, proteins and cells. Nucleic acid molecules and proteins that have been isolated include those purified by standard purification methods. The term also embraces nucleic acid molecules and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acid molecules and proteins.

(21) Modified: In the context of the present disclosure, a modified G6PC or G6Pase- refers to a G6PC nucleic acid sequence or a G6Pase- amino acid sequence that comprises at least one nucleic acid or amino acid substitution, deletion or insertion compared to the wild type sequence (such as compared to the human G6PC coding sequence set forth as nucleotides 3368-4441 of SEQ ID NO: 3, or relative to the human G6Pase- amino acid sequence set forth as SEQ ID NO: 2).

(22) Operably linked: A first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.

(23) Pharmaceutically acceptable carrier: The pharmaceutically acceptable carriers (vehicles) useful in this disclosure are conventional. Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co., Easton, PA., 15th Edition (1975), describes compositions and formulations suitable for pharmaceutical delivery of one or more therapeutic compounds, molecules or agents.

(24) In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (for example, powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically-neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.

(25) Preventing, treating or ameliorating a disease: Preventing a disease (such as GSD-Ia) refers to inhibiting the full development of a disease. Treating refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop. Ameliorating refers to the reduction in the number or severity of signs or symptoms of a disease.

(26) Promoter: A region of DNA that directs/initiates transcription of a nucleic acid (e.g. a gene). A promoter includes necessary nucleic acid sequences near the start site of transcription. Typically, promoters are located near the genes they transcribe. A promoter also optionally includes distal enhancer or repressor elements which can be located as much as several thousand base pairs from the start site of transcription.

(27) Purified: The term purified does not require absolute purity; rather, it is intended as a relative term. Thus, for example, a purified peptide, protein, virus, or other active compound is one that is isolated in whole or in part from naturally associated proteins and other contaminants. In certain embodiments, the term substantially purified refers to a peptide, protein, virus or other active compound that has been isolated from a cell, cell culture medium, or other crude preparation and subjected to fractionation to remove various components of the initial preparation, such as proteins, cellular debris, and other components.

(28) Recombinant: A recombinant nucleic acid molecule is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination can be accomplished by chemical synthesis or by the artificial manipulation of isolated segments of nucleic acid molecules, such as by genetic engineering techniques.

(29) Similarly, a recombinant virus is a virus comprising sequence (such as genomic sequence) that is non-naturally occurring or made by artificial combination of at least two sequences of different origin. The term recombinant also includes nucleic acids, proteins and viruses that have been altered solely by addition, substitution, or deletion of a portion of a natural nucleic acid molecule, protein or virus. As used herein, recombinant AAV refers to an AAV particle in which a recombinant nucleic acid molecule (such as a recombinant nucleic acid molecule encoding G6Pase-) has been packaged.

(30) Sequence identity: The identity or similarity between two or more nucleic acid sequences, or two or more amino acid sequences, is expressed in terms of the identity or similarity between the sequences. Sequence identity can be measured in terms of percentage identity; the higher the percentage, the more identical the sequences are. Sequence similarity can be measured in terms of percentage similarity (which takes into account conservative amino acid substitutions); the higher the percentage, the more similar the sequences are. Homologs or orthologs of nucleic acid or amino acid sequences possess a relatively high degree of sequence identity/similarity when aligned using standard methods. This homology is more significant when the orthologous proteins or cDNAs are derived from species which are more closely related (such as human and mouse sequences), compared to species more distantly related (such as human and C. elegans sequences).

(31) Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith & Waterman, Adv. Appl. Math. 2:482, 1981; Needleman & Wunsch, J. Mol. Biol. 48:443, 1970; Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444, 1988; Higgins & Sharp, Gene, 73:237-44, 1988; Higgins & Sharp, CABIOS 5:151-3, 1989; Corpet et al., Nuc. Acids Res. 16:10881-90, 1988; Huang et al. Computer Appls. in the Biosciences 8, 155-65, 1992; and Pearson et al., Meth. Mol. Bio. 24:307-31, 1994. Altschul et al., J. Mol. Biol. 215:403-10, 1990, presents a detailed consideration of sequence alignment methods and homology calculations.

(32) The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403-10, 1990) is available from several sources, including the National Center for Biological Information (NCBI) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. Additional information can be found at the NCBI web site.

(33) Serotype: A group of closely related microorganisms (such as viruses) distinguished by a characteristic set of antigens.

(34) Stuffer sequence: Refers to a sequence of nucleotides contained within a larger nucleic acid molecule (such as a vector) that is typically used to create desired spacing between two nucleic acid features (such as between a promoter and a coding sequence), or to extend a nucleic acid molecule so that it is of a desired length. Stuffer sequences do not contain protein coding information and can be of unknown/synthetic origin and/or unrelated to other nucleic acid sequences within a larger nucleic acid molecule.

(35) Subject: Living multi-cellular vertebrate organisms, a category that includes human and non-human mammals.

(36) Synthetic: Produced by artificial means in a laboratory, for example a synthetic nucleic acid can be chemically synthesized in a laboratory.

(37) Therapeutically effective amount: A quantity of a specified pharmaceutical or therapeutic agent (e.g. a recombinant AAV) sufficient to achieve a desired effect in a subject, or in a cell, being treated with the agent. The effective amount of the agent will be dependent on several factors, including, but not limited to the subject or cells being treated, and the manner of administration of the therapeutic composition.

(38) Vector: A vector is a nucleic acid molecule allowing insertion of foreign nucleic acid without disrupting the ability of the vector to replicate and/or integrate in a host cell. A vector can include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. A vector can also include one or more selectable marker genes and other genetic elements. An expression vector is a vector that contains the necessary regulatory sequences to allow transcription and translation of inserted gene or genes. In some embodiments herein, the vector is an AAV vector.

(39) Unless otherwise explained, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. The singular terms a, an, and the include plural referents unless context clearly indicates otherwise. Comprising A or B means including A, or B, or A and B. It is further to be understood that all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for description. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including explanations of terms, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.

III. Introduction

(40) Glycogen storage disease type Ia (GSD-Ia) is an inherited disorder of metabolism associated with life-threatening hypoglycemia, hepatic malignancy, and renal failure caused by the deficiency of glucose-6-phosphatase- (G6Pase- or G6PC), and primarily affecting the liver and kidney. Current therapy fails to prevent long-term complications in many patients, including growth failure, gout, pulmonary hypertension, renal dysfunction with risk for renal failure, osteoporosis, and hepatocellular adenomas (HCA) that can undergo malignant transformation to hepatocellular carcinoma (Chou et al., Curr Mol Med 2:121-143, 2002; Chou et al., Nat Rev Endocrinol 6:676-688, 2010). Therefore, the development of new therapies, such as gene therapies, is justified as a potentially curative treatment for GSD-Ia (Chou et al., Expert Opin Biol Ther 11:1011-1024, 2011).

