Anti-CD33 antibodies, anti-CD33/anti-CD3 bispecific antibodies and uses thereof
11466082 · 2022-10-11
Assignee
Inventors
- Michael Diem (Spring House, PA)
- Francois Gaudet (Princeton, NJ)
- Ronan McDaid (Eagleville, PA)
- Priyanka Nair-Gupta (Spring House, PA, US)
Cpc classification
A61K39/395
HUMAN NECESSITIES
C07K16/468
CHEMISTRY; METALLURGY
C07K2317/14
CHEMISTRY; METALLURGY
C07K16/2809
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/732
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
A61K47/6849
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61P35/00
HUMAN NECESSITIES
A61K47/68
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
Abstract
Anti-CD33 antibodies and antigen-binding fragments thereof and anti-CD33/anti-CD3 bispecific antibodies or antigen-binding fragments thereof are described. Also described are nucleic acids encoding the antibodies, compositions comprising the antibodies, methods of producing the antibodies, and methods of using the antibodies for treating or preventing diseases, such as cancer.
Claims
1. An isolated monoclonal antibody or antigen-binding fragment thereof that specifically binds the C2 domain of human and cynomolgus monkey CD33, wherein the antibody or antigen-binding fragment thereof comprises a heavy chain complementarity determining region 1 (HCDR1), HCDR2, and HCDR3, and a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, comprising the amino acid sequence of: a. SEQ ID NOs:447, 448, 449, 567, 568, and 569, respectively; b. SEQ ID NOs:444, 445, 446, 564, 565, and 566, respectively; c. SEQ ID NOs:354, 355, 356, 477, 478, and 479, respectively; d. SEQ ID NOs:378, 379, 380, 501, 502, and 503, respectively; e. SEQ ID NOs:411, 412, 413, 531, 532, and 533, respectively; f. SEQ ID NOs:348, 349, 350, 471, 472, and 473, respectively; g. SEQ ID NOs:360, 361, 362, 483, 484, and 485, respectively; h. SEQ ID NOs:363, 364, 365, 486, 487, and 488, respectively; i. SEQ ID NOs:366, 367, 368, 489, 490, and 491, respectively; j. SEQ ID NOs:369, 370, 371, 492, 493, and 494, respectively; k. SEQ ID NOs:387, 388, 389, 492, 493, and 494, respectively; l. SEQ ID NOs:402, 403, 404, 522, 523, and 524, respectively; m. SEQ ID NOs:408, 409, 410, 528, 529, and 530, respectively; n. SEQ ID NOs:423, 424, 425, 543, 544, and 545, respectively; or o. SEQ ID NOs:426, 427, 428, 546, 547, and 548, respectively.
2. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, comprising a. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:292, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:332; b. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:291, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:331; c. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:261, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:302; d. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:269, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:310; e. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:280, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:322; f. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:259, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:300; g. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:263, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:304; h. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:264, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:305; i. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:265, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:306; j. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:266, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:307; k. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:272, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:307; l. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:277, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:317; m. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:279, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:319; n. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:284, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:324; or o. a heavy chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:285, and a light chain variable region comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:325.
3. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, comprising: a. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:292, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:332; b. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:291, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:331; c. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:261, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:302; d. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:269, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:310; e. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:280, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:322; f. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:259, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:300; g. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:263, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:304; h. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:264, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:305; i. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:265, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:306; j. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:266, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:307; k. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:272, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:307; l. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:277, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:317; m. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:279, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:319; n. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:284, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:324; or o. a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:285, and a light chain variable region comprising the amino acid sequence of SEQ ID NO:325.
4. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof comprises an IgG1 comprising a low fucose backbone.
5. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof is chimeric.
6. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof is human or humanized.
7. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof is conjugated to a therapeutic agent.
8. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof is a bispecific antibody or antigen-binding fragment.
9. The isolated bispecific antibody or antigen-binding fragment thereof of claim 8, wherein the bispecific antibody or antigen-binding fragment has binding specificity for a first epitope and a second epitope.
10. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 comprise the amino acid sequence of SEQ ID NOs:447, 448, 449, 567, 568, and 569, respectively.
11. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, comprising a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:292 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:332.
12. A pharmaceutical composition, comprising the isolated monoclonal antibody or antigen-binding fragment thereof of claim 1 and a pharmaceutically acceptable carrier.
13. A method of producing a pharmaceutical composition comprising the monoclonal antibody or antigen-binding fragment of claim 1, comprising combining the monoclonal antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
14. An isolated nucleic acid encoding the monoclonal antibody or antigen-binding fragment thereof claim 1.
15. A vector comprising the isolated nucleic acid of claim 1.
16. A host cell comprising the vector of claim 15.
17. A method of producing the monoclonal antibody or antigen-binding fragment thereof of claim 1, comprising culturing a cell comprising a nucleic acid encoding the monoclonal antibody or antigen-binding fragment under conditions to produce the monoclonal antibody or antigen-binding fragment, and recovering the antibody or antigen-binding fragment from the cell or culture.
18. A method of treating cancer in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of claim 12, wherein the isolated monoclonal antibody or a fragment thereof, is a bispecific antibody or fragment thereof, having a binding specificity for human and cynomolgus monkey CD33 and a binding specificity for CD3.
19. The method of claim 18, wherein the cancer is a hematologic cancer.
20. The method of claim 19, wherein the hematologic cancer is a leukemia, a lymphoma, or a multiple myeloma.
21. The method of claim 19, wherein the hematologic cancer is acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), acute lymphocytic leukemia (ALL), diffuse large B-cell lymphoma (DLBCL), chronic myeloid leukemia (CML) or blastic plasmacytoid dendritic cell neoplasm (DPDCN).
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The foregoing summary, as well as the following detailed description of preferred embodiments of the present application, will be better understood when read in conjunction with the appended drawings. It should be understood, however, that the application is not limited to the precise embodiments shown in the drawings.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
DETAILED DESCRIPTION OF THE INVENTION
(27) Various publications, articles and patents are cited or described in the background and throughout the specification; each of these references is herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is for the purpose of providing context for the invention. Such discussion is not an admission that any or all of these matters form part of the prior art with respect to any inventions disclosed or claimed.
(28) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention pertains. Otherwise, certain terms used herein have the meanings as set forth in the specification.
(29) It must be noted that as used herein and in the appended claims, the singular forms “a,” “an,” and “the” include plural reference unless the context clearly dictates otherwise.
(30) Unless otherwise stated, any numerical values, such as a concentration or a concentration range described herein, are to be understood as being modified in all instances by the term “about.” Thus, a numerical value typically includes ±10% of the recited value. For example, a concentration of 1 mg/mL includes 0.9 mg/mL to 1.1 mg/mL. Likewise, a concentration range of 1% to 10% (w/v) includes 0.9% (w/v) to 11% (w/v). As used herein, the use of a numerical range expressly includes all possible subranges, all individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise.
(31) Unless otherwise indicated, the term “at least” preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the invention.
(32) As used herein, the terms “comprises,” “comprising,” “includes,” “including,” “has,” “having,” “contains” or “containing,” or any other variation thereof, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers and are intended to be non-exclusive or open-ended. For example, a composition, a mixture, a process, a method, an article, or an apparatus that comprises a list of elements is not necessarily limited to only those elements but can include other elements not expressly listed or inherent to such composition, mixture, process, method, article, or apparatus. Further, unless expressly stated to the contrary, “or” refers to an inclusive or and not to an exclusive or. For example, a condition A or B is satisfied by any one of the following: A is true (or present) and B is false (or not present), A is false (or not present) and B is true (or present), and both A and B are true (or present).
(33) As used herein, the conjunctive term “and/or” between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by “and/or,” a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or” as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or.”
(34) As used herein, the term “consists of,” or variations such as “consist of” or “consisting of,” as used throughout the specification and claims, indicate the inclusion of any recited integer or group of integers, but that no additional integer or group of integers can be added to the specified method, structure, or composition.
(35) As used herein, the term “consists essentially of,” or variations such as “consist essentially of” or “consisting essentially of,” as used throughout the specification and claims, indicate the inclusion of any recited integer or group of integers, and the optional inclusion of any recited integer or group of integers that do not materially change the basic or novel properties of the specified method, structure or composition. See M.P.E.P. § 2111.03.
(36) As used herein, “subject” means any animal, preferably a mammal, most preferably a human. The term “mammal” as used herein, encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc., more preferably a human.
(37) It should also be understood that the terms “about,” “approximately,” “generally,” “substantially,” and like terms, used herein when referring to a dimension or characteristic of a component of the preferred invention, indicate that the described dimension/characteristic is not a strict boundary or parameter and does not exclude minor variations therefrom that are functionally the same or similar, as would be understood by one having ordinary skill in the art. At a minimum, such references that include a numerical parameter would include variations that, using mathematical and industrial principles accepted in the art (e.g., rounding, measurement or other systematic errors, manufacturing tolerances, etc.), would not vary the least significant digit.
(38) The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences (e.g., anti-CD33 antibodies and polynucleotides that encode them, anti-CD33 anti-CD3 bispecific antibodies and polynucleotides that encode them, CD33 polypeptides, and CD33 polynucleotides that encode them), refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
(39) For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
(40) Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally, Current Protocols in Molecular Biology, F. M. Ausubel el al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement) (Ausubel)).
(41) Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1997) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased.
(42) Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=−4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff& Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).
(43) In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
(44) A further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions, as described below.
(45) Antibodies
(46) The invention generally relates to isolated anti-CD33 antibodies or antigen-binding fragments thereof, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies. The invention additionally relates to isolated anti-CD33/anti-CD3 bispecific antibodies or antigen-binding fragments thereof, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the bispecific antibodies. Methods of making the antibodies, and methods of using the antibodies to treat diseases including cancer are also provided. The antibodies of the invention possess one or more desirable functional properties, including but not limited to high-affinity binding to CD33 and/or CD3, high specificity to CD33 and/or CD3, and the ability to treat or prevent cancer when administered alone or in combination with other anti-cancer therapies.
(47) In a general aspect, the invention relates to isolated monoclonal antibodies or antigen-binding fragments thereof that specifically bind CD33. In certain embodiments, the isolated monoclonal antibodies or antigen-binding fragments thereof bind the C2 domain of CD33. In certain embodiments, the isolated monoclonal antibodies or antigen-binding fragments thereof bind the V domain of CD33.
(48) As used herein, the term “antibody” is used in a broad sense and includes immunoglobulin or antibody molecules including human, humanized, composite and chimeric antibodies and antibody fragments that are monoclonal or polyclonal. In general, antibodies are proteins or peptide chains that exhibit binding specificity to a specific antigen. Antibody structures are well known. Immunoglobulins can be assigned to five major classes (i.e., IgA, IgD, IgE, IgG and IgM), depending on the heavy chain constant domain amino acid sequence. IgA and IgG are further sub-classified as the isotypes IgA1, IgA2, IgG1, IgG2, IgG3 and IgG4. Accordingly, the antibodies of the invention can be of any of the five major classes or corresponding sub-classes. Preferably, the antibodies of the invention are IgG1, IgG2, IgG3 or IgG4. Antibody light chains of vertebrate species can be assigned to one of two clearly distinct types, namely kappa and lambda, based on the amino acid sequences of their constant domains. Accordingly, the antibodies of the invention can contain a kappa or lambda light chain constant domain. According to particular embodiments, the antibodies of the invention include heavy and/or light chain constant regions from rat or human antibodies. In addition to the heavy and light constant domains, antibodies contain an antigen-binding region that is made up of a light chain variable region and a heavy chain variable region, each of which contains three domains (i.e., complementarity determining regions 1-3; CDR1, CDR2, and CDR3). The light chain variable region domains are alternatively referred to as LCDR1, LCDR2, and LCRD3, and the heavy chain variable region domains are alternatively referred to as HCDR1, HCRD2, and HCDR3.
(49) As used herein, the term an “isolated antibody” refers to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to CD33 is substantially free of antibodies that do not bind to CD33). In addition, an isolated antibody is substantially free of other cellular material and/or chemicals.
(50) As used herein, the term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. The monoclonal antibodies of the invention can be made by the hybridoma method, phage display technology, single lymphocyte gene cloning technology, or by recombinant DNA methods. For example, the monoclonal antibodies can be produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, such as a transgenic mouse or rat, having a genome comprising a human heavy chain transgene and a light chain transgene.
(51) As used herein, the term “antigen-binding fragment” refers to an antibody fragment such as, for example, a diabody, a Fab, a Fab′, a F(ab′)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv).sub.2, a bispecific dsFv (dsFv-dsFv′), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), a single domain antibody (sdab) an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure. An antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment binds. According to particular embodiments, the antigen-binding fragment comprises a light chain variable region, a light chain constant region, and an Fd segment of the heavy chain. According to other particular embodiments, the antigen-binding fragment comprises Fab and F(ab′).
(52) As used herein, the term “single-chain antibody” refers to a conventional single-chain antibody in the field, which comprises a heavy chain variable region and a light chain variable region connected by a short peptide of about 15 to about 20 amino acids. As used herein, the term “single domain antibody” refers to a conventional single domain antibody in the field, which comprises a heavy chain variable region and a heavy chain constant region or which comprises only a heavy chain variable region.
(53) As used herein, the term “human antibody” refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide.
(54) As used herein, the term “humanized antibody” refers to a non-human antibody that is modified to increase the sequence homology to that of a human antibody, such that the antigen-binding properties of the antibody are retained, but its antigenicity in the human body is reduced.
(55) As used herein, the term “chimeric antibody” refers to an antibody wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species. The variable region of both the light and heavy chains often corresponds to the variable region of an antibody derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) having the desired specificity, affinity, and capability, while the constant regions correspond to the sequences of an antibody derived from another species of mammal (e.g., human) to avoid eliciting an immune response in that species.
(56) As used herein, the term “multispecific antibody” refers to an antibody that comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope. In an embodiment, the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein). In an embodiment, the first and second epitopes overlap or substantially overlap. In an embodiment, the first and second epitopes do not overlap or do not substantially overlap. In an embodiment, the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein). In an embodiment, a multispecific antibody comprises a third, fourth, or fifth immunoglobulin variable domain. In an embodiment, a multispecific antibody is a bispecific antibody molecule, a trispecific antibody molecule, or a tetraspecific antibody molecule.
