Composition for use in improving endothelial function by enhancing flow mediated dilation

12440531 ยท 2025-10-14

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to a composition comprising esterase treated decaffeinated green coffee extract (HDGCE) for use in a method of improving cardiovascular endpoints such as endothelial function by enhancing flow mediated dilation in a subject, wherein the subject is administered an effective dose of HDGCE with an amount of 100-400 mg/day.

Claims

1. A method for improving cardiovascular flow and reducing the risk of cardiovascular diseases in healthy subjects as measured by changes in measured flow mediated dilation (FMD) in a subject, wherein the subject is administered an effective dose of a composition comprising esterase treated decaffeinated green coffee extract (HDGCE) in an amount of 100-400 mg/day.

2. The method according to claim 1, wherein the composition is in the form of a functional food product.

3. The method according to claim 1, wherein the composition comprises a weight ratio of caffeic acid:ferulic acid of at least 2:1.

4. The method according to claim 3, wherein the composition has a weight ratio of caffeic acid:ferulic acid ranging from 3:1 to 10:1.

5. The method according to claim 1, wherein the composition has a total content of caffeic acid and ferulic acid between 30 and 80 mg and the composition is a heat-treated composition.

6. The method according to claim 1, wherein the composition has a total content of caffeic acid and ferulic acid of between 35 and 60 mg and the composition is a heat-treated composition.

7. The method according to claim 1, wherein the composition is a liquid beverage composition.

8. The method according to claim 1, wherein the subject, in addition to the administration of HDGCE is further complemented with a meal of at least 200 kcal.

9. The method according to claim 1, wherein the subject is human.

10. The method according to claim 1, wherein the cardiovascular disease is endothelial dysfunction.

11. The method according to claim 1, wherein the composition is in the form of a powder.

12. The method according to claim 1, wherein the composition is in the form of a snack.

Description

BRIEF DESCRIPTION OF FIGURES

(1) FIG. 1 shows purified esterase from L. johnsonii with Mw of around 34 KDa.

(2) FIG. 2 shows effect of pH on the L. johnsonii esterase activity.

(3) FIG. 3 shows effect of temperature on the L. johnsonii esterase activity.

(4) FIG. 4 shows substrate specificity of L. johnsonii esterase. 4-nitrophenyl butyrate (); 4-nitrophenyl acetate (.diamond-solid.); 4-nitrophenyl decanoate (.box-tangle-solidup.); 4-nitrophenyl tetradecanoate (.square-solid.); 4-nitrophenyl dodecanoate ().

(5) FIG. 5 shows Kinetic transformation of CQAs (); FQAs (.square-solid.) and di-CQAs () from decaffeinated green coffee extract (200 g/L) by L. johnsonii esterase (16.5 U/ml) and formation of caffeic acid (.box-tangle-solidup.) and ferulic acid (.diamond-solid.) as function of time. Reaction volume was 1 ml. The reactions were performed in duplicate.

(6) FIG. 6 shows the trial design of the experimental example disclosed herein.

DETAILED DESCRIPTION OF THE INVENTION

(7) The term cardiovascular disease may include, e.g. coronary artery disease (also known as coronary heart disease and ischemic heart disease), peripheral arterial disease (e.g. peripheral endothelial dysfunction), renal artery stenosis, and aortic aneurysm, atherosclerotic plaque formation. There are also many cardiovascular diseases that involve the heart, e.g. cardiomyopathy, hypertensive heart disease, heart failure, pulmonary heart disease, cardiac dysrhythmias, endocarditis. The structures most commonly involved are the heart valves, inflammatory cardiomegaly, myocarditis, certain medications, toxins, and autoimmune disorders, eosinophilic myocarditis, valvular heart disease, congenital heart disease, and rheumatic heart disease. Preferably, the cardiovascular disease is selected from atherosclerotic plaque formation, coronary artery disease, and endothelial dysfunction, preferably endothelial dysfunction. More preferably, the cardiovascular disease is endothelial dysfunction, preferably peripheral endothelial dysfunction.