(41) Recombinant AAV (rAAV) vectors encoding functional G6Pase- have been described (reviewed in Chou and Mansfield, Expert Opin Biol Ther 11:1011-1024, 2011). Previous studies using the mouse model of GSD-Ia have shown that recombinant AAV expressing G6Pase- directed by the CBA promoter/CMV enhancer (Ghosh et al., Gene Ther 13:321-329, 2006), the canine G6PC promoter (Koeberl et al., Gene Ther 13:1281-1289, 2006), or the human G6PC promoter at nucleotides 298 to +128 of the G6PC 5 flanking region (Koeberl et al., Mol Ther 16:665-672, 2008) deliver the G6Pase- transgene to the liver and achieve extended correction of this disorder. However, while these studies have shown promise, none have been capable of completely correcting hepatic G6Pase- deficiency.

(42) An example of one prior study is described by Koeberl et al. (Mol Ther 16:665-672, 2008) who developed a double-stranded, rAAV vector (rAAV-G6Pase) that was capable of treating GSD-Ia mice and GSD-Ia dogs. In addition, Yiu et al. (Mol Ther 18:1076-1084, 2010) and Lee et al. (Hepatology 56:1719-1729, 2012) describe the development of a similarly efficacious, single-stranded rAAV vector, rAAV-GPE-G6PC. The two vectors differ in several respects. First, rAAV-GPE-G6PC is a single-stranded rAAV vector while rAAV-G6Pase is a double-stranded rAAV vector. The double-stranded rAAV vector was developed to circumvent the rate-limiting step in the life cycle of AAV by converting single-stranded DNA genome into double-stranded DNA genome (Chou et al., Expert Opin Biol Ther 11:1011-1024, 2011). Second, the expression of G6Pase- in rAAV-G6Pase is directed by the human G6PC minimal promoter/enhancer at nucleotides 382 to 1 (Koeberl et al., Mol Ther 16:665-672, 2008). The expression of G6Pase- in rAAV-GPE-G6PC is directed by the human G6PC promoter/enhancer at nucleotides 2864 to 1 (GPE) (Yiu et al., Mol Ther 18:1076-1084, 2010; Lee et al., Hepatology 56:1719-1729, 2012). Third, the rAAV-GPE-G6PC vector contains an intron that is absent from the rAAV-G6Pase vector. Both vectors efficiently delivered the G6Pase- transgene to the liver and corrected murine GSD-Ia (Koeberl et al., Mol Ther 16:665-672, 2008; Yiu et al., Mol Ther 18:1076-1084, 2010; Lee et al., Hepatology 56:1719-1729, 2012).

(43) A comparative study was performed to determine which vector, rAAV-G6Pase or rAAV-GPE-G6PC, was more efficacious in treating GSD-Ia. The results showed unequivocally that the rAAV-GPE-G6PC vector was more efficient than the rAAV-G6Pase vector in correcting murine GSD-Ia. It was determined that the enhancer elements upstream of the G6PC minimal promoter were required for efficient hepatic transgene expression (Lee et al., Mol Genet Metab 10:275-280, 2013). Additional studies were carried out to determine whether the intron contained within the rAAV-GPE-G6PC vector played a role in directing hepatic G6Pase- expression. A double-stranded rAAV vector (referred to as rAAV-miGPE-G6PC) expressing human G6Pase- directed by the human G6PC minimal promoter at nucleotides 382 to 1, and containing the intron present in the rAAV-GPE-G6PC vector, was generated. The results showed that the rAAV-GPE-G6PC vector was more efficient than the rAAV-miGPE-G6PC vector in treating murine GSD-Ia, supporting the conclusion that the enhancer elements upstream the G6PC minimal promoter are required for efficient hepatic transgene expression (Lee et al., Mol Genet Metab 10:275-280, 2013).

(44) Recombinant AAV vectors comprising a G6PC promoter/enhancer (GPE) element are further described in PCT Publication No. WO 2015/081101, which is herein incorporated by reference. The recombinant vectors include a GPE, a synthetic intron, and the G6PC coding region. The G6PC coding region is optionally codon-optimized for expression in human cells. The recombinant vectors further include stuffer nucleic acid sequence situated between the G6PC promoter/enhancer and the intron, as well as between the intron and the G6PC coding sequence; and 5 and 3 inverted terminal repeat (ITR) sequences.

(45) It is disclosed in PCT Publication No. WO 2015/081101 that a G6Pase- expressing recombinant AAV with the G6PC promoter/enhancer (rAAV-GPE-G6PC) is significantly more efficient in directing in vivo hepatic transgene expression than another G6Pase- expressing recombinant AAV having an alternative promoter/enhancer (i.e. the chicken -actin promoter/CMV enhancer). Over a 24-week study period, G6PC-deficient mice (a model for GSD-Ia) treated with rAAV-GPE-G6PC exhibited complete normalization of hepatic G6PC deficiency as evidenced by normal levels of blood glucose, blood metabolites, hepatic glycogen and hepatic fat (see also Yiu et al., Mol Ther 18:1076-1084, 2010). Furthermore, a longer-term study of rAAV-GPE-G6PC-treated G6pc.sup./ mice demonstrated that gene therapy mediated by rAAV-GPE-G6PC was efficacious for at least 70-90 weeks in mice expressing more than 3% hepatic G6Pase-. In particular, rAAV-GPE-G6PC-treated mice exhibited normal hepatic fat storage, normal blood metabolite and glucose tolerance profiles, reduced fasting blood insulin levels, and had no evidence of hepatic abnormalities, such as hepatocellular adenoma (see also Lee et al., Hepatology 56:1719-1729, 2012).

(46) Further disclosed in PCT Publication No. WO 2015/081101 was the finding that the upstream enhancer elements of the G6PC promoter are critical for optimal G6PC expression in an animal model of GSD-Ia. Specifically, it was demonstrated that treatment with rAAV-GPE-G6PC, which comprises the G6PC promoter/enhancer at nucleotides 2684 to 1 (relative to the G6PC start site) produces significantly higher levels of hepatic G6Pase- expression, achieved greater reduction in hepatic glycogen accumulation, and led to a better toleration of fasting in a mouse model of GSD-Ia, compared to a G6Pase- expressing recombinant AAV containing only a 383 bp minimal G6PC promoter/enhancer (see also Lee et al., Mol Genet Metab. 110(3):275-280, 2013).