(57) As used herein, the term “bispecific antibody” refers to a multispecific antibody that binds no more than two epitopes or two antigens. A bispecific antibody is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope. In an embodiment, the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein). In an embodiment, the first and second epitopes overlap or substantially overlap. In an embodiment, the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein). In an embodiment, a bispecific antibody comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope. In an embodiment, a bispecific antibody comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope. In an embodiment, a bispecific antibody comprises a scFv, or fragment thereof, having binding specificity for a first epitope, and a scFv, or fragment thereof, having binding specificity for a second epitope. In an embodiment, the first epitope is located on CD33 and the second epitope is located on CD3. In an embodiment, the first epitope is located on CD33 and the second epitope is located on PD-1, PD-L1, LAG-3, TIM-3, CTLA-4, EGFR, HER-2, CD19, CD20, CD3 and/or other tumor associated immune suppressors or surface antigens.
(58) As used herein, the term “CD33” refers to a 67 kD single pass transmembrane glycoprotein, which is a member of the sialic acid-binding immunoglobulin-like lectins (Siglecs) family. CD33 is also known as Siglec-3, gp67, or p67. The structure of CD33 consists of an amino-terminal V-set Ig-like domain (coded by exon 2 of CD33) that mediates sialic acid binding and a C2-set IG-like domain (coded by exon 4) in its extracellular portion (Laszlo et al., 2016). Alternative splicing of CD33 RNA can lead to a shorter isoform that is expressed on the cell surface, which lacks the V- but retains the C2-set Ig-like domain (Laszlo, Estey, & Walter, 2014; Laszlo et al., 2016). The biological relevance of this splicing process was largely unknown until recent studies showed that a single nucleotide polymorphism (SNP) rs12459419 was present in ˜50% of the AML population and leads to skipping of exon 2 of CD33 which results in the deletion of the V domain of CD33 (Lamba et al., 2017). The full length human CD33 is provided by Uniprot P20138 (SEQ ID NO:1).
(59) As used herein, an antibody that “specifically binds to CD33” refers to an antibody that binds to a CD33, preferably a human CD33, preferably the C2 domain of CD33, with a KD of 1×10.sup.−7 M or less, preferably 1×10.sup.−8 M or less, more preferably 5×10.sup.−9 M or less, 1×10.sup.−9 M or less, 5×10.sup.−10 M or less, or 1×10.sup.−10 M or less. The term “KD” refers to the dissociation constant, which is obtained from the ratio of Kd to Ka (i.e., Kd/Ka) and is expressed as a molar concentration (M). KD values for antibodies can be determined using methods in the art in view of the present disclosure. For example, the KD of an antibody can be determined by using surface plasmon resonance, such as by using a biosensor system, e.g., a BIACORE® system, or by using bio-layer interferometry technology, such as an OCTET® RED96 system.
(60) The smaller the value of the KD of an antibody, the higher affinity that the antibody binds to a target antigen.
(61) According to a particular aspect, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), a HCDR2, a HCDR3, a light chain complementarity determining region 1 (LCDR1), a LCDR2, and a LCDR3, having the polypeptide sequences of: a. SEQ ID NOs:447, 448, 449, 567, 568, and 569, respectively; b. SEQ ID NOs:444, 445, 446, 564, 565, and 566, respectively; c. SEQ ID NOs:354, 355, 356, 477, 478, and 479, respectively; d. SEQ ID NOs:378, 379, 380, 501, 502, and 503, respectively; e. SEQ ID NOs:411, 412, 413, 531, 532, and 533, respectively; f. SEQ ID NOs:348, 349, 350, 471, 472, and 473, respectively; g. SEQ ID NOs:360, 361, 362, 483, 484, and 485, respectively; h. SEQ ID NOs:363, 364, 365, 486, 487, and 488, respectively; i. SEQ ID NOs:366, 367, 368, 489, 490, and 491, respectively; j. SEQ ID NOs:369, 370, 371, 492, 493, and 494, respectively; k. SEQ ID NOs:387, 388, 389, 492, 493, and 494, respectively; l. SEQ ID NOs:402, 403, 404, 522, 523, and 524, respectively; m. SEQ ID NOs:408, 409, 410, 528, 529, and 530, respectively; n. SEQ ID NOs:423, 424, 425, 543, 544, and 545, respectively; o. SEQ ID NOs:426, 427, 428, 546, 547, and 548, respectively; p. SEQ ID NOs:351, 352, 353, 474, 475, and 476, respectively; q. SEQ ID NOs:357, 358, 359, 480, 481, and 482, respectively; r. SEQ ID NOs:372, 373, 374, 495, 496, and 497, respectively; s. SEQ ID NOs:375, 376, 377, 498, 499, and 500, respectively; t. SEQ ID NOs:381, 382, 383, 504, 505, and 506, respectively; u. SEQ ID NOs:384, 385, 386, 507, 508, and 509, respectively; v. SEQ ID NOs:390, 391, 392, 510, 511, and 512, respectively; w. SEQ ID NOs:393, 394, 395, 513, 514, and 515, respectively; x. SEQ ID NOs:396, 397, 398, 516, 517, and 518, respectively; y. SEQ ID NOs:399, 400, 401, 519, 520, and 521, respectively; z. SEQ ID NOs:405, 406, 407, 525, 526, and 527, respectively; aa. SEQ ID NOs:414, 415, 416, 534, 535, and 536, respectively; bb. SEQ ID NOs:417, 418, 419, 537, 538, and 539, respectively; cc. SEQ ID NOs:420, 421, 422, 540, 541, and 542, respectively; dd. SEQ ID NOs:429, 430, 431, 549, 550, and 551, respectively; ee. SEQ ID NOs:432, 433, 434, 552, 553, and 554, respectively; ff. SEQ ID NOs:435, 436, 437, 555, 556, and 557, respectively; gg. SEQ ID NOs:438, 439, 440, 558, 559, and 560, respectively; hh. SEQ ID NOs:441, 442, 443, 561, 562, and 563, respectively; ii. SEQ ID NOs:450, 451, 452, 570, 571, and 572, respectively; jj SEQ ID NOs:453, 454, 455, 573, 574, and 575, respectively; kk. SEQ ID NOs:456, 457, 458, 576, 577, and 578, respectively; ll. SEQ ID NOs:459, 460, 461, 579, 580, and 581, respectively; mm. SEQ ID NOs:378, 379, 380, 582, 583, and 584, respectively; nn. SEQ ID NOs:414, 415, 416, 585, 586, and 587, respectively; or oo. SEQ ID NOs:429, 430, 431, 480, 481, and 482, respectively;
wherein the antibody or antigen-binding fragment thereof specifically binds CD33, preferably human CD33.
(62) According to another particular aspect, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOs:259-296, or a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOs:300-338. According to one preferred embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof of the invention comprises a heavy chain variable region having the polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOs:259-296, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOs:300-338, respectively.
(63) According to another particular aspect, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, comprising: a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:292, and a light chain variable region having the polypeptide sequence of SEQ ID NO:332; b. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:291, and a light chain variable region having the polypeptide sequence of SEQ ID NO:331; c. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:261, and a light chain variable region having the polypeptide sequence of SEQ ID NO:302; d. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:310; e. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:280, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; f. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:259, and a light chain variable region having the polypeptide sequence of SEQ ID NO:300; g. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:263, and a light chain variable region having the polypeptide sequence of SEQ ID NO:304; h. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:264, and a light chain variable region having the polypeptide sequence of SEQ ID NO:305; i. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:265, and a light chain variable region having the polypeptide sequence of SEQ ID NO:306; j. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:266, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; k. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:272, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; l. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:277, and a light chain variable region having the polypeptide sequence of SEQ ID NO:317; m. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:279, and a light chain variable region having the polypeptide sequence of SEQ ID NO:319; n. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:284, and a light chain variable region having the polypeptide sequence of SEQ ID NO:324; o. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:285, and a light chain variable region having the polypeptide sequence of SEQ ID NO:325; p. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:260, and a light chain variable region having the polypeptide sequence of SEQ ID NO:301; q. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:262, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303; r. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:267, and a light chain variable region having the polypeptide sequence of SEQ ID NO:308; s. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:268, and a light chain variable region having the polypeptide sequence of SEQ ID NO:309; t. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:270, and a light chain variable region having the polypeptide sequence of SEQ ID NO:311; u. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:271, and a light chain variable region having the polypeptide sequence of SEQ ID NO:312; v. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:273, and a light chain variable region having the polypeptide sequence of SEQ ID NO:313; w. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:274, and a light chain variable region having the polypeptide sequence of SEQ ID NO:314; x. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:275, and a light chain variable region having the polypeptide sequence of SEQ ID NO:315; y. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:276, and a light chain variable region having the polypeptide sequence of SEQ ID NO:316; z. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:278, and a light chain variable region having the polypeptide sequence of SEQ ID NO:318; aa. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:321; bb. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:282, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; cc. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:283, and a light chain variable region having the polypeptide sequence of SEQ ID NO:323; dd. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:326; ee. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:287, and a light chain variable region having the polypeptide sequence of SEQ ID NO:327; ff. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:288, and a light chain variable region having the polypeptide sequence of SEQ ID NO:328; gg. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:289, and a light chain variable region having the polypeptide sequence of SEQ ID NO:329; hh. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:290, and a light chain variable region having the polypeptide sequence of SEQ ID NO:330; ii. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:293, and a light chain variable region having the polypeptide sequence of SEQ ID NO:333; jj. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:294, and a light chain variable region having the polypeptide sequence of SEQ ID NO:334; kk. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:295, and a light chain variable region having the polypeptide sequence of SEQ ID NO:335; ll. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:296, and a light chain variable region having the polypeptide sequence of SEQ ID NO:336; mm. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:337; nn. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:338; or oo. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303.
(64) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:348, 349, 350, 471, 472, and 473, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:259, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:300. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:259; and a light chain variable region having the polypeptide sequence of SEQ ID NO:300.
(65) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:351, 352, 353, 474, 475, and 476, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:260, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:301. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:260; and a light chain variable region having the polypeptide sequence of SEQ ID NO:301.
(66) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:354, 355, 356, 477, 478, and 479, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:261, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:302. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:261; and a light chain variable region having the polypeptide sequence of SEQ ID NO:301.
(67) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:357, 358, 359, 480, 481, and 482, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:262, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:303. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:262; and a light chain variable region having the polypeptide sequence of SEQ ID NO:303.
(68) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:360, 361, 362, 483, 484, and 485, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:263, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:304. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:263; and a light chain variable region having the polypeptide sequence of SEQ ID NO:304.
(69) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:363, 364, 365, 486, 487, and 488, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:264, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:305. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:264; and a light chain variable region having the polypeptide sequence of SEQ ID NO:305.
(70) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:366, 367, 368, 489, 490, and 491, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:265, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:306. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:265; and a light chain variable region having the polypeptide sequence of SEQ ID NO:306.
(71) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:369, 370, 371, 492, 493, and 494, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99/o identical to SEQ ID NO:266, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:307. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:266; and a light chain variable region having the polypeptide sequence of SEQ ID NO:307.
(72) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:372, 373, 374, 495, 496, and 497, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:267, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:308. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:267; and a light chain variable region having the polypeptide sequence of SEQ ID NO:308.
(73) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:375, 376, 377, 498, 499, and 500, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:268, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:309. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID N0:268; and a light chain variable region having the polypeptide sequence of SEQ ID NO:309.
(74) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:378, 379, 380, 501, 502, and 503, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:269, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:310. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269; and a light chain variable region having the polypeptide sequence of SEQ ID NO:310.
(75) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:381, 382, 383, 504, 505, and 506, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:270, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:311. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:270; and a light chain variable region having the polypeptide sequence of SEQ ID NO:311.
(76) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:384, 385, 386, 507, 508, and 509, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:271, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:312. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:271; and a light chain variable region having the polypeptide sequence of SEQ ID NO:312.
(77) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:387, 388, 389, 492, 493, and 494, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:272, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:307. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:272; and a light chain variable region having the polypeptide sequence of SEQ ID NO:307.
(78) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:390, 391, 392, 510, 511, and 512, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:273, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99/a identical to SEQ ID NO:313. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:273; and a light chain variable region having the polypeptide sequence of SEQ ID NO:313.
(79) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:393, 394, 395, 513, 54, and 515, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:274, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:314. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:274; and a light chain variable region having the polypeptide sequence of SEQ ID NO:314.
(80) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:396, 397, 398, 516, 517, and 518, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:275, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:315. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:275; and a light chain variable region having the polypeptide sequence of SEQ ID NO:315.
(81) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:399, 400, 401, 519, 520, and 521, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:276, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:316. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:276; and a light chain variable region having the polypeptide sequence of SEQ ID NO:316.
(82) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:402, 403, 404, 522, 523, and 524, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:277, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:317. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:277; and a light chain variable region having the polypeptide sequence of SEQ ID NO:317.
(83) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:405, 406, 407, 525, 526, and 527, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:278, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:318. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:278; and a light chain variable region having the polypeptide sequence of SEQ ID NO:318.
(84) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:408, 409, 410, 528, 529, and 530, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:279, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:319. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:279; and a light chain variable region having the polypeptide sequence of SEQ ID NO:319.
(85) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:411, 412, 413, 531, 532, and 533, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:280, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99/o identical to SEQ ID NO:320. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:280; and a light chain variable region having the polypeptide sequence of SEQ ID NO:320.
(86) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:414, 415, 416, 534, 535, and 536, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:281, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:321. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281; and a light chain variable region having the polypeptide sequence of SEQ ID NO:321.
(87) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:417, 418, 419, 537, 538, and 539, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:282, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:322. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:282; and a light chain variable region having the polypeptide sequence of SEQ ID NO:322.
(88) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:420, 421, 422, 540, 541, and 542, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:283, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:323. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:283; and a light chain variable region having the polypeptide sequence of SEQ ID NO:323.
(89) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:423, 424, 425, 543, 544, and 545, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:284, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:324. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:284; and a light chain variable region having the polypeptide sequence of SEQ ID NO:324.