(8) Cerebrovascular disease includes a variety of medical conditions that affect the blood vessels of the brain and the cerebral circulation. Arteries supplying oxygen and nutrients to the brain are often damaged or deformed in these disorders. The most common presentation of cerebrovascular disease is an ischemic stroke or mini-stroke and sometimes a hemorrhagic stroke. Hypertension (high blood pressure) is the most important contributing risk factor for stroke and cerebrovascular diseases as it can change the structure of blood vessels and result in atherosclerosis. Atherosclerosis narrows blood vessels in the brain, resulting in decreased cerebral perfusion. Other risk factors that contribute to stroke include smoking and diabetes. Narrowed cerebral arteries can lead to ischemic stroke, but continually elevated blood pressure can also cause tearing of vessels, leading to a hemorrhagic stroke. Preferably, the cerebrovascular disease is selected from ischemic stroke, mini stroke, and hemorrhagic stroke.

(9) The term functional food product means a beverage or food composition comprising the HDGCE composition in an amount ranging from 100-400 mg of hydrolysed green coffee extract. The food composition may be a powder form such as chocolate or malt based composition. The food composition may also be a snack such as a cereal bar comprising HDGCE.

(10) The term esterase treated refers to incubation of the decaffeinated green coffee extract with purified chlorogenate esterase or microorganism containing such an esterase. A chlorogenate esterase for example is described in U.S. Pat. No. 8,481,028 or for example in Bel-Rhlid et al.: Biotranformation of caffeoyl quinic acids from green coffee extracts by Lactobacillus johnsonii NCC 533 (2013): AMB express vol 3:28.

(11) An esterase is a hydrolase enzyme that splits esters into an acid and an alcohol in a chemical reaction with water called hydrolysis. The incubation time can be from 30 minutes to 6 hrs at temperatures ranging from 20 to 50 C. related to concentration of the enzyme such that hydrolysis of at least 80% of total chlorogenic acids present in the decaffeinated green coffee extract is reached. In one embodiment the esterase is from L. johnsonii.

(12) The term decaffeinated green coffee extract refers to green coffee beans decaffeinated by for instance hot water or extraction with organic solvents or supercritical CO.sub.2 well known to a skilled person in the art. The caffeine content is lower than 5% W/W, may be 2 to 3% W/W.

(13) The term amount of 100-400 mg/day refers to the esterase treated decaffeinated green coffee extract (HDGCE) of 100-400 mg dry weight, which may be dissolved, for instance in water or integrated in to a consumable food product such as cereals, soluble coffee, chocolate or food complement such as capsules or tablets fit for consumption by the subject. In one embodiment the amount of esterase treated decaffeinated green coffee extract of 100-400 mg dry weight is dissolved in about 200 ml water.

(14) The term measured by changes in flow mediated dilation refers to the change in delta FMD value between a subject administered with a placebo (subject given a composition without the HDGCE) vs a subject administered with active composition (composition comprising 100-400 mg/day of HDGCE). In one embodiment the change is at least 1% with a p value lower than 0.02.

(15) In one embodiment, the total content of caffeic acid and ferulic acid in said HDGCE composition is between 30 and 80 mg and the composition may be a heat-treated composition. In another embodiment, the total content of caffeic acid and ferulic acid in said HDGCE composition is between 35 and 60 mg and the composition may be a heat-treated composition.

(16) The composition for use according to the invention may be in any suitable format, for example the composition may be in the form of a liquid composition, in the form of a beverage, for example a liquid drink, a shake drink, a nutritional composition or a liquid meal replacement.

(17) An important method of controlling food hygiene risks is to heat treat edible compositions, which may harbour food pathogens or spoilage organisms. Well-known examples of such heat treatments are pasteurization, for example heating an edible material to 70 C. for 2 minutes or 75 C. for 26 seconds or 80 C. for 5 seconds, and ultra-high temperature (UHT) treatment, for example heating an edible material to above 135 C. for at least 2 seconds.