(47) Also disclosed in PCT Publication No. WO 2015/081101 was the finding that stuffer nucleotide sequences present between the G6PC promoter/enhancer and the intron, as well as between the intron and the G6PC coding sequence, are important for liver transduction and expression of G6Pase-. In particular, recombinant AAV produced from plasmid UF11-K29-G6PC, which lacks the stuffer sequences, exhibited G6Pase activity of 7.3 nmol/min/mg. In comparison, recombinant AAV produced from plasmid UF11-GPE-G6PC, exhibited G6Pase activity of 33.0 nmol/min/mg.

(48) In addition, data disclosed in PCT Publication No. WO 2015/081101 demonstrated that codon-optimization of the G6PC coding sequence increased efficiency of translation approximately 1.5- to 2.5-fold, resulting in significantly greater G6Pase- expression in the liver following administration of rAAV-co-GPE-G6PC (containing a codon-optimized G6PC nucleic acid sequence), compared with administration of rAAV-GPE-G6PC, which encodes wild-type G6PC.

(49) Thus, recombinant AAV comprising the G6PC promoter/enhancer at nucleotides 2684 to 1, a synthetic intron, stuffer sequences flanking the intron, and the G6PC coding region (wild-type or codon-optimized) are important features for efficient hepatic transgene expression and treatment of GSD-Ia in vivo.

(50) The present disclosure shows for the first time that the human G6PC can be modified at specific positions to enhance phosphohydrolase activity of the encoded G6Pase- enzyme. The modified G6Pase- coding sequences can be incorporated into rAAV gene therapy vectors to enhance efficacy in the treatment of glycogen storage disease.

IV. Overview of Several Embodiments

(51) It is disclosed herein that the canine G6Pase- enzyme is more active than the human G6Pase- enzyme. An amino acid alignment of the two proteins revealed that they differ in sequence at 18 residues. To identify human G6Pase- mutants with increased phosphohydrolase activity, mutants were generated that contain at least one corresponding amino acid from canine G6Pase-.

(52) Provided herein are recombinant nucleic acid molecules, AAV vectors and recombinant AAV that can be used in gene therapy applications for the treatment of glycogen storage disease, specifically GSD-Ia.

(53) In some embodiments, provided is an isolated nucleic acid molecule encoding a modified G6Pase-, wherein the modified G6Pase- comprises a serine to cysteine substitution at amino acid 298 of human G6Pase- (the amino acid sequence of wild type human G6Pase- is set forth herein as SEQ ID NO: 2). The modified G6Pase- can include modifications at additional residues so long as the protein retains enzymatic activity. For example, the modified G6Pase- can include substitutions at other residues that differ between the canine and human G6Pase- sequences, such residues include positions 3, 54, 139, 196, 199, 242, 247, 292, 301, 318, 324, 332, 347, 349, 350 and/or 353 of the human G6Pase- (set forth as SEQ ID NO: 2). FIG. 1 shows an alignment of the human and canine G6Pase- protein sequences, and Table 2 provides a summary of the amino acid differences between human and canine G6Pase-. The present disclosure contemplates nucleotide substitutions that alter the amino acid sequence at one or more of the residues listed above and in Table 2.

(54) In some examples, the nucleic acid molecule encodes a modified G6Pase- having an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 2, and having a serine to cysteine substitution at amino acid 298. In particular examples, the amino acid sequence of the modified G6Pase- comprises or consists of SEQ ID NO: 8 (human S298C G6Pase-). In other particular examples, the amino acid sequence of the modified G6Pase- comprises or consists of SEQ ID NO: 9 (human S298C/A301V G6Pase-). In non-limiting examples, the isolated nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 6 (modified human G6PC encoding S298C G6Pase-) or SEQ ID NO: 7 (codon-optimized, modified human G6PC encoding S298C G6Pase-).

(55) Also provided herein are vectors comprising the isolated nucleic acid molecules encoding modified G6Pase-. In some embodiments, the nucleic acid molecule encoding the modified G6Pase- is operably linked to a promoter, such as a G6PC promoter. In some examples, the G6PC promoter is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to nucleotides 182-3045 of SEQ ID NO: 4 (human G6PC promoter/enhancer) or at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to 182-3045 of SEQ ID NO: 5 (human codon-optimized G6PC promoter/enhancer). In non-limiting examples, the G6PC promoter comprises nucleotides 182-3045 of SEQ ID NO: 4 or nucleotides 182-3045 of SEQ ID NO: 5.

(56) In some examples, the vector comprises a nucleotide sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to nucleotides 182-4441 of SEQ ID NO: 4 or nucleotides 182-4441 of SEQ ID NO: 5. In specific non-limiting examples, the vector comprises nucleotides 182-4441 of SEQ ID NO: 4 or nucleotides 182-4441 of SEQ ID NO: 5.

(57) In some embodiments, the vector is an AAV vector. The AAV serotype can be any suitable serotype for delivery of transgenes to a subject. In some examples, the AAV vector is a serotype 8 AAV (AAV8). In other examples the AAV vector is a serotype 1, 2, 3, 4, 5, 6, 7, 9, 10, 11 or 12 vector (i.e. AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV9, AAV10, AAV11 or AAV12). In yet other examples, the AAV vector is a hybrid of two or more AAV serotypes (such as, but not limited to AAV2/1, AAV2/7, AAV2/8 or AAV2/9). The selection of AAV serotype will depend in part on the cell type(s) that are targeted for gene therapy. For treatment of GSD-Ia, the liver and kidney are the relevant target organs.

(58) When an AAV vector is used, the vector can include inverted terminal repeats (ITRs). In some embodiments, the AAV vector comprises a nucleotide sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to nucleotides 17-4819 of SEQ ID NO: 4 or nucleotides 17-4819 of SEQ ID NO: 5. In some examples, the AAV vector comprises nucleotides 17-4819 of SEQ ID NO: 4 or nucleotides 17-4819 of SEQ ID NO: 5.

(59) Also provided herein are isolated host cells comprising the nucleic acid molecules or vectors disclosed herein. For example, the isolated host cell can be a cell (or cell line) appropriate for production of recombinant AAV (rAAV). In some examples, the host cell is a mammalian cell, such as a HEK-293, BHK, Vero, RD, HT-1080, A549, Cos-7, ARPE-19, or MRC-5 cell.