(90) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:426, 427, 428, 546, 547, and 548, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99/a identical to SEQ ID NO:285, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:325. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:285; and a light chain variable region having the polypeptide sequence of SEQ ID NO:325.
(91) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:429, 430, 431, 549, 550, and 551, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:286, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:326. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286; and a light chain variable region having the polypeptide sequence of SEQ ID NO:326.
(92) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:432, 433, 434, 552, 553, and 554, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:287, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90°%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:327. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID N0:287; and a light chain variable region having the polypeptide sequence of SEQ ID NO:327.
(93) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:435, 436, 437, 555, 556, and 557, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:288, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:328. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:288; and a light chain variable region having the polypeptide sequence of SEQ ID NO:328.
(94) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:438, 439, 440, 558, 559, and 560, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:289, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:329. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:289; and a light chain variable region having the polypeptide sequence of SEQ ID NO:329.
(95) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:441, 442, 443, 561, 562, and 563, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:290, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:330. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:290; and a light chain variable region having the polypeptide sequence of SEQ ID NO:330.
(96) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:444, 445, 446, 564, 565, and 566, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:291, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:331. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:291; and a light chain variable region having the polypeptide sequence of SEQ ID NO:331.
(97) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:447, 448, 449, 567, 568, and 569, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:292, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99/a identical to SEQ ID NO:332. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:292; and a light chain variable region having the polypeptide sequence of SEQ ID NO:332.
(98) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:450, 451, 452, 570, 571, and 572, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:293, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:333. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:293; and a light chain variable region having the polypeptide sequence of SEQ ID NO:333.
(99) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:453, 454, 455, 573, 574, and 575, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:294, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:334. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:294; and a light chain variable region having the polypeptide sequence of SEQ ID NO:334.
(100) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:456, 457, 458, 576, 577, and 578, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:295, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:335. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:295; and a light chain variable region having the polypeptide sequence of SEQ ID NO:335.
(101) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:459, 460, 461, 579, 580, and 581, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:296, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:336. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:296; and a light chain variable region having the polypeptide sequence of SEQ ID NO:336.
(102) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:378, 379, 380, 582, 583, and 584, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:269, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:337. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269; and a light chain variable region having the polypeptide sequence of SEQ ID NO:337.
(103) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:414, 415, 416, 585, 586, and 587, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:281, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:338. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281; and a light chain variable region having the polypeptide sequence of SEQ ID NO:338.
(104) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:429, 430, 431, 480, 481, and 482, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:286, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99/o identical to SEQ ID NO:303. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286; and a light chain variable region having the polypeptide sequence of SEQ ID NO:303.
(105) Also provided herein are anti-CD33/anti-CD3 bispecific antibodies or antigen-binding fragments thereof comprising an anti-CD33 antibody or an antigen-binding fragment thereof and an anti-CD3 antibody or antigen-binding fragment thereof. In certain embodiments, the anti-CD33 antibody or antigen-binding fragment thereof is an anti-CD33 monoclonal antibody or antigen-binding fragment thereof of the invention and the anti-CD3 antibody or antigen-binding fragment thereof comprises a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, having the polypeptide sequence of (1) SEQ ID NOs:342, 343, 344, 465, 466, and 467, respectively, or (2) SEQ ID NOs:345, 346, 347, 468, 469, and 470, respectively.
(106) The term “CD3” refers to the CD3 protein multi-subunit complex. CD3 can also be referred to as “cluster of differentiation 3.” The CD3 protein multi-subunit complex is composed of six (6) distinctive polypeptide chains, which include a CD3γ chain (SwissProt P09693) (SEQ ID NO:588), a CD36 chain (SwissProt P04234) (SEQ ID NO:589), two CD3ε chains (SwissProt P07766) (SEQ ID NO:590), and one CD3ζ chain homodimer (SwissProt 20963) (SEQ ID NO:591), which is associated with the T cell receptor α and β chain. CD3 is a T cell co-receptor that functions to activate both the cytotoxic T cell (CD8+ naïve T cells) and also the T helper cells (CD4+ naïve T cells). The CD3γ, CD3δ, and CD3ε polypeptide chains of the CD3 multi-subunit complex associate with the T-cell receptor (TCR) and the CD3ζ chain to generate an activation signal in T lymphocytes, and the interaction between CD3 and the T-cell receptor constitutes the TCR complex. The term “CD3” includes any CD3 variant, isoform, and species homolog, which is naturally expressed by cells (including T cells) or can be expressed on cells transfected with genes or cDNA encoding those polypeptides, unless noted, preferably the “CD3” is a human CD3 protein multi-subunit complex. The redirection of T-lymphocytes to cancer cells expressing CD33 via the TCR/CD3 complex represents an attractive alternative treatment approach. The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha (α)/beta (β) or TCR gamma (γ)/delta (6) heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma (γ), delta (δ), epsilon (ε), zeta (ζ) and eta (η). Human CD3ε is described under UniProt P07766 (CD3E_HUMAN). An anti CD3ε antibody described in the state of the art is SP34 (Yang S J, The Journal of Immunology (1986) 137: 1097-1100), which reacts with both primate and human CD3 and is available commercially from Pharmingen. Additional anti-CD3 antibodies described in the state of the art include, UCHT-1 (see WO2000041474) and BC-3 (Fred Hutchinson Cancer Research Institute; used in Phase I/II trials of GvHD, Anasetti et al., Transplantation 54: 844 (1992)). SP34 differs from UCHT-1 and BC-3 in that SP-34 recognizes an epitope present on solely the ε chain of CD3 (see Salmeron et al., (1991) J. Immunol. 147: 3047) whereas UCHT-1 and BC-3 recognize an epitope contributed by both the ε and γ chains. Antibody sequences with the same sequence as SP34 are described at least in WO2008119565, WO2008119566, WO2008119567, WO2010037836, WO2010037837 and WO2010037838. An antibody sequence that is 96% identical to the SP34 VH is described in U.S. Pat. No. 8,236,308 (WO2007042261)
(107) Different formats of bispecific antibodies have been described and were recently reviewed by Chames and Baty (2009) Curr Opin Drug Disc Dev 12: 276.
(108) In some embodiments, the bispecific antibody of the present invention is a diabody, a cross-body, or a bispecific antibody obtained via a controlled Fab arm exchange as those described in the present invention.
(109) In some embodiments, the bispecific antibodies include IgG-like molecules with complementary CH3 domains to force heterodimerisation; recombinant IgG-like dual targeting molecules, wherein the two sides of the molecule each contain the Fab fragment or part of the Fab fragment of at least two different antibodies; IgG fusion molecules, wherein full length IgG antibodies are fused to an extra Fab fragment or parts of Fab fragment; Fc fusion molecules, wherein single chain Fv molecules or stabilized diabodies are fused to heavy-chain constant-domains, Fc-regions or parts thereof; Fab fusion molecules, wherein different Fab-fragments are fused together; ScFv- and diabody-based and heavy chain antibodies (e.g., domain antibodies, nanobodies) wherein different single chain Fv molecules or different diabodies or different heavy-chain antibodies (e.g. domain antibodies, nanobodies) are fused to each other or to another protein or carrier molecule.
(110) In some embodiments, IgG-like molecules with complementary CH3 domains molecules include the TRIOMAB™/QUADROMA™ (TRION PHARMA™/FRESENIUS BIOTECH™), the Knobs-into-Holes (GENENTECH®), CrossMAbs (ROCHE®) and the electrostatically-matched (AMGEN®), the LUZ-Y (GENENTECH®), the Strand Exchange Engineered Domain body (SEEDbodyxEMD SERONO®), the BICLONIC™ (MERUS®) and the DUOBODY® (GENMAB® A/S).
(111) In some embodiments, recombinant IgG-like dual targeting molecules include Dual Targeting (DT)-Ig (GSK®/DOMANTIS™), Two-in-one Antibody (GENENTECH®), Cross-linked Mabs (KARMANOS CANCER CENTER®), mAb2 (F-STAR®) and CovX-body (COVX™/PFIZER®).
(112) In some embodiments, IgG fusion molecules include Dual Variable Domain (DVD)-Ig (ABBOTT®), IgG-like Bispecific (InnClone/ELI LILLY®), Ts2Ab (MEDIMMUNE®/ASTRAZENECA®) and BsAb (ZYMOGENETICS®), HERCULES (BIOGEN IDEC™) and TvAb (ROCHE®).
(113) In some embodiments, Fc fusion molecules include to ScFv/Fc Fusions (Academic Institution), SCORPION (EMERGENT BIOSOLUTIONS®/TRUBION™, ZYMOGENETICS®/BRISTOL-MYERS SQUIBB®), Dual Affinity Retargeting Technology (FC-DART®) (MACROGENETICS™) and Dual (ScFv).sub.2-Fab (NATIONAL RESEARCH CENTER FOR ANTIBODY MEDICINE™—China).
(114) In some embodiments, Fab fusion bispecific antibodies include F(ab)2 (MEDAREX™/AMGEN®), Dual-Action or Bis-Fab (GENENTECH®), DOCK-AND-LOCK™ (DNL™) (IMMUNOMEDICS®), Bivalent Bispecific (BIOTECNOL™) and Fab-Fv (UCB-CELLTECH™). ScFv-, diabody-based and domain antibodies include but are not limited to Bispecific T Cell Engager (BiTE) (MICROMET™), Tandem Diabody (TANDAB™) (AFFIRMED™), Dual Affinity Retargeting Technology (DART®) (MACROGENETICS™), Single-chain Diabody (Academic), TCR-like Antibodies (AIT, ReceptorLogics), Human Serum Albumin ScFv Fusion (MERRIMACK™) and COMBODY (EPIGEN BIOTECH®), dual targeting nanobodies (ABLYNX®), dual targeting heavy chain only domain antibodies.
(115) Full length bispecific antibodies of the invention may be generated for example using Fab arm exchange (or half molecule exchange) between two mono specific bivalent antibodies by introducing substitutions at the heavy chain CH3 interface in each half molecule to favor heterodimer formation of two antibody half molecules having distinct specificity either in vitro in cell-free environment or using co-expression. The Fab arm exchange reaction is the result of a disulfide-bond isomerization reaction and dissociation-association of CH3 domains. The heavy-chain disulfide bonds in the hinge regions of the parent mono specific antibodies are reduced. The resulting free cysteines of one of the parent monospecific antibodies form an inter heavy-chain disulfide bond with cysteine residues of a second parent mono specific antibody molecule and simultaneously CH3 domains of the parent antibodies release and reform by dissociation-association. The CH3 domains of the Fab arms may be engineered to favor heterodimerization over homodimerization. The resulting product is a bispecific antibody having two Fab arms or half molecules which each bind a distinct epitope, i.e. an epitope on CD33 and an epitope on CD3.
(116) “Homodimerization” as used herein refers to an interaction of two heavy chains having identical CH3 amino acid sequences. “Homodimer” as used herein refers to an antibody having two heavy chains with identical CH3 amino acid sequences.
(117) “Heterodimerization” as used herein refers to an interaction of two heavy chains having non-identical CH3 amino acid sequences. “Heterodimer” as used herein refers to an antibody having two heavy chains with non-identical CH3 amino acid sequences.
(118) The “knob-in-hole” strategy (see, e.g., PCT Inti. Publ. No. WO 2006/028936) may be used to generate full length bispecific antibodies. Briefly, selected amino acids forming the interface of the CH3 domains in human IgG can be mutated at positions affecting CH3 domain interactions to promote heterodimer formation. An amino acid with a small side chain (hole) is introduced into a heavy chain of an antibody specifically binding a first antigen and an amino acid with a large side chain (knob) is introduced into a heavy chain of an antibody specifically binding a second antigen. After co-expression of the two antibodies, a heterodimer is formed as a result of the preferential interaction of the heavy chain with a “hole” with the heavy chain with a “knob”. Exemplary CH3 substitution pairs forming a knob and a hole are (expressed as modified position in the first CH3 domain of the first heavy chain/modified position in the second CH3 domain of the second heavy chain): T366Y/F405A, T366W/F405W, F405W/Y407A, T394W/Y407T, T394S/Y407A, T366W/T394S, F405W/T394S and T366W/T366S_L368A_Y407V.
(119) Other strategies such as promoting heavy chain heterodimerization using electrostatic interactions by substituting positively charged residues at one CH3 surface and negatively charged residues at a second CH3 surface may be used, as described in US Pat. Publ. No. US2010/0015133; US Pat. Publ. No. US2009/0182127; US Pat. Publ. No. US2010/028637 or US Pat. Publ. No. US2011/0123532. In other strategies, heterodimerization may be promoted by the following substitutions (expressed as modified position in the first CH3 domain of the first heavy chain/modified position in the second CH3 domain of the second heavy chain): L351Y_F405A_Y407V/T394W, T366I_K392M_T394W/F405A_Y407V, T366L_K392M_T394W/F405A_Y407V, L351Y_Y407A/T366A_K409F, L351Y_Y407A/T366V K409F Y407A/T366A_K409F, or T350V_L351Y_F405A_Y407V/T350V_T366L_K392L_T394W as described in U.S. Pat. Publ. No. US2012/0149876 or U.S. Pat. Publ. No. US2013/0195849.
(120) In addition to methods described above, bispecific antibodies of the invention may be generated in vitro in a cell-free environment by introducing asymmetrical mutations in the CH3 regions of two mono specific homodimeric antibodies and forming the bispecific heterodimeric antibody from two parent monospecific homodimeric antibodies in reducing conditions to allow disulfide bond isomerization according to methods described in Inti. Pat. Publ. No. WO2011/131746. In the methods, the first monospecific bivalent antibody (e.g., anti-CD33 antibody) and the second monospecific bivalent antibody (e.g., anti-CD3 antibody) are engineered to have certain substitutions at the CH3 domain that promotes heterodimer stability; the antibodies are incubated together under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide bond isomerization; thereby generating the bispecific antibody by Fab arm exchange. The incubation conditions may optimally be restored to non-reducing conditions. Exemplary reducing agents that may be used are 2-mercaptoethylamine (2-MEA), dithiothreitol (DTT), dithioerythritol (DTE), glutathione, tris (2-carboxyethyl) phosphine (TCEP), L-cysteine and beta-mercaptoethanol, preferably a reducing agent selected from the group consisting of: 2-mercaptoethylamine, dithiothreitol and tris (2-carboxyethyl) phosphine. For example, incubation for at least 90 min at a temperature of at least 20° C. in the presence of at least 25 mM 2-MEA or in the presence of at least 0.5 mM dithiothreitol at a pH from 5-8, for example at pH of 7.0 or at pH of 7.4 may be used.