(18) The composition for use according to the invention may be administered in a daily dose to provide HDGCE between 100 mg and 400 mg dry weight per subject per day. This dose should ensure a sufficient daily quantity for providing the desired effect to a subject in at least a mid-term period. In one embodiment, the subject is fasting when the composition is administered.

(19) A further aspect of the present invention is the non-therapeutic use of a composition comprising HDGCE with an amount of 100-400 mg/day to increase flow mediated dilation (FMD), wherein the amount of caffeic acid and ferulic is in the ratio of caffeic:ferulic of at least more than 2:1, for example at least more than 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1 or 10:1.

(20) In one embodiment, the said subject, in addition to the administration of HDGCE is further complemented with a meal of at least 200 kcal.

(21) In one embodiment, the subject is a human subject. In one embodiment, the subject is a healthy human subject.

(22) Coffee Extract

(23) Numerous methods for producing coffee extracts are known in the art, e.g. from EP 0916267. The coffee extract may e.g. be pure soluble coffee. Pure soluble coffee products are readily available and numerous methods for producing pure soluble coffee products are known in the art, e.g. from EP106930.

(24) Another aspect of the invention provides a process for preparing a HDGCE composition comprising the steps of; (i) Preparing a decaffeinated green coffee extract by contacting green coffee beans with water, steam, organic solvent, super critical CO.sub.2 and/or mixtures thereof; (ii) Optionally drying the decaffeinated green coffee extract; (iii) Contacting the obtained decaffeinated green coffee extract with esterase enzyme, at pH ranging from 4 to 7 and temperature ranging from 20 to 50 C. for incubation time ranging from 1 to 6 hours; (iv) Heating the above enzyme treated green coffee extract at a temperature ranging from 80 to 120 C. for 1 to 30 minutes to deactivate the enzyme and to pasteurize the extract; and (v) Optionally drying the extract to obtain the esterase treated decaffeinated green coffee extract (HDGCE). In one embodiment, the drying step (ii) is spray drying or freeze drying. In another embodiment the esterase enzyme is preferably chlorogenate esterase in a concentration preferably ranging from 1 to 20 U/200 mg of green coffee extract W/W preferably dissolved in 1 ml of water or buffer.

(25) Those skilled in the art will understand that they can freely combine all features of the present invention disclosed herein. In particular, features described for the therapeutic use of the composition may be combined with the non-therapeutic use and vice versa. Further, features described for different embodiments of the present invention may be combined. Further advantages and features of the present invention are apparent from the figures and examples.

EXAMPLES

Example 1

(26) Purification, Characterization and Cloning of Esterase from Lactobacillus johnsonii (NCC 533)

(27) The esterase activity was identified in Lactobacillus johnsonii whole cells. The enzyme was purified and characterized. The gene was annotated (LJ-1228, Gene=1158601 1159347 Reversed Product=alpha/beta hydrolase see sequences below). The gene was then over-expressed in a food-grade E. coli and enzyme purified by HPLC (HIC column TSK gel Phenyl-5 PW, Linear gradient of 1 to 0 mol (NH.sub.4).sub.2SO.sub.4/L in NaPO.sub.4 (50 mM) pH 7.0+1 mM EDTA. Flow 0.8 ml/min).