(60) Further provided are rAAV comprising a nucleic acid molecule disclosed herein. In some embodiments, the rAAV is rAAV8 and/or rAAV2. However, the AAV serotype can be any other suitable AAV serotype, such as AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV9, AAV10, AAV11 or AAV12, or a hybrid of two or more AAV serotypes (such as, but not limited to AAV2/1, AAV2/7, AAV2/8 or AAV2/9). Compositions comprising a rAAV disclosed herein and a pharmaceutically acceptable carrier are also provided by the present disclosure. In some embodiments, the compositions are formulated for intravenous or intramuscular administration. Suitable pharmaceutical formulations for administration of rAAV can be found, for example, in U.S. Patent Application Publication No. 2012/0219528 (herein incorporated by reference).

(61) Further provided are methods of treating a subject diagnosed with a glycogen storage disease, comprising selecting a subject with GSD-Ia and administering to the subject a therapeutically effective amount of a rAAV (or a composition comprising a rAAV) disclosed herein.

(62) Methods of promoting glucose homeostasis; inhibiting hypoglycemia; inhibiting or preventing the development of hepatocellular adenoma (HCA); inhibiting or preventing the development of hepatocellular carcinoma (HCC); inhibiting or preventing renal dysfunction or failure; inhibiting or preventing growth retardation; inhibiting or preventing hepatomegaly; inhibiting or preventing nephromegaly; inhibiting or preventing hyperlipidemia; inhibiting or preventing pulmonary hypertension; or treating, preventing or inhibiting any other complication associated with GSD-Ia, in a subject with a deficiency in glucose-6-phosphatase- (G6Pase-) are also provided by the present disclosure. In some embodiments, the methods include administering to the subject a therapeutically effective amount of a rAAV (or a composition comprising a rAAV) disclosed herein. In some embodiments, the subject with a deficiency in G6Pase- is a subject that has GSD-Ia. Thus, in some examples, the method includes selecting a subject with GSD-Ia.

(63) In some embodiments of the methods disclosed herein, the rAAV is administered intravenously.

(64) In some embodiments, the rAAV is administered at a dose of about 110.sup.10 to about 110.sup.14 viral particles (vp)/kg. In some examples, the rAAV is administered at a dose of about 110.sup.11 to about 810.sup.13 vp/kg or about 110.sup.12 to about 810.sup.13 vp/kg. In other examples, the rAAV is administered at a dose of about 110.sup.13 to about 610.sup.13 vp/kg. In specific non-limiting examples, the rAAV is administered at a dose of at least about 110.sup.10, at least about 510.sup.10, at least about 110.sup.11, at least about 510.sup.11, at least about 110.sup.12, at least about 510.sup.12, at least about 110.sup.13, at least about 510.sup.13, or at least about 110.sup.14 vp/kg. In other non-limiting examples, the rAAV is administered at a dose of no more than about 110.sup.10, no more than about 510.sup.10, no more than about 110.sup.11, no more than about 510.sup.11, no more than about 110.sup.12, no more than about 510.sup.12, no more than about 110.sup.13, no more than about 510.sup.13, or no more than about 110.sup.14 vp/kg. In one non-limiting example, the rAAV is administered at a dose of about 110.sup.12 vp/kg. In another non-limiting example, the rAAV is administered at a dose of about 110.sup.11 vp/kg. The rAAV can be administered in a single dose, or in multiple doses (such as 2, 3, 4, 5, 6, 7, 8, 9 or 10 doses) as needed for the desired therapeutic results.

V. Modified Human G6PC/G6Pase- Sequences

(65) It is disclosed herein that the canine G6Pase- enzyme is more active than the human G6Pase- enzyme. As shown in FIG. 1 and Table 2, the two proteins differ in sequence at 18 residues. Using site-directed mutagenesis, human G6Pase- mutants with increased phosphohydrolase activity were identified. The human G6Pase- mutants that were generated contained one or more corresponding amino acids from canine G6Pase- at position(s) 3, 54, 139, 196, 199, 242, 247, 292, 298, 301, 318, 324, 332, 347, 349, 350 and/or 353 of SEQ ID NO: 2. The human G6Pase- sequence and a human/canine G6Pase- consensus sequence are set forth below.

(66) TABLE-US-00001 HumanG6Pase-(SEQIDNO:2): MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK 60 LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA 120 MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ 180 VVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK 240 AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIV 300 ASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL 357 Human/CanineG6Pase-consensussequence(SEQIDNO:10): MEXGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLXEAVGIK 60 LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA 120 MGTAGVYYVMVTSTLSIFXGKXKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ 180 VVAGVLSGIAVAETFXHIXSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK 240 AXRWCEXPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWXPFRLSXIV 300 XSLVLLHVFDSLKPPSQXELVFYXLSFCKSAXVPLASVSVIPYCLAXVXXQPXKKSL 357

(67) In some embodiments, provided herein is a modified G6Pase- comprising SEQ ID NO: 10, wherein X at amino acid residue 3=K or E; X at amino acid residue 54=R or Q; X at amino acid residue 139=R or Q; X at amino acid residue 142=K or I; X at amino acid residue 196=R or S; X at amino acid residue 199=Q or H; X at amino acid residue 242=R or Q; X at amino acid residue 247=R or Q; X at amino acid residue 292=F or L; X at amino acid residue 298=C or S; X at amino acid residue 301=V or A; X at amino acid residue 318=T or V; X at amino acid residue 324=T or V; X at amino acid residue 332=A or V; X at amino acid residue 347=R or Q; X at amino acid residue 349=F or L; X at amino acid residue 350=D or G; or X at amino acid residue 353=D or H, or any combination thereof.

(68) In particular examples, the modified G6Pase- sequence comprises a S298C mutation, or comprises S298C and A310V mutations, as set forth below. In non-limiting examples, the modified G6Pase- sequence comprises or consists of SEQ ID NO: 8 or SEQ ID NO: 9.

(69) TABLE-US-00002 HumanG6Pase-S298C(SEQIDNO:8): MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK 60 LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA 120 MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ 180 VVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK 240 AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSCIV 300 ASLVLLHVFDSLKPPSQVELVFYVLSFCKSAWPLASVSVIPYCLAQVLGQPHKKSL 357 HumanG6Pase-S298C/A310V(SEQIDNO:9): MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK 60 LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA 120 MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ 180 VVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK 240 AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSCIV 300 VSLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL 357

(70) In some embodiments, the modified G6Pase- comprising an S298C mutation is encoded by a nucleic acid sequence set forth below.