(121) In certain embodiments, the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, having the polypeptide sequence of: a. SEQ ID NOs:447, 448, 449, 567, 568, and 569, respectively; b. SEQ ID NOs:444, 445, 446, 564, 565, and 566, respectively; c. SEQ ID NOs:354, 355, 356, 477, 478, and 479, respectively; d. SEQ ID NOs:378, 379, 380, 501, 502, and 503, respectively; e. SEQ ID NOs:411, 412, 413, 531, 532, and 533, respectively; f. SEQ ID NOs:348, 349, 350, 471, 472, and 473, respectively; g. SEQ ID NOs:360, 361, 362, 483, 484, and 485, respectively; h. SEQ ID NOs:363, 364, 365, 486, 487, and 488, respectively; i. SEQ ID NOs:366, 367, 368, 489, 490, and 491, respectively; j. SEQ TD NOs:369, 370, 371, 492, 493, and 494, respectively; k. SEQ ID NOs:387, 388, 389, 492, 493, and 494, respectively; l. SEQ ID NOs:402, 403, 404, 522, 523, and 524, respectively; m. SEQ ID NOs:408, 409, 410, 528, 529, and 530, respectively; n. SEQ ID NOs:423, 424, 425, 543, 544, and 545, respectively; o. SEQ ID NOs:426, 427, 428, 546, 547, and 548, respectively; p. SEQ ID NOs:357, 358, 359, 480, 481, and 482, respectively; q. SEQ ID NOs:372, 373, 374, 495, 496, and 497, respectively; r. SEQ ID NOs:375, 376, 377, 498, 499, and 500, respectively; s. SEQ TD NOs:381, 382, 383, 504, 505, and 506, respectively; t. SEQ ID NOs:384, 385, 386, 507, 508, and 509, respectively; u. SEQ ID NOs:390, 391, 392, 510, 511, and 512, respectively; v. SEQ ID NOs:393, 394, 395, 513, 514, and 515, respectively; w. SEQ ID NOs:396, 397, 398, 516, 517, and 518, respectively; x. SEQ TD NOs:399, 400, 401, 519, 520, and 521, respectively; y. SEQ ID NOs:405, 406, 407, 525, 526, and 527, respectively; z. SEQ ID NOs:414, 415, 416, 534, 535, and 536, respectively; aa. SEQ ID NOs:417, 418, 419, 537, 538, and 539, respectively; bb. SEQ ID NOs:420, 421, 422, 540, 541, and 542, respectively; cc. SEQ ID NOs:429, 430, 431, 549, 550, and 551, respectively; dd. SEQ ID NOs:432, 433, 434, 552, 553, and 554, respectively; ee. SEQ ID NOs:435, 436, 437, 555, 556, and 557, respectively; ff. SEQ ID NOs:438, 439, 440, 558, 559, and 560, respectively; gg. SEQ ID NOs:441, 442, 443, 561, 562, and 563, respectively; hh. SEQ ID NOs:450, 451, 452, 570, 571, and 572, respectively; ii. SEQ ID NOs:453, 454, 455, 573, 574, and 575, respectively; jj. SEQ ID NOs:456, 457, 458, 576, 577, and 578, respectively; kk. SEQ ID NOs:459, 460, 461, 579, 580, and 581, respectively; ll. SEQ ID NOs:378, 379, 380, 582, 583, and 584, respectively; mm. SEQ ID NOs:414, 415, 416, 585, 586, and 587, respectively; or nn. SEQ ID NOs:429, 430, 431, 480, 481, and 482, respectively;
and the anti-CD3 antibody or antigen-binding fragment thereof comprises a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, having the polypeptide sequence of: 1) SEQ ID NOs: 342, 343, 344, 465, 466, and 467, respectively; or 2) SEQ ID NOs: 345, 346, 347, 468, 469, and 470, respectively.
(122) In certain embodiments, the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOs:259-296, or a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to one of SEQ ID NOs:300-338; and the anti-CD3 antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:257 or 258, or a light chain variable region having a polypeptide sequence at least 85%, preferably 90°%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:298 or 299.
(123) In certain embodiments, the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof comprises: a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:292, and a light chain variable region having the polypeptide sequence of SEQ ID NO:332; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; b. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:291, and a light chain variable region having the polypeptide sequence of SEQ ID NO:331; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; c. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:261, and a light chain variable region having the polypeptide sequence of SEQ ID NO:302; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; d. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:310; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; e. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:280, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; f. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:259, and a light chain variable region having the polypeptide sequence of SEQ ID NO:300; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; g. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:263, and a light chain variable region having the polypeptide sequence of SEQ ID NO:304; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; h. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:264, and a light chain variable region having the polypeptide sequence of SEQ ID NO:305; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; i. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:265, and a light chain variable region having the polypeptide sequence of SEQ ID NO:306; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; j. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:266, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; k. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:272, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; l. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:277, and a light chain variable region having the polypeptide sequence of SEQ ID NO:317; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; m. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:279, and a light chain variable region having the polypeptide sequence of SEQ ID NO:319; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; n. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:284, and a light chain variable region having the polypeptide sequence of SEQ ID NO:324; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; o. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:285, and a light chain variable region having the polypeptide sequence of SEQ ID NO:325; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; p. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:260, and a light chain variable region having the polypeptide sequence of SEQ ID NO:301; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; q. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:262, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; r. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:267, and a light chain variable region having the polypeptide sequence of SEQ ID NO:308; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; s. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:268, and a light chain variable region having the polypeptide sequence of SEQ ID NO:309; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; t. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:270, and a light chain variable region having the polypeptide sequence of SEQ ID NO:311; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; u. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:271, and a light chain variable region having the polypeptide sequence of SEQ ID NO:312; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; v. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:273, and a light chain variable region having the polypeptide sequence of SEQ ID NO:313; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; w. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:274, and a light chain variable region having the polypeptide sequence of SEQ ID NO:314; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; x. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:275, and a light chain variable region having the polypeptide sequence of SEQ ID NO:315; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; y. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:276, and a light chain variable region having the polypeptide sequence of SEQ ID NO:316; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; z. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:278, and a light chain variable region having the polypeptide sequence of SEQ ID NO:318; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; aa. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:321; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; bb. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:282, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; cc. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:283, and a light chain variable region having the polypeptide sequence of SEQ ID NO:323; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; dd. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:326; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; ee. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:287, and a light chain variable region having the polypeptide sequence of SEQ ID NO:327; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; ff. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:288, and a light chain variable region having the polypeptide sequence of SEQ ID NO:328; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; gg. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:289, and a light chain variable region having the polypeptide sequence of SEQ ID NO:329; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; hh. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:290, and a light chain variable region having the polypeptide sequence of SEQ ID NO:330; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; ii. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:293, and a light chain variable region having the polypeptide sequence of SEQ ID NO:333; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; jj. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:294, and a light chain variable region having the polypeptide sequence of SEQ ID NO:334; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; kk. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:295, and a light chain variable region having the polypeptide sequence of SEQ ID NO:335; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; ll. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:296, and a light chain variable region having the polypeptide sequence of SEQ ID NO:336; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; mm. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:337; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; nn. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:338; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; oo. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; pp. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:292, and a light chain variable region having the polypeptide sequence of SEQ ID NO:332; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; qq. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:291, and a light chain variable region having the polypeptide sequence of SEQ ID NO:331; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; rr. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:261, and a light chain variable region having the polypeptide sequence of SEQ ID NO:302; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, ss. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:310; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; tt. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:280, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; uu. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:259, and a light chain variable region having the polypeptide sequence of SEQ ID NO:300; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; vv. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:263, and a light chain variable region having the polypeptide sequence of SEQ ID NO:304; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ww. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:264, and a light chain variable region having the polypeptide sequence of SEQ ID NO:305; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; xx. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:265, and a light chain variable region having the polypeptide sequence of SEQ ID NO:306; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, yy. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:266, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; zz. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:272, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; aaa. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:277, and a light chain variable region having the polypeptide sequence of SEQ ID NO:317; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; bbb. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:279, and a light chain variable region having the polypeptide sequence of SEQ ID NO:319; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ccc. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:284, and a light chain variable region having the polypeptide sequence of SEQ ID NO:324; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; or ddd. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:285, and a light chain variable region having the polypeptide sequence of SEQ ID NO:325; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, eee. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:260, and a light chain variable region having the polypeptide sequence of SEQ ID NO:301; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; fff. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:262, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ggg. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:267, and a light chain variable region having the polypeptide sequence of SEQ ID NO:308; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; hhh. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:268, and a light chain variable region having the polypeptide sequence of SEQ ID NO:309; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; iii. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:270, and a light chain variable region having the polypeptide sequence of SEQ ID NO:311; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; jjj. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:271, and a light chain variable region having the polypeptide sequence of SEQ ID NO:312; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, kkk. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:273, and a light chain variable region having the polypeptide sequence of SEQ ID NO:313; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; lll. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:274, and a light chain variable region having the polypeptide sequence of SEQ ID NO:314; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; mmm. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:275, and a light chain variable region having the polypeptide sequence of SEQ ID NO:315; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; nnn. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:276, and a light chain variable region having the polypeptide sequence of SEQ ID NO:316; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ooo. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:278, and a light chain variable region having the polypeptide sequence of SEQ ID NO:318; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ppp. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:321; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, qqq. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:282, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; rrr. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:283, and a light chain variable region having the polypeptide sequence of SEQ ID NO:323; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; sss. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:326; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ttt. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:287, and a light chain variable region having the polypeptide sequence of SEQ ID NO:327; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; uuu. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:288, and a light chain variable region having the polypeptide sequence of SEQ ID NO:328; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; vvv. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:289, and a light chain variable region having the polypeptide sequence of SEQ ID NO:329; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, www. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:290, and a light chain variable region having the polypeptide sequence of SEQ ID NO:330; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; xxx. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:293, and a light chain variable region having the polypeptide sequence of SEQ ID NO:333; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; yyy. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:294, and a light chain variable region having the polypeptide sequence of SEQ ID NO:334; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; zzz. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:295, and a light chain variable region having the polypeptide sequence of SEQ ID NO:335; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; aaaa. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:296, and a light chain variable region having the polypeptide sequence of SEQ ID NO:336; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; bbbb. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:337; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, cccc. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:338; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; or dddd. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299.
(124) According to another particular aspect, the invention relates to an isolated anti-CD33 monoclonal antibody or antigen-binding fragment thereof that induces antibody-dependent cell-mediated cytotoxicity (ADCC). The monoclonal antibody or antigen-binding fragment thereof can, for example, induce ADCC in vitro. The monoclonal antibody or antigen-binding fragment thereof can induce ADCC with an EC.sub.50 of less than about 2 nM. In certain embodiments, the EC.sub.50 is less than about 2.0 nM, less than about 1.9 nM, less than about 1.8 nM, less than about 1.7 nM, less than about 1.6 nM, less than about 1.5 nM, less than about 1.4 nM, less than about 1.3 nM, less than about 1.2 nM, less than about 1.1 nM, less than about 1.0 nM, less than about 0.9 nM, less than about 0.8 nM, less than about 0.7 nM, less than about 0.6 nM, less than about 0.5 nM, less than about 0.4 nM, less than about 0.3 nM, less than about 0.2 nM, or less than about 0.1 nM. In certain embodiments, the CD33 monoclonal antibody or antigen-binding fragment thereof comprises an IgG1 low fucose backbone.
(125) In some embodiments described herein, immune effector properties of the CD33-specific antibodies can be enhanced or silenced through Fc modifications by techniques known to those skilled in the art. For example, Fc effector functions such as Clq binding, complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cell-mediated phagocytosis (ADCP), down regulation of cell surface receptors (e.g., B cell receptor; BCR), etc. may be provided and/or controlled by modifying residues in the Fc responsible for these activities.
(126) “Antibody-dependent cell-mediated cytotoxicity” or “ADCC” refers to a cell-mediated reaction in which non-specific cytotoxic cells that express Fc receptors (FcRs) (e.g. Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell.
(127) The ability of monoclonal antibodies to induce ADCC can be enhanced by engineering their oligosaccharide component. Human IgG1 or IgG3 are N-glycosylated at Asn297 with the majority of the glycans in the well-known biantennary G0, G0F, G1, G1F, G2 or G2F forms. Antibodies produced by non-engineered CHO cells typically have a glycan fucose content of about at least 85%. The removal of the core fucose from the biantennary complex-type oligosaccharides attached to the Fc regions enhances the ADCC of antibodies via improved Fc.gamma.RIIIa binding without altering antigen binding or CDC activity. Such mAbs can be achieved using different methods reported to lead to the successful expression of relatively high defucosylated antibodies bearing the biantennary complex-type of Fc oligosaccharides such as control of culture osmolality (Konno et al., Cytotechnology 64:249-65, 2012), application of a variant CHO line Lec13 as the host cell line (Shields et al., J Biol Chem 277:26733-26740, 2002), application of a variant CHO line EB66 as the host cell line (Olivier et al., MAbs; 2(4), 2010; Epub ahead of print; PMID:20562582), application of a rat hybridoma cell line YB2/0 as the host cell line (Shinkawa et al., J Biol Chem 278:3466-3473, 2003), introduction of small interfering RNA specifically against the α-1,6-fucosyltrasferase (FUT8) gene (Mori et al., Biotechnol Bioeng 88:901-908, 2004), or coexpression of β-1,4-N-acetylglucosaminyltransferase III and golgi α-mannosidase II or a potent alpha-mannosidase I inhibitor, kifunensine (Ferrara et al., J Biol Chem 281:5032-5036, 2006, Ferrara et al., Biotechnol Bioeng 93:851-861, 2006; Xhou et al., Biotechnol Bioeng 99:652-65, 2008).