(28) TABLE-US-00001 DNASequence/NucleotidesSequence Atggagactacaattaaacgtgatggtctaaacttacatggtttacttgaaggaaccgataagattgaaaatgatacgattgctattttaatgcat ggttttaaaggtgatttgggttatgatgacagcaagattttgtatgctctctctcactacttaaatgatcaaggcctcccaacaattcgttttgacttt gatggatgcggaaaaagtgatggtaaatttgaagatatgactgtctatagcgaaatcctagatgggataaaaatattagattatgttcgtaatac tgttaaggcaaaacatatctatttagtgggacactcccaaggtggagtagtagcgtcaatgctggctggatattatcgagatgttattgaaaaat tggctttactctctcctgcagcaactcttaagtctgatgctttagatggagtttgtcagggtagtacttatgatccaacgcatatccctgaaactgt caatgttagtggctttgaagtaggaggagcttactttagaacggctcaattattgcctatttatcaaacagcggaacattataatagggaaacttt attgattcatggcttagcagataaagtcgtgtcacctaatgcttcaagaaaatttcatacacttttgcctaaaagtgagctccatttaattccagat gagggtcacatgtttaacggaaaaaatagacctgaagtattaaaattagttggtgagtttttaataaaataa AminoAcidSequence 1 mettikrdglnlhgllegtdkiendtiailmhgfkgdldyddskilyalshylndqglpt 61 irfdfdgcgksdgkfedmtvyseildgikildyvrntvkakhiylvghsqggvvasmlag 121 yyrdvieklallspaatlksdaldgvcqgstydpthipetvnvsgfevggayfrtaqllp 181 iyqtaehynretllihgladkvvspnasrkfhtllpkselhlipdeghmfngknrpevlk 241 lvgeflik
Identification of Optimal pH of L. johnsonii Esterase

(29) The optimum pH was determined by using glycine buffer, acetate buffer, Tris buffer, phosphate buffer and water. 5-CQA was used as substrate (50 mol/ml). As we can see in FIG. 2, the optimum pH of the enzyme was between 4.0 and 6.0. The reactions were performed for 30 min at 37 C. with purified esterase (0.01 U/mg substrate)

(30) Identification of Optimal Temperature of L. johnsonii Esterase

(31) The optimum temperature was determined by using 5-CQA as substrate (50 mol/ml) at different temperatures from 10 C. to 90 C. As we can see in FIG. 3, the optimum temperature of the enzyme was between 30 C. and 40 C. The reactions were performed for 30 min at pH 5.0 with purified esterase (0.01 U/mg substrate)

(32) Substrate Specificity

(33) The substrate specificity of L. johnsonii esterase was studied using different 4-nitrophenyl derivatives. As we can see in FIG. 4, 4-nitrophenyl butyrate was the best substrate while no transformation of 4-nitrophenyl dodecanoate could be observed. The reactions were carried out in sodium phosphate buffer pH 6.0 at 37 C. for 10 min. The substrates were used at concentration of 0.2 mM and enzyme at 0.01 U/mg substrate. The measures were monitored each 30 seconds. The absorbance was set at 410 nm.

(34) Treatment of Decaffeinated Green Coffee Extract with L. Johnsonii Esterase.

(35) Reaction Kinetics: Lab Scale Trials

(36) Kinetic studies were performed on decaffeinated green coffee extract (DGCE) at 200 mg/ml using L. johnsonii esterase at different concentrations (1.65, 3.3, 4.95, 8.25 and 16.25 U/ml). The reactions were performed in 1 ml volume, at pH 4.5 and 37 C. The results are summarized in the charts below. The concentrations of the different compounds are in mg/ml.