(71) TABLE-US-00003 HumanG6PCS298C(SEQIDNO:6): ATGGAGGAAGGAATGAATGTTCTCCATGACTTT GGGATCCAGTCAACACATTACCTCCAGGTGAATTACCAAG ACTCCCAGGACTGGTTCATCTTGGTGTCCGTGATCGCAGA CCTCAGGAATGCCTTCTACGTCCTCTTCCCCATCTGGTTC CATCTTCAGGAAGCTGTGGGCATTAAACTCCTTTGGGTAG CTGTGATTGGAGACTGGCTCAACCTCGTCTTTAAGTGGAT TCTCTTTGGACAGCGTCCATACTGGTGGGTTTTGGATACT GACTACTACAGCAACACTTCCGTGCCCCTGATAAAGCAGT TCCCTGTAACCTGTGAGACTGGACCAGGGAGCCCCTCTGG CCATGCCATGGGCACAGCAGGTGTATACTACGTGATGGTC ACATCTACTCTTTCCATCTTTCAGGGAAAGATAAAGCCGA CCTACAGATTTCGGTGCTTGAATGTCATTTTGTGGTTGGG ATTCTGGGCTGTGCAGCTGAATGTCTGTCTGTCACGAATC TACCTTGCTGCTCATTTTCCTCATCAAGTTGTTGCTGGAG TCCTGTCAGGCATTGCTGTTGCAGAAACTTTCAGCCACAT CCACAGCATCTATAATGCCAGCCTCAAGAAATATTTTCTC ATTACCTTCTTCCTGTTCAGCTTCGCCATCGGATTTTATC TGCTGCTCAAGGGACTGGGTGTAGACCTCCTGTGGACTCT GGAGAAAGCCCAGAGGTGGTGCGAGCAGCCAGAATGGGTC CACATTGACACCACACCCTTTGCCAGCCTCCTCAAGAACC TGGGCACGCTCTTTGGCCTGGGGCTGGCTCTCAACTCCAG CATGTACAGGGAGAGCTGCAAGGGGAAACTCAGCAAGTGG CTCCCATTCCGCCTCAGCTGCATTGTAGCCTCCCTCGTCC TCCTGCACGTCTTTGACTCCTTGAAACCCCCATCCCAAGT CGAGCTGGTCTTCTACGTCTTGTCCTTCTGCAAGAGTGCG GTAGTGCCCCTGGCATCCGTCAGTGTCATCCCCTACTGCC TCGCCCAGGTCCTGGGCCAGCCGCACAAGAAGTCGTTGTA A Humancodon-optimizedG6PCS298C(SEQIDNO:7): ATGGAAGAGGGCATGAACGTGCTGCACGACTTC GGCATCCAGAGCACCCACTATCTGCAGGTCAACTACCAGG ACAGCCAGGACTGGTTCATCCTGGTGTCCGTGATCGCCGA CCTGCGGAACGCCTTCTACGTGCTGTTCCCCATCTGGTTC CATCTGCAAGAAGCCGTCGGCATCAAGCTGCTGTGGGTGG CCGTGATCGGCGATTGGCTGAACCTGGTGTTCAAGTGGAT CCTGTTCGGCCAGCGGCCCTATTGGTGGGTGCTGGACACC GACTACTACAGCAACACCAGCGTGCCCCTGATCAAGCAGT TCCCCGTGACCTGCGAGACAGGCCCTGGCTCTCCTTCTGG CCACGCCATGGGAACAGCCGGCGTGTACTACGTGATGGTC ACCAGCACCCTGAGCATCTTCCAGGGCAAGATCAAGCCCA CCTACCGGTTCCGGTGCCTGAACGTGATCCTGTGGCTGGG CTTCTGGGCCGTGCAGCTGAACGTGTGCCTGAGCCGGATC TACCTGGCCGCCCACTTCCCACATCAAGTGGTGGCCGGCG TGCTGAGCGGAATCGCCGTGGCCGAGACATTCAGCCACAT CCACAGCATCTACAACGCCAGCCTGAAGAAGTACTTCCTG ATCACATTCTTTCTGTTCAGCTTCGCCATCGGCTTCTACC TGCTGCTGAAGGGCCTGGGCGTGGACCTGCTGTGGACCCT GGAAAAGGCCCAGCGGTGGTGCGAGCAGCCCGAGTGGGTG CACATCGACACCACCCCCTTCGCCAGCCTGCTGAAGAACC TGGGCACCCTGTTTGGACTGGGCCTGGCCCTGAACAGCAG CATGTACAGAGAGAGCTGCAAGGGCAAGCTGAGCAAGTGG CTGCCCTTCCGGCTGAGCTGCATCGTGGCCAGCCTGGTGC TGCTGCACGTGTTCGACAGCCTGAAGCCCCCCAGCCAGGT GGAACTGGTGTTTTACGTGCTGAGCTTCTGCAAGAGCGCC GTGGTGCCCCTGGCCTCCGTGTCTGTGATCCCCTACTGCC TGGCTCAGGTGCTGGGCCAGCCCCACAAGAAGTCCCTCTG A

VI. Recombinant AAV for Gene Therapy Applications

(72) AAV belongs to the family Parvoviridae and the genus Dependovirus. AAV is a small, non-enveloped virus that packages a linear, single-stranded DNA genome. Both sense and antisense strands of AAV DNA are packaged into AAV capsids with equal frequency.

(73) The AAV genome is characterized by two inverted terminal repeats (ITRs) that flank two open reading frames (ORFs). In the AAV2 genome, for example, the first 125 nucleotides of the ITR are a palindrome, which folds upon itself to maximize base pairing and forms a T-shaped hairpin structure. The other 20 bases of the ITR, called the D sequence, remain unpaired. The ITRs are cis-acting sequences important for AAV DNA replication; the ITR is the origin of replication and serves as a primer for second-strand synthesis by DNA polymerase. The double-stranded DNA formed during this synthesis, which is called replicating-form monomer, is used for a second round of self-priming replication and forms a replicating-form dimer. These double-stranded intermediates are processed via a strand displacement mechanism, resulting in single-stranded DNA used for packaging and double-stranded DNA used for transcription. Located within the ITR are the Rep binding elements and a terminal resolution site (TRS). These features are used by the viral regulatory protein Rep during AAV replication to process the double-stranded intermediates. In addition to their role in AAV replication, the ITR is also essential for AAV genome packaging, transcription, negative regulation under non-permissive conditions, and site-specific integration (Daya and Berns, Clin Microbiol Rev 21(4):583-593, 2008).