(128) In some embodiments described herein, ADCC elicited by the CD33 antibodies may also be enhanced by certain substitutions in the antibody Fc. Exemplary substitutions are for example substitutions at amino acid positions 256, 290, 298, 312, 356, 330, 333, 334, 360, 378 or 430 (residue numbering according to the EU index) as described in U.S. Pat. No. 6,737,056.
(129) According to another particular aspect, the invention relates to an isolated anti-CD33 monoclonal antibody or antigen-binding fragment thereof that is capable of binding CD33 with a dissociation constant (KD) of less than about 5×10.sup.−8M. In certain embodiments, the dissociation constant is less than about 5×10.sup.−8M, less than 1×10.sup.−8M, less than 5×10.sup.−9M, less than 1×10.sup.−9M, less than 5×10.sup.−10M, less than 1×10.sup.−10M, less than 5×10.sup.−11M, or less than 1×10.sup.−11M.
(130) According to another particular aspect, the invention relates to an isolated anti-CD33 monoclonal antibody or antigen-binding fragment thereof that is capable of binding CD33 and inducing internalization of CD33 with an EC.sub.50 of less than about 2 nM. In certain embodiments, the EC.sub.50 is less than about 2.0 nM, less than about 1.9 nM, less than about 1.8 nM, less than about 1.7 nM, less than about 1.6 nM, less than about 1.5 nM, less than about 1.4 nM, less than about 1.3 nM, less than about 1.2 nM, less than about 1.1 nM, less than about 1.0 nM, less than about 0.9 nM, less than about 0.8 nM, less than about 0.7 nM, less than about 0.6 nM, less than about 0.5 nM, less than about 0.4 nM, less than about 0.3 nM, less than about 0.2 nM, and less than about 0.1 nM.
(131) According to another particular aspect, the invention relates to an isolated anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof capable of inducing T-cell dependent cytotoxicity in CD33-expressing cells. The bispecific antibody or antigen-binding fragment thereof can, for example, induce T-cell dependent cytotoxicity in CD33-expressing cells in vitro with an EC.sub.50 value of less than about 2 nM. In certain embodiments, the EC.sub.50 is less than about 2.0 nM, less than about 1.9 nM, less than about 1.8 nM, less than about 1.7 nM, less than about 1.6 nM, less than about 1.5 nM, less than about 1.4 nM, less than about 1.3 nM, less than about 1.2 nM, less than about 1.1 nM, less than about 1.0 nM, less than about 0.9 nM, less than about 0.8 nM, less than about 0.7 nM, less than about 0.6 nM, less than about 0.5 nM, less than about 0.4 nM, less than about 0.3 nM, less than about 0.2 nM, and less than about 0.1 nM.
(132) According to another particular aspect, the invention relates to an isolated anti-CD33 monoclonal antibody and/or an isolated anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof, wherein the anti-CD33 monoclonal antibody or anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof is chimeric.
(133) According to another particular aspect, the invention relates to an isolated anti-CD33 monoclonal antibody and/or an isolated anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof, wherein the anti-CD33 monoclonal antibody or anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof is human or humanized.
(134) In another general aspect, the invention relates to an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention. In another general aspect, the invention relates to an isolated nucleic acid encoding a bispecific antibody or antigen-binding fragment thereof of the invention. It will be appreciated by those skilled in the art that the coding sequence of a protein can be changed (e.g., replaced, deleted, inserted, etc.) without changing the amino acid sequence of the protein. Accordingly, it will be understood by those skilled in the art that nucleic acid sequences encoding monoclonal antibodies and/or bispecific antibodies of the invention can be altered without changing the amino acid sequences of the proteins.
(135) In another general aspect, the invention relates to a vector comprising an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention. In another general aspect, the invention relates to a vector comprising an isolated nucleic acid encoding a bispecific antibody or antigen-binding fragment thereof of the invention. Any vector known to those skilled in the art in view of the present disclosure can be used, such as a plasmid, a cosmid, a phage vector or a viral vector. In some embodiments, the vector is a recombinant expression vector such as a plasmid. The vector can include any element to establish a conventional function of an expression vector, for example, a promoter, ribosome binding element, terminator, enhancer, selection marker, and origin of replication. The promoter can be a constitutive, inducible or repressible promoter. A number of expression vectors capable of delivering nucleic acids to a cell are known in the art and can be used herein for production of an antibody or antigen-binding fragment thereof in the cell. Conventional cloning techniques or artificial gene synthesis can be used to generate a recombinant expression vector according to embodiments of the invention. Such techniques are well known to those skilled in the art in view of the present disclosure.
(136) In another general aspect, the invention relates to a host cell comprising an isolated nucleic acid encoding a monoclonal antibody and/or bispecific antibody or an antigen-binding fragment thereof of the invention. Any host cell known to those skilled in the art in view of the present disclosure can be used for recombinant expression of antibodies or antigen-binding fragments thereof of the invention. In some embodiments, the host cells are E. coli TG1 or BL21 cells (for expression of, e.g., an scFv or Fab antibody), CHO-DG44 or CHO-K1 cells or HEK293 cells (for expression of, e.g., a full-length IgG antibody). According to particular embodiments, the recombinant expression vector is transformed into host cells by conventional methods such as chemical transfection, heat shock, or electroporation, where it is stably integrated into the host cell genome such that the recombinant nucleic acid is effectively expressed.
(137) In another general aspect, the invention relates to a method of producing a monoclonal antibody or antigen-binding fragment thereof of the invention, comprising culturing a cell comprising a nucleic acid encoding the monoclonal antibody or antigen-binding fragment thereof under conditions to produce a monoclonal antibody or antigen-binding fragment thereof of the invention, and recovering the antibody or antigen-binding fragment thereof from the cell or cell culture (e.g., from the supernatant). In another general aspect, the invention relates to a method of producing a bispecific antibody or antigen-binding fragment thereof of the invention, comprising culturing a cell comprising a nucleic acid encoding the bispecific antibody or antigen-binding fragment thereof under conditions to produce a bispecific antibody or antigen-binding fragment thereof of the invention, and recovering the antibody or antigen-binding fragment thereof from the cell or cell culture (e.g., from the supernatant). Expressed antibodies or antigen-binding fragments thereof can be harvested from the cells and purified according to conventional techniques known in the art and as described herein.
(138) Pharmaceutical Compositions
(139) In another general aspect, the invention relates to a pharmaceutical composition comprising an isolated monoclonal antibody or antigen-binding fragment thereof of the invention and a pharmaceutically acceptable carrier. In another general aspect, the invention relates to a pharmaceutical composition comprising a bispecific antibody or antigen-binding fragment thereof of the invention and a pharmaceutically acceptable carrier. The term “pharmaceutical composition” as used herein means a product comprising an antibody of the invention together with a pharmaceutically acceptable carrier. Antibodies of the invention and compositions comprising them are also useful in the manufacture of a medicament for therapeutic applications mentioned herein.
(140) As used herein, the term “carrier” refers to any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, oil, lipid, lipid containing vesicle, microsphere, liposomal encapsulation, or other material well known in the art for use in pharmaceutical formulations. It will be understood that the characteristics of the carrier, excipient or diluent will depend on the route of administration for a particular application. As used herein, the term “pharmaceutically acceptable carrier” refers to a non-toxic material that does not interfere with the effectiveness of a composition according to the invention or the biological activity of a composition according to the invention. According to particular embodiments, in view of the present disclosure, any pharmaceutically acceptable carrier suitable for use in an antibody pharmaceutical composition can be used in the invention.
(141) The formulation of pharmaceutically active ingredients with pharmaceutically acceptable carriers is known in the art, e.g., Remington: The Science and Practice of Pharmacy (e.g. 21st edition (2005), and any later editions). Non-limiting examples of additional ingredients include; buffers, diluents, solvents, tonicity regulating agents, preservatives, stabilizers, and chelating agents. One or more pharmaceutically acceptable carrier may be used in formulating the pharmaceutical compositions of the invention.
(142) In one embodiment of the invention, the pharmaceutical composition is a liquid formulation. A preferred example of a liquid formulation is an aqueous formulation, i.e., a formulation comprising water. The liquid formulation may comprise a solution, a suspension, an emulsion, a microemulsion, a gel, and the like. An aqueous formulation typically comprises at least 50% w/w water, or at least 60%, 70%, 75%, 80%, 85%, 90%, or at least 95% w/w of water.
(143) In one embodiment, the pharmaceutical composition may be formulated as an injectable which can be injected, for example, via an injection device (e.g., a syringe or an infusion pump). The injection may be delivered subcutaneously, intramuscularly, intraperitoneally, intravitreally, or intravenously, for example.
(144) In another embodiment, the pharmaceutical composition is a solid formulation, e.g., a freeze-dried or spray-dried composition, which may be used as is, or whereto the physician or the patient adds solvents, and/or diluents prior to use. Solid dosage forms may include tablets, such as compressed tablets, and/or coated tablets, and capsules (e.g., hard or soft gelatin capsules). The pharmaceutical composition may also be in the form of sachets, dragees, powders, granules, lozenges, or powders for reconstitution, for example.
(145) The dosage forms may be immediate release, in which case they may comprise a water-soluble or dispersible carrier, or they may be delayed release, sustained release, or modified release, in which case they may comprise water-insoluble polymers that regulate the rate of dissolution of the dosage form in the gastrointestinal tract or under the skin.
(146) In other embodiments, the pharmaceutical composition may be delivered intranasally, intrabuccally, or sublingually.
(147) The pH in an aqueous formulation can be between pH 3 and pH 10. In one embodiment of the invention, the pH of the formulation is from about 7.0 to about 9.5. In another embodiment of the invention, the pH of the formulation is from about 3.0 to about 7.0.
(148) In another embodiment of the invention, the pharmaceutical composition comprises a buffer. Non-limiting examples of buffers include: arginine, aspartic acid, bicine, citrate, disodium hydrogen phosphate, fumaric acid, glycine, glycylglycine, histidine, lysine, maleic acid, malic acid, sodium acetate, sodium carbonate, sodium dihydrogen phosphate, sodium phosphate, succinate, tartaric acid, tricine, and tris(hydroxymethyl)-aminomethane, and mixtures thereof. The buffer may be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific buffers constitute alternative embodiments of the invention.
(149) In another embodiment of the invention, the pharmaceutical composition comprises a preservative. Non-limiting examples of buffers include: benzethonium chloride, benzoic acid, benzyl alcohol, bronopol, butyl 4-hydroxybenzoate, chlorobutanol, chlorocresol, chlorohexidine, chlorphenesin, o-cresol, m-cresol, p-cresol, ethyl 4-hydroxybenzoate, imidurea, methyl 4-hydroxybenzoate, phenol, 2-phenoxyethanol, 2-phenylethanol, propyl 4-hydroxybenzoate, sodium dehydroacetate, thiomerosal, and mixtures thereof. The preservative may be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific preservatives constitute alternative embodiments of the invention.
(150) In another embodiment of the invention, the pharmaceutical composition comprises an isotonic agent. Non-limiting examples of the embodiment include a salt (such as sodium chloride), an amino acid (such as glycine, histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, and threonine), an alditol (such as glycerol, 1,2-propanediol propyleneglycol), 1,3-propanediol, and 1,3-butanediol), polyethyleneglycol (e.g. PEG400), and mixtures thereof. Another example of an isotonic agent includes a sugar. Non-limiting examples of sugars may be mono-, di-, or polysaccharides, or water-soluble glucans, including for example fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, alpha and beta-HPCD, soluble starch, hydroxyethyl starch, and sodium carboxymethyl-cellulose. Another example of an isotonic agent is a sugar alcohol, wherein the term “sugar alcohol” is defined as a C(4-8) hydrocarbon having at least one —OH group. Non-limiting examples of sugar alcohols include mannitol, sorbitol, inositol, galactitol, dulcitol, xylitol, and arabitol. Pharmaceutical compositions comprising each isotonic agent listed in this paragraph constitute alternative embodiments of the invention. The isotonic agent may be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific isotonic agents constitute alternative embodiments of the invention.
(151) In another embodiment of the invention, the pharmaceutical composition comprises a chelating agent. Non-limiting examples of chelating agents include citric acid, aspartic acid, salts of ethylenediaminetetraacetic acid (EDTA), and mixtures thereof. The chelating agent may be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific chelating agents constitute alternative embodiments of the invention.
(152) In another embodiment of the invention, the pharmaceutical composition comprises a stabilizer. Non-limiting examples of stabilizers include one or more aggregation inhibitors, one or more oxidation inhibitors, one or more surfactants, and/or one or more protease inhibitors.
(153) In another embodiment of the invention, the pharmaceutical composition comprises a stabilizer, wherein said stabilizer is carboxy-/hydroxycellulose and derivates thereof (such as HPC, HPC-SL, HPC-L and HPMC), cyclodextrins, 2-methylthioethanol, polyethylene glycol (such as PEG 3350), polyvinyl alcohol (PVA), polyvinyl pyrrolidone, salts (such as sodium chloride), sulphur-containing substances such as monothioglycerol), or thioglycolic acid. The stabilizer may be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific stabilizers constitute alternative embodiments of the invention.
(154) In further embodiments of the invention, the pharmaceutical composition comprises one or more surfactants, preferably a surfactant, at least one surfactant, or two different surfactants. The term “surfactant” refers to any molecules or ions that are comprised of a water-soluble (hydrophilic) part, and a fat-soluble (lipophilic) part. The surfactant may, for example, be selected from the group consisting of anionic surfactants, cationic surfactants, nonionic surfactants, and/or zwitterionic surfactants. The surfactant may be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific surfactants constitute alternative embodiments of the invention.
(155) In a further embodiment of the invention, the pharmaceutical composition comprises one or more protease inhibitors, such as, e.g., EDTA, and/or benzamidine hydrochloric acid (HCl). The protease inhibitor may be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific protease inhibitors constitute alternative embodiments of the invention.