(37) TABLE-US-00002 Time (h) 0 1 2 3 4 Enzyme (U) 0 1.65 1.65 1.65 1.65 DGCE 200 200 200 200 200 (mg/ml) CQAs 52.11 21.51 18.05 16.18 15.14 FQAs 11.03 9.89 9.09 9.56 8.3 di-CQAs 13.22 3.34 2.88 2.65 2.44 CA 0.49 19.82 21.51 22.35 22.08 FA 0.21 3.76 4.11 4.45 4.36 Caffeine 3.20 3.13 3.09 3.10 3.00 Enzyme (U) 0 3.3 3.3 3.3 3.3 DGCE 200 200 200 200 200 (mg/ml) CQAs 52.25 17.77 14.62 12.88 11.09 FQAs 11.1 1.65 1.46 1.28 1.11 di-CQAs 13.29 2.41 2.14 2.08 1.83 CA 0.48 25.63 27.23 27.56 26.27 FA 0.20 4.09 4.58 4.77 4.80 Caffeine 3.21 3.05 3.08 3.04 2.90 Enzyme (U) 0 4.95 4.95 4.95 4.95 DGCE 200 200 200 200 200 (mg/ml) CQAs 50.85 15.88 12.86 10.93 10.04 FQAs 10.74 1.66 1.29 1.07 0.57 di-CQAs 11.75 1.83 1.72 1.44 1.37 CA 0.49 26.42 27.77 27.82 27.65 FA 0.21 4.30 4.79 4.94 5.19 Caffeine 3.12 3.03 3.04 2.94 2.98 Enzyme (U) 0 8.25 8.25 8.25 8.25 DGCE 200 200 200 200 200 (mg/ml) CQAs 51.68 13.03 9.78 8.07 6.93 FQAs 10.92 1.32 0.56 0.50 0.49 di-CQAs 13.48 1.53 1.17 0.95 0.90 CA 0.48 27.13 28.52 29.22 29.40 FA 0.21 4.90 5.72 6.08 6.36 Caffeine 3.20 2.97 2.95 2.94 2.92 Enzyme (U) 0 16.5 16.5 16.5 16.5 DGCE 200 200 200 200 200 (mg/ml) CQAs 51.46 8.90 6.34 4.87 3.91 FQAs 10.93 0.54 0.48 0.44 0.42 di-CQAs 13.19 1.29 1.02 0.58 0.30 CA 0.48 27.26 28.79 29.19 29.90 FA 0.21 4.90 5.72 6.08 6.36 Caffeine 3.18 2.80 2.83 2.79 2.82
Reaction Kinetics as Function of Time

(38) Kinetic studies were performed on decaffeinated green coffee extract (200 mg/ml) using L. johnsonii esterase at concentration of 16.25 U/ml. The reactions were performed in 1 ml reaction volume, at pH 4.5 and 37 C. The kinetics were carried out for 1, 2, 3 and 4 hours. The concentration of the different compounds are in mg/ml.

(39) Reaction Kinetics as Function of Enzyme Concentration

(40) Kinetic studies were performed on decaffeinated green coffee extract (200 mg/ml) using L. johnsonii esterase at different concentrations (5, 10, 15, 25 and 50 l/ml that correspond respectively to 1.65, 3.3, 4.95, 8.25 and 16.5 U/ml). The reactions were performed in 1 ml volume, at pH 4.5 and 37 C. (see FIG. 5). The reactions time was 4 hours. The concentration of the different compounds are in mg/ml.

(41) Pilot Plant Trial

(42) Treatment of Decaffeinated Green Coffee Extract with L. johnsonii Esterase

(43) Decaffeinated green coffee extract (1.76 Kg) was dissolved in water (8.8 Kg) under stirring. The pH was then adjusted to pH 4.5 by addition of chlorohydric acid (HCl, 0.36 Kg). To this solution, 0.024 Kg of enzyme (Esterase from L. johnsonii) was added in two times: 0.016 Kg of enzyme was added at time T=0 h and 0.008 Kg of enzyme was added after 3 h of reaction. The reaction was performed at 37 C. for 6 hours. The mixture was then heated for 10 min at 98 C. to inactive the enzyme. After centrifugation (2 min at 5000 g) and filtration (0.45 m), the mixture was freeze-dried and the resulting powder was used for the preparation of beverages used for clinical study.

(44) UPLC Analysis

(45) The method used to analyze the samples allows the quantitative determination of caffeic acid, chlorogenic acid isomers (5-CQA, 4-CQA, 3-CQA, 4-FQA, 5-FQA, 3,4-diCQA, 3,5-diCQA and 4,5-diCQA) and caffeine in liquid coffee extract and pure soluble coffee, extracted either from roasted or green beans. The samples were centrifuged (5000 g) for 5 min at 15 C. 100 L of the resulting supernatant were added to 900 L of methanol/water (80:20) and filtered on 0.2 m before analysis. The analyses were performed on an UPLC equipped with a pump, a degassing system, a sample injector with injection loop more than 5 L, an photodiode array detector (325 and 275 nm wavelength) and an appropriate data software. The separation of molecules was carried on an ACQUITY UPLC BEH Shield RP 18, 1.7 m, 2.1100 mm, column (from Waters). Mobile phase A was 5% acetonitrile in water with 0.1% phosphoric acid and mobile phase B was 100% acetonitrile with 0.1% phosphoric acid. Flow rate was 0.4 mL/min, column temperature 35 C. and injection volume was 2 L.