(74) The left ORF of AAV contains the Rep gene, which encodes four proteinsRep78, Rep 68, Rep52 and Rep40. The right ORF contains the Cap gene, which produces three viral capsid proteins (VP1, VP2 and VP3). The AAV capsid contains 60 viral capsid proteins arranged into an icosahedral symmetry. VP1, VP2 and VP3 are present in a 1:1:10 molar ratio (Daya and Berns, Clin Microbiol Rev 21(4):583-593, 2008).

(75) AAV is currently one of the most frequently used viruses for gene therapy. Although AAV infects humans and some other primate species, it is not known to cause disease and elicits a very mild immune response. Gene therapy vectors that utilize AAV can infect both dividing and quiescent cells and persist in an extrachromosomal state without integrating into the genome of the host cell. Because of the advantageous features of AAV, the present disclosure contemplates the use of AAV for the recombinant nucleic acid molecules and methods disclosed herein.

(76) AAV possesses several desirable features for a gene therapy vector, including the ability to bind and enter target cells, enter the nucleus, the ability to be expressed in the nucleus for a prolonged period of time, and low toxicity. However, the small size of the AAV genome limits the size of heterologous DNA that can be incorporated. To minimize this problem, AAV vectors have been constructed that do not encode Rep and the integration efficiency element (IEE). The ITRs are retained as they are cis signals required for packaging (Daya and Berns, Clin Microbiol Rev 21(4):583-593, 2008).

(77) Methods for producing rAAV suitable for gene therapy are well known in the art (see, for example, U.S. Patent Application Nos. 2012/0100606; 2012/0135515; 2011/0229971; and 2013/0072548; and Ghosh et al., Gene Ther 13(4):321-329, 2006), and can be utilized with the recombinant nucleic acid molecules, vectors and methods disclosed herein.

(78) The following examples are provided to illustrate certain particular features and/or embodiments. These examples should not be construed to limit the disclosure to the particular features or embodiments described.

EXAMPLES

Example 1: Construction and Characterization of Human G6PC (G6Pase-) Mutants for Use in AAV-Mediated Gene Therapy

(79) This example describes the generation of 18 human G6PC mutants and the identification of specific G6Pase- mutants with increased phosphohydrolase activity.

(80) Construction of G6PC Mutants

(81) To construct human G6PC mutants, the pSVL vector, comprising nucleotides 1 to 1074 of human G6PC cDNA (the entire coding region, with the initiation codon ATG at nucleotides 1-3; SEQ ID NO: 11), was used as a template. For PCR-directed mutagenesis, the template was amplified using two outside PCR primers matching nucleotides 1 to 20 (sense) and 1055 to 1074 (antisense) that flanked the 20 nucleotide long sense and antisense mutant primers with the codon to be mutated in the middle (see FIG. 4 and Table 1 below). The template for the hG6PC-S298C/A301V double mutant was the pSVL-hG6PC-S298C mutant. The mutated sequences were cloned in pSVL and verified by DNA sequencing.

(82) TABLE-US-00004 TABLE 1 Nucleotide changes in human G6PC mutants Mutation Nucleotide/codon changes Sequences in human G6PC R3K GAA (R) .fwdarw. AAA (K) nucleotides 7-9 Q54R CAG (Q) .fwdarw. CGT (R) nucleotides 160-162 Q139R CAG (Q) .fwdarw. CGG (R) nucleotides 415-417 I142K ATA (I) .fwdarw. AAA (K) nucleotides 424-426 S196R AGC (S) .fwdarw. CGC (R) Nucleotides 586-588 H199Q CAC (H) .fwdarw. CAG (Q) nucleotides 595-597 Q242R CAG (Q) .fwdarw. AGG (R) nucleotides 724-726 Q247R CAG (Q) .fwdarw. CGG (R) nucleotides 739-741 L292F CTC (L) .fwdarw. TTC (F) nucleotides 874-876 S298C TCT (S) .fwdarw. TGC (C) nucleotides 892-894 A301V GCC (A) .fwdarw. GTG (V) nucleotides 901-903 V318T GTC (V) .fwdarw. ACT (T) nucleotides 952-954 V324T GTC (V) .fwdarw. ACC (T) nucleotides 970-972 V332A GTA (V) .fwdarw. GCA (A) nucleotides 994-996 Q347R CAG (Q) .fwdarw. CGG (R) nucleotides 1039-1041 L349F CTG (L) .fwdarw. TTC (F) nucleotides 1045-1047 G350D GGC (G) .fwdarw. GAC (D) nucleotides 1048-1050 H353D CAC (H) .fwdarw. GAC (D) nucleotides 1057-1059
Expression in COS-1 Cells and Phosphohydrolase Assays

(83) COS-1 cells were grown at 37 C. in HEPES-buffered Dulbecco modified minimal essential medium supplemented with 4% fetal bovine serum. The G6PC constructs were transfected into COS-1 cells by the DEAE-dextran/chloroquine method. After incubation at 37 C. for 2 days, the transfected cultures were harvested for phosphohydrolase activity. Briefly, reaction mixtures (50 l) containing 50 mM cacodylate buffer, pH 6.5, 10 mM G6P and appropriate amounts of cell homogenates were incubated at 37 C. for 10 minutes as previously described (Lei et al., Science 262:580-583, 1993).

(84) Statistical Analysis

(85) The unpaired t test was performed using the GraphPad Prism Program, version 4 (GraphPad Software, San Diego, CA). Values were considered statistically significant at p<0.05.

(86) Results

(87) The phosphohydrolase activities of human and canine G6Pase- were compared by in vitro expression assays. The results demonstrated that the canine enzyme was about 5-fold more active than the human enzyme. A sequence alignment of the canine and human sequences showed that the two enzymes differ by 18 amino acid residues (FIG. 1 and Table 2).

(88) TABLE-US-00005 TABLE 2 Amino acid differences between human and canine G6Pase- Amino Amino Amino Amino Amino acid acid acid acid acid Canine K3 R54 R139 K142 R196 Human E3 Q54 Q139 I142 S196 Canine Q199 R242 R247 F292 C298 Human H199 Q242 Q247 L292 S298 Canine V301 T318 T324 A332 R347 Human A301 V318 V324 V332 Q347 Canine F349 D350 D353 Human L349 G350 H353

(89) To determine which amino acid substitutions result in increased enzymatic activity of canine G6Pase-, 18 human G6PC mutants were constructed via site-directed mutagenesis. Each mutant carried one of the corresponding amino acids from canine G6Pase-. Phosphohydrolase activities of the 18 human G6Pase- mutants were examined by transient expression assays. The results showed that the human G6PC-S298C construct was the most active, with 2.14-fold higher activity than the activity of the G6PC-WT construct (Table 3). The G6PC-A301V mutant was also more active, being 1.35-fold more active than the G6PC-WT. Next, a double S298C/A301V mutant (hG6PC-S298C/A301V) was constructed. This double mutant was equally as active as the single hG6PC-S298C mutant (Table 3).