(156) In another general aspect, the invention relates to a method of producing a pharmaceutical composition comprising a monoclonal antibody or antigen-binding fragment thereof of the invention, comprising combining a monoclonal antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition. In another general aspect, the invention relates to a method of producing a pharmaceutical composition comprising a bispecific antibody or antigen-binding fragment thereof of the invention, comprising combining a bispecific antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
(157) Methods of Use
(158) In another general aspect, the invention relates to a method of targeting CD33 on a cancer cell surface in a subject, the method comprising administering to the subject an isolated monoclonal antibody or antigen binding fragment thereof that specifically binds CD33 or an anti-CD33/anti-CD3 bispecific antibody or antigen binding fragment thereof or a pharmaceutical composition of the invention.
(159) Also contemplated herein is a therapeutic anti-CD33 antibody immunoconjugate comprising a therapeutic agent that is selected from the group consisting of a radionuclide, boron, gadolinium or uranium atoms, an immunomodulator, such as a cytokine, a stem cell growth factor, a lymphotoxin, such as tumor necrosis factor (TNF), a hematopoietic factor such as an interleukin (IL), a colony stimulating factor (CSF) such as granulocyte-colony stimulating factor (G-CSF) or granulocyte macrophage-colony stimulating factor (GM-CSF)), an interferon (IFN) such as interferons-α, -β or -γ, and a stem cell growth factor such as that designated “S1 factor,” a hematopoietic factor, erythropoietin, thrombopoietin, an antibody, a hormone, a hormone antagonist, an enzyme, an enzyme inhibitor, a photoactive therapeutic agent, a cytotoxic drug, such as antimitotic agents, alkylating agents, antimetabolite agents, angiogenesis-inhibiting agents, apoptotic agents, alkaloid agents, COX-2-inhibiting agents, and antibiotic agents, a cytotoxic toxin, such as plant toxins, microbial toxins, and animal toxins, and synthetic variations thereof, an angiogenesis inhibitor, a different antibody, and a combination thereof. In a preferred embodiment, the cytokine is selected from the group consisting of IL-1, IL-2, IL-3, IL-6, IL-10, IL-12, IL-18, IL-21, interferon-γ, TNF-α and a combination thereof, the radionuclide is selected from the group consisting of an Auger emitter, a beta-emitter and an alpha-emitter, such as P-32, P-33, Sc-47, Fe-59, Cu-64, Cu-67, Se-75, As-77, Sr-89, Y-90, Mo-99, Rh-105, Pd-109, Ag-111, I-125, I-131, Pr-142, Pr-143, Pm-149, Sm-153, Tb-161, Ho-166, Er-169, Lu-177, Re-186, Re-188, Re-189, Ir-194, Au-198, Au-199, Pb-211, Pb-212, and Bi-213, Co-58, Ga-67, Br-80m, Tc-99m, Rh-103m, Pt-109, In-111, Sb-119, I-125, Ho-161, Os-189m, Ir-192, Dy-152, At-211, Bi-212, Ra-223, Rn-219, Po-215, Bi-211, Ac-225, Fr-221, At-217, Bi-213, Fm-255, B-10, Gd-157, U-235, and combinations thereof. Preferably, the radionuclide has an energy between 20 and 10,000 keV.
(160) The functional activity of antibodies and antigen-binding fragments thereof that bind CD33 can be characterized by methods known in the art and as described herein. Methods for characterizing antibodies and antigen-binding fragments thereof that bind CD33 include, but are not limited to, affinity and specificity assays including BIACORE®, ELISA, and OCTET® Red analysis; binding assays to detect the binding of antibodies to CD33 on cancer cells by FACS. According to particular embodiments, the methods for characterizing antibodies and antigen-binding fragments thereof that bind CD33 include those described below.
(161) In another general aspect, the invention relates to a method of treating a cancer in a subject in need thereof, comprising administering to the subject an isolated monoclonal antibody or antigen binding fragment thereof that specifically binds CD33 or a pharmaceutical composition of the invention. The cancer can, for example, be a CD33-expressing cancer. The cancer can, for example, be selected from but not limited to, a lung cancer, a gastric cancer, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin's lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid tumors. The cancer can, for example, be a hematologic cancer. The hematologic cancer can, for example, be a leukemia, a lymphoma, and a myeloma. In certain embodiments, the hematologic cancer can be acute myeloid leukemia (AML), myelodysplastic syndrome (MDS, low or high risk), acute lymphocytic leukemia (ALL, including all subtypes), diffuse large B-cell lymphoma (DLBCL), chronic myeloid leukemia (CML), or blastic plasmacytoid dendritic cell neoplasm (DPDCN).
(162) According to embodiments of the invention, the pharmaceutical composition comprises a therapeutically effective amount of an anti-CD33 antibody or antigen-binding fragment thereof. As used herein, the term “therapeutically effective amount” refers to an amount of an active ingredient or component that elicits the desired biological or medicinal response in a subject. A therapeutically effective amount can be determined empirically and in a routine manner, in relation to the stated purpose.
(163) As used herein with reference to anti-CD33 antibodies or antigen-binding fragments thereof, a therapeutically effective amount means an amount of the anti-CD33 antibody or antigen-binding fragment thereof that modulates an immune response in a subject in need thereof.
(164) According to particular embodiments, a therapeutically effective amount refers to the amount of therapy which is sufficient to achieve one, two, three, four, or more of the following effects: (i) reduce or ameliorate the severity of the disease, disorder or condition to be treated or a symptom associated therewith; (ii) reduce the duration of the disease, disorder or condition to be treated, or a symptom associated therewith; (iii) prevent the progression of the disease, disorder or condition to be treated, or a symptom associated therewith; (iv) cause regression of the disease, disorder or condition to be treated, or a symptom associated therewith; (v) prevent the development or onset of the disease, disorder or condition to be treated, or a symptom associated therewith; (vi) prevent the recurrence of the disease, disorder or condition to be treated, or a symptom associated therewith; (vii) reduce hospitalization of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (viii) reduce hospitalization length of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (ix) increase the survival of a subject with the disease, disorder or condition to be treated, or a symptom associated therewith; (xi) inhibit or reduce the disease, disorder or condition to be treated, or a symptom associated therewith in a subject; and/or (xii) enhance or improve the prophylactic or therapeutic effect(s) of another therapy.
(165) The therapeutically effective amount or dosage can vary according to various factors, such as the disease, disorder or condition to be treated, the means of administration, the target site, the physiological state of the subject (including, e.g., age, body weight, health), whether the subject is a human or an animal, other medications administered, and whether the treatment is prophylactic or therapeutic. Treatment dosages are optimally titrated to optimize safety and efficacy.
(166) According to particular embodiments, the compositions described herein are formulated to be suitable for the intended route of administration to a subject. For example, the compositions described herein can be formulated to be suitable for intravenous, subcutaneous, or intramuscular administration.
(167) As used herein, the terms “treat,” “treating,” and “treatment” are all intended to refer to an amelioration or reversal of at least one measurable physical parameter related to a cancer, which is not necessarily discernible in the subject, but can be discernible in the subject. The terms “treat,” “treating,” and “treatment,” can also refer to causing regression, preventing the progression, or at least slowing down the progression of the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to an alleviation, prevention of the development or onset, or reduction in the duration of one or more symptoms associated with the disease, disorder, or condition, such as a tumor or more preferably a cancer. In a particular embodiment, “treat,” “treating,” and “treatment” refer to prevention of the recurrence of the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to an increase in the survival of a subject having the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to elimination of the disease, disorder, or condition in the subject.
(168) According to particular embodiments, provided are compositions used in the treatment of a cancer. For cancer therapy, the compositions can be used in combination with another treatment including, but not limited to, a chemotherapy, an anti-CD20 mAb, an anti-TIM-3 mAb, an anti-CTLA-4 antibody, an anti-PD-L1 antibody, an anti-PD-1 antibody, a PD-1/PD-L1 therapy, other immuno-oncology drugs, an antiangiogenic agent, a radiation therapy, an antibody-drug conjugate (ADC), a targeted therapy, or other anticancer drugs.
(169) As used herein, the term “in combination,” in the context of the administration of two or more therapies to a subject, refers to the use of more than one therapy. The use of the term “in combination” does not restrict the order in which therapies are administered to a subject. For example, a first therapy (e.g., a composition described herein) can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapy to a subject.
EMBODIMENTS
(170) This invention provides the following non-limiting embodiments.
(171) Embodiment 1 is an isolated monoclonal antibody or antigen-binding fragment thereof that specifically binds the C2 domain of CD33.
(172) Embodiment 2 is the isolated monoclonal antibody or antigen-binding fragment thereof of embodiment 1, wherein the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, having the polypeptide sequence of: a. SEQ ID NOs:447, 448, 449, 567, 568, and 569, respectively; b. SEQ ID NOs:444, 445, 446, 564, 565, and 566, respectively; c. SEQ ID NOs:354, 355, 356, 477, 478, and 479, respectively; d. SEQ ID NOs:378, 379, 380, 501, 502, and 503, respectively; e. SEQ ID NOs:411, 412, 413, 531, 532, and 533, respectively; f. SEQ ID NOs:348, 349, 350, 471, 472, and 473, respectively; g. SEQ ID NOs:360, 361, 362, 483, 484, and 485, respectively; h. SEQ ID NOs:363, 364, 365, 486, 487, and 488, respectively; i. SEQ ID NOs:366, 367, 368, 489, 490, and 491, respectively; j. SEQ ID NOs:369, 370, 371, 492, 493, and 494, respectively; k. SEQ ID NOs:387, 388, 389, 492, 493, and 494, respectively; l. SEQ ID NOs:402, 403, 404, 522, 523, and 524, respectively; m. SEQ ID NOs:408, 409, 410, 528, 529, and 530, respectively; n. SEQ ID NOs:423, 424, 425, 543, 544, and 545, respectively; or o. SEQ ID NOs:426, 427, 428, 546, 547, and 548, respectively;
wherein the antibody or antigen-binding fragment thereof specifically binds CD33, preferably human CD33.
(173) Embodiment 3 is the isolated monoclonal antibody or antigen-binding fragment thereof of embodiment 1 or 2, comprising a heavy chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:292, 291, 261, 269, 280, 259, 263, 264, 265, 266, 272, 277, 279, 284, or 285, or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:332, 331, 302, 310, 320, 300, 304, 305, 306, 307, 317, 319, 324, or 325.
(174) Embodiment 4 is the isolated monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-3, comprising: a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:292, and a light chain variable region having the polypeptide sequence of SEQ ID NO:332; b. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:291, and a light chain variable region having the polypeptide sequence of SEQ ID NO:331; c. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:261, and a light chain variable region having the polypeptide sequence of SEQ ID NO:302; d. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:310; e. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:280, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; f. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:259, and a light chain variable region having the polypeptide sequence of SEQ ID NO:300; g. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:263, and a light chain variable region having the polypeptide sequence of SEQ ID NO:304; h. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:264, and a light chain variable region having the polypeptide sequence of SEQ ID NO:305; i. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:265, and a light chain variable region having the polypeptide sequence of SEQ ID NO:306; j. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:266, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; k. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:272, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; I. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:277, and a light chain variable region having the polypeptide sequence of SEQ ID NO:317; m. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:279, and a light chain variable region having the polypeptide sequence of SEQ ID NO:319; n. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:284, and a light chain variable region having the polypeptide sequence of SEQ ID NO:324; or o. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:285, and a light chain variable region having the polypeptide sequence of SEQ ID NO:325.
(175) Embodiment 5 is an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), a HCDR2, a HCDR3, a light chain complementarity determining region 1 (LCDR1), a LCDR2, and a LCDR3, having the polypeptide sequences of a. SEQ ID NOs:357, 358, 359, 480, 481, and 482, respectively; b. SEQ ID NOs:372, 373, 374, 495, 496, and 497, respectively; c. SEQ ID NOs:375, 376, 377, 498, 499, and 500, respectively; d. SEQ ID NOs:381, 382, 383, 504, 505, and 506, respectively; e. SEQ ID NOs:384, 385, 386, 507, 508, and 509, respectively; f. SEQ ID NOs:390, 391, 392, 510, 511, and 512, respectively; g. SEQ ID NOs:393, 394, 395, 513, 514, and 515, respectively; h. SEQ ID NOs:396, 397, 398, 516, 517, and 518, respectively; i. SEQ ID NOs:399, 400, 401, 519, 520, and 521, respectively; j. SEQ ID NOs:405, 406, 407, 525, 526, and 527, respectively; k. SEQ ID NOs:414, 415, 416, 534, 535, and 536, respectively; l. SEQ ID NOs:417, 418, 419, 537, 538, and 539, respectively; m. SEQ ID NOs:420, 421, 422, 540, 541, and 542, respectively; n. SEQ ID NOs:429, 430, 431, 549, 550, and 551, respectively; o. SEQ ID NOs:432, 433, 434, 552, 553, and 554, respectively; p. SEQ ID NOs:435, 436, 437, 555, 556, and 557, respectively; q. SEQ ID NOs:438, 439, 440, 558, 559, and 560, respectively; r. SEQ ID NOs:441, 442, 443, 561, 562, and 563, respectively; s. SEQ ID NOs:450, 451, 452, 570, 571, and 572, respectively; t. SEQ ID NOs:453, 454, 455, 573, 574, and 575, respectively; u. SEQ ID NOs:456, 457, 458, 576, 577, and 578, respectively; v. SEQ ID NOs:459, 460, 461, 579, 580, and 581, respectively; w. SEQ ID NOs:378, 379, 380, 582, 583, and 584, respectively; x. SEQ ID NOs:414, 415, 416, 585, 586, and 587, respectively; or y. SEQ ID NOs:429, 430, 431, 480, 481, and 482, respectively;
wherein the antibody or antigen-binding fragment thereof specifically binds CD33, preferably human CD33.
(176) Embodiment 6 is the isolated monoclonal antibody or antigen-binding fragment thereof of embodiment 5, comprising a heavy chain variable region having a polypeptide sequence at least 95% identical to one of SEQ ID NOs:260, 262, 267, 268, 270, 271, 273, 274, 275, 276, 278, 281, 282, 283, 286, 287, 288, 289, 290, 293, 294, 295, or 296, or a light chain variable region having a polypeptide sequence at least 95% identical to one of SEQ ID NOs:301, 303, 308, 309, 311, 312, 313, 314, 315, 316, 318, 321, 322, 323, 326, 327, 328, 329, 330, 333, 334, 335, 336, 337, or 338.