(46) Clinical Trial

(47) Primary Objective

(48) The primary objective of the trial was to investigate the efficacy by oral administration of hydrolyzed decaffeinated green coffee rich in phenolic acids in improving endothelial function in healthy volunteers. Endothelial function is defined as the percent change in the internal diameter of the brachial artery during reactive hyperemia relative to baseline (% FMD).

(49) Primary Endpoint

(50) The primary outcome was the average change from baseline (i.e. predose) in % FMD at any time point post treatment. Responses were calculated as the percentage change in brachial artery diameter from baseline

(51) Trial Design for HDGCE

(52) This was a placebo-controlled, double-blind, randomized, single-center, cross-over trial of hydrolyzed green coffee extract in 20 healthy subjects. Subjects were randomly assigned to each group sequence. The trial was performed in one center, and involved 4 days (non-consecutive) treatment period.

(53) Statistical Analyses

(54) The main analysis of the primary endpoint was the difference in change from baseline means of FMD at peak between the different doses of phenolic acid and the control at each time point after the baseline. A difference of 1% was considered clinically relevant and a p-value of less than 0.05 was considered statistically significant.

(55) Description of the Composition

(56) A hydrolyzed green coffee extract containing phenolic acids and at approximately 2% caffeine was used for the trial. In this study, only one dose per day of coffee extract rich in phenolic acids was given to subjects. The decaffeinated green coffee extract, maltodextrin and aroma were wet-mixed and then freeze-dried to ensure homogeneity of the final premix.

(57) The placebo contains only maltodextrin and aroma. The amount of maltodextrin and aroma are similar between the 4 arms to avoid any potential effect of these ingredients on the study outcomes. The table below describes the composition of the four investigational products after freeze-drying (considering 2% residual water following drying).

(58) TABLE-US-00003 TABLE 1 Hydrolyzed green coffee extract (HDGCE) compositions Dose 10 (10 mg of caffeic acid (CA) and Dose 20 Dose 40 ferulic acids (20 mg of (40 mg of Placebo (FA)) CA + FA) CA + FA) Hydrolyzed green 0.0 43.3 86.6 173.1 coffee extract (mg) Maltodextrin DE 21 (mg) 902.5 902.5 902.5 902.5 Strawberry aroma (mg) 47.5 47.5 47.5 47.5 Est. residual water (mg) 19.0 19.9 20.7 22.5 Total mass (mg) 969.0 1013.2 1057.3 1145.6 Est. Energy content 379 373 370 366 (kcal/100 g)

(59) Each dose of investigational product or matching placebo was dissolved in an opaque glass of 200 mL of mineral water at room temperature with lid right before the administration. The investigational product was administered in the morning in fasting conditions.

(60) Disposition of Subjects

(61) 23 subjects were screened and 3 of them were screening failures with violation of inclusion and/or exclusion criteria. All the rest of 20 subjects enrolled to the study continued all 4 visits.

(62) Full Analysis Dataset (Referred to as FAS or ITT for Intention to Treat)

(63) All subjects that were randomized were included in the full analysis. There were a total number of 20 subjects for this dataset. Of which only 42 subjects have data available for the primary analysis.

(64) TABLE-US-00004 TABLE 1 Analysis populations Total Subjects with complete Population subjects baseline FMD data FAS/ITT 20 19 PP 14 14