(90) TABLE-US-00006 TABLE 3 Phosphohydrolase activity of human G6PC mutants Phosphohydrolase activity G6PC construct Location (nmol/min/mg) pSVL-hG6PC-WT 164.5 9.5 (100%) pSVL-hG6PC-E3K N-terminal 156.0 6.3 pSVL-hG6PC-Q54R C1 169.6 7.3 pSVL-hG6PC-Q139R C2 113.1 6.7 pSVL-hG6PC-I142K C2 141.0 4.4 pSVL-hG6PC-S196R H5 90.5 2.5 pSVL-hG6PC-H199Q C3 154.0 7.4 pSVL-hG6PC-Q242R L3 174.5 4 pSVL-hG6PC-Q247R L3 143.8 16.4 pSVL-hG6PC-L292F H8 140.3 20.3 pSVL-hG6PC-S298C H8 351.8 16.4 (214%) pSVL-hG6PC-A301V H8 221.7 12.5 (135%) pSVL-hG6PC-S298C/A301V H8 353.7 18.8 (215%) pSVL-hG6PC-V318T L4 156.7 16.3 pSVL-hG6PC-V324T H9 117.6 8.2 pSVL-hG6PC-V332A H9 160.5 13.1 pSVL-hG6PC-Q347R C-terminal 162.5 7.9 pSVL-hG6PC-L349F C-terminal 186.4 5.9 (113%) pSVL-hG6PC-G350D C-terminal 146.6 16.7 pSVL-hG6PC-H353D C-terminal 164.7 2.8

(91) Phosphohydrolase activity of COS-1 cells transfected with a human (h) G6PC wild-type (WT) or a hG6PC mutant construct in a pSVL vector. The data represent the meanSEM. H, L, and C denote the locations of the mutations in helices 1 to 9, luminal loops 1 to 4 or cytoplasmic loops 1 to 4, respectively (FIG. 2). Numbers in parentheses are % of hG6PC-WT activity. Phosphohydrolase assays were performed in duplicate.

(92) It has been previously shown that the structural integrity of transmembrane helices is vital to the stability and enzymatic activity of G6PC, and non-helical mutants play no essential role in the stability of G6PC (Shieh et al., J Biol Chem 277:5047-5053, 2002). In accordance with these previous observations, mutations of amino acid residues in helix 8 of G6PC markedly altered enzymatic activity.

(93) To further confirm the efficacy of the hG6PC-S298C construct, phosphohydrolase activities of two human G6PC constructs, pSVL-G6PC-WT and pSVL-G6PC-S298C, were compared. Transient expression assays showed that the pSVL-G6PC-S298C construct was 1.7-fold more efficacious than the pSVL-G6PC construct (Table 4).

(94) Studies have shown that codon optimization strategies can increase translation efficiency (Huston et al., Mol Ther 9:1867-1877, 2011). Codon-optimized (co) human G6PC is 1.46-fold more active than the G6PC-WT construct (Table 4). To examine the impact of codon optimization, pSVL-co-G6PC-S298C, which expresses a codon optimized human G6PC-S298C, was constructed. Transient expression assays showed that the pSVL-co-G6PC-S298C construct was 2.9-fold more efficacious than the pSVL-G6PC-WT construct (Table 4).

(95) TABLE-US-00007 TABLE 4 Phosphohydrolase activity of hG6PC-WT, hG6PC-S298C, co-hG6PC, co-hG6PC-S298C, and canine G6PC Phosphohydrolase activity hG6PC constructs (nmol/min/mg) pSVL-hG6PC-WT 131.1 3.8 (100%) pSVL-hG6PC-S298C 223.1 7.1 (170%) pSVL-co-hG6PC 191.5 6.0 (146%) pSVL-co-hG6PC-S298C 382.8 23.5 (292%) pSVL-canine G6PC 725.7 66.5 (554%)

(96) Phosphohydrolase activity of COS-1 cells transfected with hG6PC-WT, hG6PC-S298C, co-hG6PC, co-hG6PC-S298C, or canine G6PC construct in a pSVL vector. The data represent the meanSEM of three independent experiments using three separate batches of each construct. Phosphohydrolase assays were performed in duplicate. Numbers in parentheses are % of hG6PC-WT activity.

(97) Recombinant AAV8-GPE-G6PC, AAV8-GPE-co-G6PC, AAV8-GPE-G6PC-S298C and AAV8-GPE-co-G6PC-S298C vectors were constructed. Hepatic G6Pase activity was examined in GSD-Ia (G6pc/) mice infused with AAV8-GPE-G6PC, AAV8-GPE-G6PC-S298C, AAV8-GPE-co-G6PC, or AAV8-GPE-co-G6PC-S298C vectors. In agreement with in vitro expression studies, in vivo studies showed that the AAV8-GPE-G6PC-S298C and AAV8-co-G6PC-S298C vectors directed hepatic G6PC expression that was 3.4-fold over that of the AAV8-GPE-G6PC vector (FIG. 3).

Example 2: Evaluation of Minimal Vector Dose Required to Correct Hepatic G6Pase- Deficiency

(98) This example describes studies to determine the minimal dose needed to restore G6Pase- activity to a level that prevents HCA/HCC development and maintains glucose homeostasis.

(99) GSD-Ia is characterized by impaired glucose homeostasis and the long-term complication of hepatocellular adenoma (HCA) (Chou et al., Nat Rev Endocrinol 6:676-688, 2010). The inventor has previously shown that rAAV8-G6PC-treated G6pc/ mice expressing 3% of normal hepatic G6Pase- activity (which is equivalent to 5 units of G6Pase- activity; 1 nmol/min/mg is defined as one unit of G6Pase- activity) maintain glucose homeostasis to age P70-P90 weeks and do not develop HCA (Lee et al., Hepatology 56:1719-1729, 2012; PCT Publication No. WO 2015/081101, which is herein incorporated by reference).