(177) Embodiment 7 is the isolated monoclonal antibody or antigen-binding fragment thereof of embodiment 5 or 6, comprising: a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:260, and a light chain variable region having the polypeptide sequence of SEQ ID NO:301; b. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:262, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303; c. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:267, and a light chain variable region having the polypeptide sequence of SEQ ID NO:308; d. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:268, and a light chain variable region having the polypeptide sequence of SEQ ID NO:309; e. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:270, and a light chain variable region having the polypeptide sequence of SEQ ID NO:311; f. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:271, and a light chain variable region having the polypeptide sequence of SEQ ID NO:312; g. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:273, and a light chain variable region having the polypeptide sequence of SEQ ID NO:313; h. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:274, and a light chain variable region having the polypeptide sequence of SEQ ID NO:314; i. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:275, and a light chain variable region having the polypeptide sequence of SEQ ID NO:315; j. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:276, and a light chain variable region having the polypeptide sequence of SEQ ID NO:316; k. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:278, and a light chain variable region having the polypeptide sequence of SEQ ID NO:318; l. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:321; m. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:282, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; n. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:283, and a light chain variable region having the polypeptide sequence of SEQ ID NO:323; o. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:326; p. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:287, and a light chain variable region having the polypeptide sequence of SEQ ID NO:327; q. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:288, and a light chain variable region having the polypeptide sequence of SEQ ID NO:328; r. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:289, and a light chain variable region having the polypeptide sequence of SEQ ID NO:329; s. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:290, and a light chain variable region having the polypeptide sequence of SEQ ID NO:330; t. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:293, and a light chain variable region having the polypeptide sequence of SEQ ID NO:333; u. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:294, and a light chain variable region having the polypeptide sequence of SEQ ID NO:334; v. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:295, and a light chain variable region having the polypeptide sequence of SEQ ID NO:335; w. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:296, and a light chain variable region having the polypeptide sequence of SEQ ID NO:336; x. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:337; y. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:338; or z. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303.
(178) Embodiment 8 is the isolated monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-4, wherein the monoclonal antibody or antigen-binding fragment thereof induces antibody-dependent cell-mediated cytotoxicity (ADCC) in vitro with an EC.sub.50 of less than about 2 nM.
(179) Embodiment 9 is the isolated monoclonal antibody or antigen-binding fragment thereof of embodiment 8, wherein the monoclonal antibody or antigen-binding fragment thereof comprises an IgG1 low fucose backbone.
(180) Embodiment 10 is the isolated monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-7, wherein the monoclonal antibody or antigen-binding fragment thereof binds CD33 with a dissociation constant (KD) of less than about 5×10.sup.−9 M.
(181) Embodiment 11 is the isolated monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-7, wherein the monoclonal antibody or antigen-binding fragment thereof binds CD33 and induces internalization with an EC.sub.50 of less than about 2 nM.
(182) Embodiment 12 is the isolated monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-11, wherein the monoclonal antibody or antigen-binding fragment thereof inhibits CD33 activity.
(183) Embodiment 13 is the isolated monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-12, wherein the antibody or antigen-binding fragment thereof is chimeric.
(184) Embodiment 14 is the isolated monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-13, wherein the antibody or antigen-binding fragment thereof is human or humanized.
(185) Embodiment 15 is the isolated monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-13, wherein the antibody or antigen-binding fragment thereof is conjugated to a therapeutic agent.
(186) Embodiment 16 is an isolated nucleic acid encoding the monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-14.
(187) Embodiment 17 is a vector comprising the isolated nucleic acid of embodiment 16.
(188) Embodiment 18 is a host cell comprising the vector of embodiment 17.
(189) Embodiment 19 is a pharmaceutical composition, comprising the isolated monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-14 and a pharmaceutically acceptable carrier.
(190) Embodiment 20 is a method of treating cancer in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 19.
(191) Embodiment 21 is the method of embodiment 20, wherein the cancer is a hematologic cancer.
(192) Embodiment 22 is the method of embodiment 21, wherein the hematologic cancer is selected from the group consisting of a leukemia, a lymphoma, or a multiple myeloma.
(193) Embodiment 23 is the method of embodiment 22, wherein the hematologic cancer is acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), acute lymphocytic leukemia (ALL), diffuse large B-cell lymphoma (DLBCL), chronic myeloid leukemia (CML) or blastic plasmacytoid dendritic cell neoplasm (DPDCN).
(194) Embodiment 24 is a method of producing the monoclonal antibody or antigen-binding fragment thereof of any one of embodiments 1-14, comprising culturing a cell comprising a nucleic acid encoding the monoclonal antibody or antigen-binding fragment under conditions to produce the monoclonal antibody or antigen-binding fragment, and recovering the antibody or antigen-binding fragment from the cell or culture.
(195) Embodiment 25 is a method of producing a pharmaceutical composition comprising the monoclonal antibody or antigen-binding fragment of any one of embodiments 1-14, comprising combining the monoclonal antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
(196) Embodiment 26 is an anti-CD33/anti-CD3 bispecific antibody comprising an anti-CD33 antibody or an antigen-binding fragment thereof and an anti-CD3 antibody or antigen-binding fragment thereof,
(197) wherein the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, having the polypeptide sequence of: a. SEQ ID NOs:447, 448, 449, 567, 568, and 569, respectively; b. SEQ ID NOs:444, 445, 446, 564, 565, and 566, respectively; c. SEQ ID NOs:354, 355, 356, 477, 478, and 479, respectively; d. SEQ ID NOs:378, 379, 380, 501, 502, and 503, respectively; e. SEQ ID NOs:411, 412, 413, 531, 532, and 533, respectively; f. SEQ ID NOs:348, 349, 350, 471, 472, and 473, respectively; g. SEQ ID NOs:360, 361, 362, 483, 484, and 485, respectively; h. SEQ ID NOs:363, 364, 365, 486, 487, and 488, respectively; i. SEQ ID NOs:366, 367, 368, 489, 490, and 491, respectively; j. SEQ ID NOs:369, 370, 371, 492, 493, and 494, respectively; k. SEQ ID NOs:387, 388, 389, 492, 493, and 494, respectively; l. SEQ ID NOs:402, 403, 404, 522, 523, and 524, respectively; m. SEQ ID NOs:408, 409, 410, 528, 529, and 530, respectively; n. SEQ ID NOs:423, 424, 425, 543, 544, and 545, respectively; or o. SEQ ID NOs:426, 427, 428, 546, 547, and 548, respectively;
and the anti-CD3 antibody or antigen-binding fragment thereof comprises a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, having the polypeptide sequence of: 1) SEQ ID NOs: 342, 343, 344, 465, 466, and 467, respectively; or 2) SEQ ID NOs: 345, 346, 347, 468, 469, and 470, respectively.
(198) Embodiment 27 is the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of embodiment 25, wherein the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:292, 291, 261, 269, 280, 259, 263, 264, 265, 266, 272, 277, 279, 284, or 285, or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:332, 331, 302, 310, 320, 300, 304, 305, 306, 307, 317, 319, 324, or 325; and the anti-CD3 antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:257 or 258, or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:298 or 299.
(199) Embodiment 28 is the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of embodiment 25 or 26, comprising: a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:292, and a light chain variable region having the polypeptide sequence of SEQ ID NO:332; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; b. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:291, and a light chain variable region having the polypeptide sequence of SEQ ID NO:331; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; c. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:261, and a light chain variable region having the polypeptide sequence of SEQ ID NO:302; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; d. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:310; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; e. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:280, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; f. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:259, and a light chain variable region having the polypeptide sequence of SEQ ID NO:300; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; g. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:263, and a light chain variable region having the polypeptide sequence of SEQ ID NO:304; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; h. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:264, and a light chain variable region having the polypeptide sequence of SEQ ID NO:305; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; i. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:265, and a light chain variable region having the polypeptide sequence of SEQ ID NO:306; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; j. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:266, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; k. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:272, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; l. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:277, and a light chain variable region having the polypeptide sequence of SEQ ID NO:317; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; m. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:279, and a light chain variable region having the polypeptide sequence of SEQ ID NO:319; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; n. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:284, and a light chain variable region having the polypeptide sequence of SEQ ID NO:324; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; o. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:285, and a light chain variable region having the polypeptide sequence of SEQ ID NO:325; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; p. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:292, and a light chain variable region having the polypeptide sequence of SEQ ID NO:332; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; q. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:291, and a light chain variable region having the polypeptide sequence of SEQ ID NO:331; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; r. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:261, and a light chain variable region having the polypeptide sequence of SEQ ID NO:302; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; s. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:310; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; t. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:280, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; u. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:259, and a light chain variable region having the polypeptide sequence of SEQ ID NO:300; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; v. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:263, and a light chain variable region having the polypeptide sequence of SEQ ID NO:304; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; w. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:264, and a light chain variable region having the polypeptide sequence of SEQ ID NO:305; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; x. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:265, and a light chain variable region having the polypeptide sequence of SEQ ID NO:306; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; y. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:266, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; z. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:272, and a light chain variable region having the polypeptide sequence of SEQ ID NO:307; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; aa. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:277, and a light chain variable region having the polypeptide sequence of SEQ ID NO:317; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; bb. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:279, and a light chain variable region having the polypeptide sequence of SEQ ID NO:319; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; cc. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:284, and a light chain variable region having the polypeptide sequence of SEQ ID NO:324; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; or dd. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:285, and a light chain variable region having the polypeptide sequence of SEQ ID NO:325; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299.
(200) Embodiment 29 is the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of any one of embodiments 26-28, wherein the anti-CD33 antibody or antigen-binding fragment thereof specifically binds the C2 domain of CD33.
(201) Embodiment 30 is an anti-CD33/anti-CD3 bispecific antibody comprising an anti-CD33 antibody or an antigen-binding fragment thereof and an anti-CD3 antibody or antigen-binding fragment thereof,
(202) wherein the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, having the polypeptide sequence of: a. SEQ ID NOs:357, 358, 359, 480, 481, and 482, respectively; b. SEQ ID NOs:372, 373, 374, 495, 496, and 497, respectively; c. SEQ ID NOs:375, 376, 377, 498, 499, and 500, respectively; d. SEQ ID NOs:381, 382, 383, 504, 505, and 506, respectively; e. SEQ ID NOs:384, 385, 386, 507, 508, and 509, respectively; f. SEQ ID NOs:390, 391, 392, 510, 511, and 512, respectively; g. SEQ ID NOs:393, 394, 395, 513, 514, and 515, respectively; h. SEQ ID NOs:396, 397, 398, 516, 517, and 518, respectively; i. SEQ ID NOs:399, 400, 401, 519, 520, and 521, respectively; j. SEQ ID NOs:405, 406, 407, 525, 526, and 527, respectively; k. SEQ ID NOs:414, 415, 416, 534, 535, and 536, respectively; l. SEQ ID NOs:417, 418, 419, 537, 538, and 539, respectively; m. SEQ ID NOs:420, 421, 422, 540, 541, and 542, respectively; n. SEQ ID NOs:429, 430, 431, 549, 550, and 551, respectively; o. SEQ ID NOs:432, 433, 434, 552, 553, and 554, respectively; p. SEQ ID NOs:435, 436, 437, 555, 556, and 557, respectively; q. SEQ ID NOs:438, 439, 440, 558, 559, and 560, respectively; r. SEQ ID NOs:441, 442, 443, 561, 562, and 563, respectively; s. SEQ ID NOs:450, 451, 452, 570, 571, and 572, respectively; t. SEQ ID NOs:453, 454, 455, 573, 574, and 575, respectively; u. SEQ ID NOs:456, 457, 458, 576, 577, and 578, respectively; v. SEQ ID NOs:459, 460, 461, 579, 580, and 581, respectively; w. SEQ ID NOs:378, 379, 380, 582, 583, and 584, respectively; x. SEQ ID NOs:414, 415, 416, 585, 586, and 587, respectively; or y. SEQ ID NOs:429, 430, 431, 480, 481, and 482, respectively;
and the anti-CD3 antibody or antigen-binding fragment thereof comprises a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, having the polypeptide sequence of: 1) SEQ ID NOs: 342, 343, 344, 465, 466, and 467, respectively; or 2) SEQ ID NOs: 345, 346, 347, 468, 469, and 470, respectively.
(203) Embodiment 31 is the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of embodiment 29, wherein the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 95% identical to one of SEQ ID NOs:260, 262, 267, 268, 270, 271, 273, 274, 275, 276, 278, 281, 282, 283, 286, 287, 288, 289, 290, 293, 294, 295, or 296, or a light chain variable region having a polypeptide sequence at least 95% identical to one of SEQ ID NOs:301, 303, 308, 309, 311, 312, 313, 314, 315, 316, 318, 321, 322, 323, 326, 327, 328, 329, 330, 333, 334, 335, 336, 337, or 338; and the anti-CD3 antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:257 or 258, or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:298 or 299.