(65) TABLE-US-00005 TABLE 3 Summary Statistics Change from Baseline FMD time- DOSE point N mean sd median q1 q3 min max Placebo T0 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 T1 20 0.07 2.14 0.55 1.66 1.18 2.51 6.34 T2 19 0.42 2.38 0.07 1.37 1.95 2.78 6.51 T3 20 0.67 2.23 0.48 1.23 2.06 2.78 4.62 T4 20 0.22 1.78 0.09 1.35 1.48 1.96 4.35 T6 20 0.37 1.85 0.24 0.89 0.98 2.82 4.21 Dose 10 T0 19 0.00 0.00 0.00 0.00 0.00 0.00 0.00 T1 19 0.59 1.39 0.17 0.50 1.91 2.15 2.65 T2 19 0.55 1.37 0.53 0.23 1.26 1.41 4.30 T3 19 0.72 2.23 0.77 0.37 1.86 3.57 4.94 T4 19 0.73 1.69 0.87 0.76 1.95 2.36 3.85 T6 19 0.73 1.63 0.67 0.19 1.94 1.99 4.41 Dose 20 T0 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 T1 20 0.09 1.20 0.19 0.77 1.08 2.66 1.68 T2 20 0.98 1.85 1.05 0.04 2.25 3.16 4.21 T3 19 0.91 1.68 1.29 0.62 2.01 2.20 3.65 T4 20 0.66 1.25 0.51 0.15 1.41 1.32 3.07 T6 20 0.08 1.34 0.02 0.90 0.97 2.35 2.31 Dose 40 T0 20 0.00 0.00 0.00 0.00 0.00 0.00 0.00 T1 20 0.90 1.90 0.82 0.64 1.84 2.03 4.71 T2 20 0.66 1.90 0.57 0.43 1.35 2.50 4.68 T3 20 0.68 2.48 0.47 0.82 1.27 3.33 6.36 T4 19 0.39 2.22 0.07 0.87 2.33 3.76 3.88 T6 20 1.48 1.63 1.50 0.58 2.59 2.82 3.67
Results on Endothelial Dysfunction

(66) TABLE-US-00006 TABLE 4 Dose 40 vs Placebo Estimated differences and significance Time Estimate Measurement [hours] [%] difference pvalue FMD AT PEAK 1 1.0129864 0.036782 2 0.3108739 0.52569 3 0.0571364 0.905784 4 0.200163 0.682904 6 1.1531864 0.017608

(67) TABLE-US-00007 TABLE 5 Dose 20 vs Placebo Estimated differences and significance Time Estimate LBTEST [hours] [%] difference pvalue FMD AT PEAK 1 0.1022950 0.8152772 2 0.7160753 0.1079982 3 0.3527904 0.4270130 4 0.5687950 0.1947502 6 0.1622050 0.7110748

(68) TABLE-US-00008 TABLE 6 Dose 10 vs Placebo Estimated differences and significance Time Estimate LBTEST [hours] [%] difference pvalue FMD AT PEAK 1 0.7006669 0.1497409 2 0.2239250 0.6491587 3 0.1003932 0.8361086 4 0.5573011 0.2514995 6 0.4092880 0.3993708

(69) TABLE-US-00009 TABLE 7 FMD iAUC summary statistics for HDGCE me- DOSE N mean sd dian q1 q3 min max Pvalue Placebo 20 1.72 8.22 0.60 4.10 7.23 10.82 22.39 Dose 19 3.69 6.03 4.36 2.03 7.69 10.45 12.83 0.2966 10 Dose 20 2.85 4.99 2.19 0.07 6.09 6.78 14.13 0.5711 20 Dose 20 4.21 8.62 4.56 0.61 8.57 11.58 23.85 0.2147 40

(70) The p-values pertain to comparison of iAUCs of the different doses to the iAUC of Placebo. None of the doses were found to be statistically different from the Placebo and this is likely due to the very high variability observed.

(71) We found out that the 173.1 mg HDGCE dose showed a significant increase of FMD at 1 h (p value=0.036) and 6 h (p value=0.017608) compared with placebo treatment. The increased in FMD at these time points was higher than 1% units of FMD. An improvement of the endothelial dysfunction (1% in flow-mediated dilation value) was associated with a 13% lower risk of cardiovascular events (Inaba et al. (2010) Int J Cardiovas Imaging 26:621-640).

CONCLUSIONS

(72) Statistical significance was observed between 173.1 mg of HDGCE (dose 40) and Placebo at timepoints 1 hour and 6 hours.