(100) The present study was conducted using purified, accurately tittered rAAV8 vectors (supplied by Dimension Therapeutics, Cambridge, MA) to determine the minimal dosage of rAAV vector required to correct hepatic G6Pase- deficiency using G6pc/ mice. Ten-day-old G6pc/ mice were infused with 510.sup.11 vg/kg of rAAV8-co-G6PC or rAAV8-co-G6PC-S298C. At age 24-days (2 weeks post-infusion), hepatic G6Pase- activity in rAAV-co-G6PC-S298C- and rAAV8-co-G6PC-treated G6pc/ mice was 18.61.1 and 7.71.1 units, respectively (FIG. 5).

(101) It has been shown that the efficiency and persistence of AAV-mediated hepatic gene transfer are lower during early development because the fast rate of hepatocellular proliferation associated with liver growth can dilute out the number of cells effectively infected with AAV (Yiu et al., Mol Ther 18:1076-1084, 2010). In two-week-old G6pc/ mice infused with 1.510.sup.13 vg/kg of rAAV-G6PC, hepatic G6Pase- activity was 174.022.4 units at age 24 weeks. In four-week-old G6pc/ mice infused with 110.sup.13 vg/kg of rAAV-G6PC, hepatic G6Pase- activity was 335.640.2 units at age 24 weeks, which is 2.9-fold higher than the G6Pase- activity in mice infused at age 2 weeks with the same vector dosage.

(102) Therefore, it is expected that if the same dosage of rAAV-co-G6PC-S298C is infused into 4-week-old G6pc/ mice, hepatic G6Pase- activity will be restored to 53.94 (18.62.9) units at age 24 weeks, well above the minimal hepatic G6Pase- activity (5 units) required to maintain glucose homeostasis and prevent HCA/HCC formation. This also meets the requirement of rAAV-mediated human clinical gene therapy trial for the treatment of GSD-Ia, which requires administration of 110.sup.12 vg/kg AAV.

(103) To compare the relative efficacy of the four different vectors, 10-day-old G6pc/ mice are infused with 510.sup.11 vg/kg of accurately tittered rAAV8-G6PC or rAAV8-G6PC-S298C vector and hepatic G6Pase- activity of the treated G6pc/ mice is examined at age 24 days. In addition, 10-day-old G6pc/ mice are infused with 510.sup.12 vg/kg of accurately tittered rAAV8-G6PC, rAAV8-G6PC-S298C, rAAV8-co-G6PC or rAAV8-co-G6PC-S298C and hepatic G6Pase- activity of the treated G6pc/ mice is examined at age 12 weeks. The results of this study will demonstrate the stability of transgene expression from age 24 days to age 12 weeks.

(104) Untreated G6pc/ mice have a short lifespan. To more accurately determine the minimal dosage of rAAV vector required to correct hepatic G6Pase- deficiency in adult mice, L-G6pc/ mice, which have a liver-specific G6Pase knockout and survive to adulthood, were used as described below.

(105) G6pc.sup.fx/fx mice contain exon 3 of the G6pc gene flanked with loxP sites (Peng et al., Genesis 47:590-594, 2009). The G6pc.sup.fx/fx mice were crossed with SA.sup.creERT2/w mice (Schuler et al., Genesis 39:167-172, 2004), which express a tamoxifen-dependent Cre-recombinase under the control of the serum albumin promoter to produce G6pc.sup.fx/fx.SA.sup.creERT2/w mice. The liver-specific G6pc knockout (L-G6pc/) were generated by tamoxifen-mediated excision of the G6pc exon 3 in three-week-old G6pc.sup.fx/fx.SA.sup.creERT2/w mice. It is expected that 100% of L-G6pc/ mice will develop HCA/HCC at age 54 weeks (51 week post G6pc gene excision).

(106) Ten-week-old L-G6pc/ mice were treated with 10.sup.12 vg/kg of rAAV-G6PC. The results showed that at age 18 weeks, hepatic G6Pase- activity was restored to 68.912.8 units (FIG. 6A). The AAV-treated mice (AAV mice) exhibited no hepatic histological abnormalities except mild glycogen storage (FIG. 6B), and displayed a normal profile of fasting glucose tolerance (FGT) (FIG. 6C). Moreover, the AAV mice exhibited normalized liver weight (FIG. 6D) and normalized hepatic levels of glycogen and triglyceride (FIG. 6E). These data indicate that it is possible to scale down to a more optimal dosage for a human clinical gene therapy trial for the treatment of GSD-Ia.

(107) To examine the minimal dosage of rAAV8-G6PC, rAAV8-co-G6PC, rAAV8-G6PC-S298C and rAAV8-co-G6PC-S298C required to correct hepatic G6Pase- deficiency and prevent HCA/HCC development, various doses (e.g., 110.sup.10, 310.sup.10, 110.sup.11, 310.sup.11, 110.sup.12, 310.sup.12 and 110.sup.13) of each vector are infused into 10-12-week-old L-G6pc/ mice. At age 54 weeks, G6Pase- activity is measured. Hepatic histology, FGT, liver weight and hepatic levels of glycogen and triglyceride are also measured and/or evaluated.

Example 3: Treatment of Human GSD-Ia Using AAV-Based Gene Therapy

(108) This example describes an exemplary method for the clinical use of AAV vectors encoding modified G6PC for the treatment of GSD-Ia.

(109) A patient diagnosed with GSD-Ia is selected for treatment. Typically, the patient is at least 18 years old and may or may not have had pre-exposure to immunomodulation. The patient is administered a therapeutically effective amount of a recombinant AAV expressing modified G6PC, such as a rAAV comprising SEQ ID NO: 4 or SEQ ID NO: 5, as disclosed herein. The recombinant AAV can be administered intravenously. An appropriate therapeutic dose can be selected by a medical practitioner. In some cases, the therapeutically effective dose is in the range of 110.sup.10 to 110.sup.14 viral particles (vp)/kg, such as about 110.sup.11 or 110.sup.12 vp/kg. In most instances, the patient is administered a single dose. In the absence of immunomodulation, the patient is likely to tolerate only a single infusion of rAAV. If the subject has had pre-exposure immunomodulation, two or more doses may be administered. The health of the subject can be monitored over time to determine the effectiveness of the treatment.

(110) In view of the many possible embodiments to which the principles of the disclosed invention may be applied, it should be recognized that the illustrated embodiments are only preferred examples of the invention and should not be taken as limiting the scope of the invention. Rather, the scope of the invention is defined by the following claims. We therefore claim as our invention all that comes within the scope and spirit of these claims.