(204) Embodiment 32 is the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of embodiment 29 or 30, comprising: a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:260, and a light chain variable region having the polypeptide sequence of SEQ ID NO:301; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; b. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:262, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; c. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:267, and a light chain variable region having the polypeptide sequence of SEQ ID NO:308; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; d. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:268, and a light chain variable region having the polypeptide sequence of SEQ ID NO:309; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; e. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:270, and a light chain variable region having the polypeptide sequence of SEQ ID NO:311; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; f. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:271, and a light chain variable region having the polypeptide sequence of SEQ ID NO:312; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; g. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:273, and a light chain variable region having the polypeptide sequence of SEQ ID NO:313; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; h. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:274, and a light chain variable region having the polypeptide sequence of SEQ ID NO:314; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; i. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:275, and a light chain variable region having the polypeptide sequence of SEQ ID NO:315; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; j. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:276, and a light chain variable region having the polypeptide sequence of SEQ ID NO:316; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; k. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:278, and a light chain variable region having the polypeptide sequence of SEQ ID NO:318; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; l. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:321; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; m. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:282, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; n. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:283, and a light chain variable region having the polypeptide sequence of SEQ ID NO:323; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; o. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:326; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; p. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:287, and a light chain variable region having the polypeptide sequence of SEQ ID NO:327; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; q. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:288, and a light chain variable region having the polypeptide sequence of SEQ ID NO:328; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; r. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:289, and a light chain variable region having the polypeptide sequence of SEQ ID NO:329; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; s. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:290, and a light chain variable region having the polypeptide sequence of SEQ ID NO:330; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; t. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:293, and a light chain variable region having the polypeptide sequence of SEQ ID NO:333; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; u. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:294, and a light chain variable region having the polypeptide sequence of SEQ ID NO:334; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; v. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:295, and a light chain variable region having the polypeptide sequence of SEQ ID NO:335; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; w. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:296, and a light chain variable region having the polypeptide sequence of SEQ ID NO:336; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; x. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:337; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; y. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:338; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; z. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:257, and a light chain variable region having a polypeptide sequence of SEQ ID NO:298; aa. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:260, and a light chain variable region having the polypeptide sequence of SEQ ID NO:301; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; bb. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:262, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; cc. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:267, and a light chain variable region having the polypeptide sequence of SEQ ID NO:308; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; dd. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:268, and a light chain variable region having the polypeptide sequence of SEQ ID NO:309; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ee. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:270, and a light chain variable region having the polypeptide sequence of SEQ ID NO:311; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ff. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:271, and a light chain variable region having the polypeptide sequence of SEQ ID NO:312; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, gg. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:273, and a light chain variable region having the polypeptide sequence of SEQ ID NO:313; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; hh. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:274, and a light chain variable region having the polypeptide sequence of SEQ ID NO:314; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ii. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:275, and a light chain variable region having the polypeptide sequence of SEQ ID NO:315; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; jj. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:276, and a light chain variable region having the polypeptide sequence of SEQ ID NO:316; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; kk. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:278, and a light chain variable region having the polypeptide sequence of SEQ ID NO:318; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ll. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:321; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, mm. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:282, and a light chain variable region having the polypeptide sequence of SEQ ID NO:322; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; nn. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:283, and a light chain variable region having the polypeptide sequence of SEQ ID NO:323; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; oo. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:326; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; pp. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:287, and a light chain variable region having the polypeptide sequence of SEQ ID NO:327; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; qq. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:288, and a light chain variable region having the polypeptide sequence of SEQ ID NO:328; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; rr. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:289, and a light chain variable region having the polypeptide sequence of SEQ ID NO:329; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, ss. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:290, and a light chain variable region having the polypeptide sequence of SEQ ID NO:330; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; tt. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:293, and a light chain variable region having the polypeptide sequence of SEQ ID NO:333; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; uu. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:294, and a light chain variable region having the polypeptide sequence of SEQ ID NO:334; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; vv. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:295, and a light chain variable region having the polypeptide sequence of SEQ ID NO:335; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; ww. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:296, and a light chain variable region having the polypeptide sequence of SEQ ID NO:336; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; xx. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:269, and a light chain variable region having the polypeptide sequence of SEQ ID NO:337; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299, yy. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:281, and a light chain variable region having the polypeptide sequence of SEQ ID NO:338; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299; or zz. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:286, and a light chain variable region having the polypeptide sequence of SEQ ID NO:303; and a heavy chain variable region having the polypeptide sequence of SEQ ID NO:258, and a light chain variable region having a polypeptide sequence of SEQ ID NO:299.
(205) Embodiment 33 is the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of any one of embodiments 26-32, wherein the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof induces T-cell dependent cytotoxicity in CD33-expressing cells in vitro with an EC.sub.50 value of less than about 1 nM.
(206) Embodiment 34 is the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of any one of embodiments 26-33, wherein the bispecific antibody or antigen-binding fragment thereof is chimeric.
(207) Embodiment 35 is the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of any one of embodiments 26-34, wherein the bispecific antibody or antigen-binding fragment thereof is human or humanized.
(208) Embodiment 36 is an isolated nucleic acid encoding the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of any one of embodiments 26-35.
(209) Embodiment 37 is a vector comprising the isolated nucleic acid of embodiment 36.
(210) Embodiment 38 is a host cell comprising the vector of embodiment 37.
(211) Embodiment 39 is a pharmaceutical composition, comprising the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of any one of embodiments 26-35 and a pharmaceutically acceptable carrier.
(212) Embodiment 40 is a method of treating cancer in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 39.
(213) Embodiment 41 is the method of embodiment 40, wherein the cancer is a hematologic cancer.
(214) Embodiment 42 is the method of embodiment 41, wherein the hematologic cancer is selected from the group consisting of a leukemia, a lymphoma, or a multiple myeloma.
(215) Embodiment 43 is the method of embodiment 42, wherein the hematologic cancer is acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), acute lymphocytic leukemia (ALL), diffuse large B-cell lymphoma (DLBCL), chronic myeloid leukemia (CML) or blastic plasmacytoid dendritic cell neoplasm (DPDCN).
(216) Embodiment 44 is a method of producing the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof of any one of embodiments 26-35, comprising culturing a cell comprising a nucleic acid encoding the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment under conditions to produce the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment, and recovering the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment from the cell or culture.
(217) Embodiment 45 is a method of producing a pharmaceutical composition comprising the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment of any one of embodiments 26-35, comprising combining the anti-CD33/anti-CD3 bispecific antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
EXAMPLES
(218) Reagents
(219) Antigen Generation
(220) The human and cyno CD33 proteins were produced with or without a mutated monomeric form of human serum albumin (HSA), Uniprot P02768 with a C58S mutation, fused at the C-terminus for immunizations and assays. The cDNAs encoding the CD33 protein antigens with a six-histidine tag, were synthetically synthesized and cloned into a mammalian secretion expression vector under the Actin promoter using standard molecular biology techniques.
(221) The full-length human CD33 extracellular domain (ECD) derived from Uniprot P20138 (SEQ ID NO:1) (human CD33 ECD) was fused at the N-terminus with a signal sequence and with or without the HSA, followed by a six histidine tag at the C-terminus, hCD33 ECD with HSA and hCD33 ECD only). The human CD33 ECD expression construct was transiently transfected into HEK293 derived cells, EXPI293™ (GIBCO®/THERMO FISHER SCIENTIFIC®; Waltham, Mass.) using EXPIFECTAMINE™ according to manufacturer protocol. Cells were incubated 5 days at 37° C. with 8% CO.sub.2 on an orbital shaker before harvesting. The expressed cells were removed by centrifugation and the soluble CD33 was purified from the media using immobilized metal affinity chromatography using Ni SEPHAROSE™ 6 Fast Flow resin (GE® Healthcare, Little Chalfont, United Kingdom) followed by SUPERDEX® 200 preparative size exclusion chromatography (SEC) (GE® Healthcare) in Dubelcco's Phosphate Saline buffer pH 7.2 (1×DPBS). SEC elution fractions excluding any disulfide aggregates were combined and sterile filtered to yield the final protein for immunization and CD33 assays. Protein concentration was determined by A280 and quality of purified protein was assessed by SDS-PAGE and analytical SEC (PHENOMENEX®; Torrance, Calif.). Endotoxin measurements were performed using ENDOSAFE®-PTS Cartridges, a chromogenic LAL assay (CHARLES RIIVER®; Wilmington, Mass.).
(222) The human CD33 ECD subdomain proteins, hCD33 V-domain-HSA, hCD33 V-domain-his, hCD33 C2 domain-HSA, and hCD33 C2 domain-His, were similarly constructed, expressed and purified as the full-length human CD33 ECD.
(223) Cyno CD33 constructs for immunization and cross selectivity assays, cyno CD33 ECD-HSA, cyno CD33-His, were also generated based on the Genbank sequence XP_005590138.1. Cyno CD33 protein expression and purification were same as the human CD33 proteins.
(224) The CD33 antigens for screening were biotinylated in 50 mM Na Phosphate pH 7.2 using SURELINK™ Chromagenic Biotin Labeling kit (SERACARE® KPL) according to manufacturer conditions. Briefly, a biotin stock of 25 mM was added to the CD33 protein at a 4:1 molar ratio of biotin to protein and incubated at room temperature for 30 minutes with gentle rotation and then switched to 4° C. for 2 more hours. Unincorporated biotin was removed by buffer exchange into 1×DPBS. Protein concentration and biotin incorporation was determined by measuring at A280 nm and A354 nm using NanoDrop. See Table 1 for the sequences of each of the antigens described above.
(225) TABLE-US-00001 TABLE 1 Antigen Sequences Protein Name Protein ID SEQ ID NO Cyno CD33 ECD-HSA C33W1 2 Human CD33 ECD-HSA C33W2 3 Human CD33-V-HSA C33W3 4 Human CD33-C2-HSA C33W4 5 Human CD33-V-His C33W8 6 Human CD33 C2-His C33W9 7 Human CD33 ECD-His C33W49 8 Cyno CD33 ECD-His C33W50 9 Human CD33 full length 10 Cyno CD33 full length 11
(226) Generation of CD33 Expressing Isogenic Cell Lines
(227) Human and cyno CD33 expressing cell lines were generated using lentivirus (GENECOPOEIA®; Rockville, Md.) containing full length human CD33 or cyno CD33 and puromycin for selection of CD33 positive cells. HEK293F cells (ATCC), negative for CD33, were transduced with lentiviral particles to overexpress human CD33 and cyno CD33. Following transduction, cells positively expressing CD33 and the resistance marker, were selected by treating pooled cells, grown in DMEM+10% HI FBS (LIFE TECHNOLOGIES™; Carlsbad, Calif.) and supplemented with varying concentrations of Puromycin (LIFE TECHNOLOGIES™).
(228) In addition to the HEK generated cell lines, several commercial cell lines were used for binding and cellular toxicity assays. These included MOLM13, KG1, SH2, OCIAML3 and MV411 and were obtained from either American Type Culture Collection or Deutsche Sammlung von Mikrooranismen und Zellkulturen, and cultured at 37° C., 5% CO.sub.2 in complete RPMI culture media with 10% FBS.
Example 1: Immunization Campaigns
(229) OMNIRAT®
(230) A human immunoglobulin transgenic rat strain (OMNIRAT®; Ligand Pharmaceuticals; San Diego, Calif.) was used to develop human CD33 monoclonal antibody expressing hybridoma cells. The OMNIRAT® contains a chimeric human/rat IgH locus (comprising 22 human V.sub.Hs, all human D and J.sub.H segments in natural configuration linked to the rat CH locus) together with fully human IgL loci (12 Vκs linked to Jκ-Cκ and 16 Vλs linked to Jκ-Cκ). (see e.g., Osborn, et al. (2013) J Immunol 190(4): 1481-1490). Accordingly, the rats exhibit reduced expression of rat immunoglobulin, and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity chimeric human/rat IgG monoclonal antibodies with fully human variable regions. The preparation and use of OMNIRAT®, and the genomic modifications carried by such rats, is described in PCT Publication WO 2014/093908 to Bruggemann et al.
(231) When immunized with recombinant human and cynomolgus CD33 (huCD33 ECD-HSA and cyno CD33 ECD-HSA respectively), this transgenic rat produces chimeric human-rat IgG antibodies to human CD33, some of which also bind to cynomolgus CD33.
(232) Eight OMNIRATS® were immunized alternately with huCD33 ECD-HSA and cyno CD33 ECD-HSA. Following a 46 day immunization regimen, lymph nodes from all eight OMNIRATS® were harvested and used to generate hybridomas. Eighty-one 96-well plates of hybridoma supernatants were screened via binding ELISA and AlphaLISA using standard techniques, of which 128 hybridoma supernatants were selected for specific binding to huCD33 ECD-HSA and cyno CD33 ECD-HSA. Most of the 128 supernatants were also positive for binding to cells over-expressing huCD33 or cyCD33.
(233) Six additional OMNIRATS® were immunized with rhuCD33 only. Following a 31 day immunization regimen, lymph nodes from all six OMNIRATS® were harvested and used to generate hybridomas. Thirty 96-well plates of hybridoma supernatants were screened via binding ELISA using standard techniques, of which 94 hybridoma supernatants were selected for specific binding to huCD33 ECD-HSA and cyno CD33 ECD-HSA. Hybridoma lysates were prepared from the positive clones and progressed to v region cloning described below.
(234) OMNIMOUSE®
(235) A human immunoglobulin transgenic mouse strain (OMNIMOUSE®; Ligand Pharmaceuticals) was used to develop human CD33 monoclonal antibody expressing hybridoma cells. The OMNIMOUSE® contains chimeric human/rat IgH loci together with fully human IgL loci. The mice exhibit reduced expression of mouse immunoglobulin, and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity chimeric human/rat IgG monoclonal antibodies with fully human variable regions.
(236) When immunized with recombinant human and cynomolgus CD33 (huCD33 ECD-HSA and cyno CD33 ECD-HAS respectively), this transgenic mouse produces chimeric human/rat IgG antibodies to human CD33, some of which also bind to cynomolgus CD33.
(237) Four OMNIMICE® were immunized alternately with huCD33 ECD-HSA and cyno CD33 ECD-HSA. Following a 53 day immunization regimen, spleens and lymph nodes from all four OMNIMICE® were harvested and used to generate hybridomas. Forty-eight 96-well plates of hybridoma supernatants were screened via binding ELISA and AlphaLISA, of which 8 hybridoma supernatants were selected for specific binding to huCD33 ECD-HSA and cyno CD33 ECD-HSA. Hybridoma lysates were prepared from the positive clones and progressed to v region cloning described below.
(238) V Region Cloning
(239) Total RNA from hybridoma cell lysates was purified using RNeasy 96 kit (QIAGEN®; Hilden, Germany) following the manufacturer's protocol, and the resulting RNA was quantitated using Drop Sense and stored at −80° C. or cDNA was synthesized using INVITROGEN® SUPERSCRIPT® III First-Strand Synthesis System for RT-PCR (INVITROGEN®; Carlsbad, Calif.). The first strand cDNA Synthesis was carried out using gene specific primers annealed to the constant regions of heavy, kappa, and lambda chains, respectively. The RT-PCR reaction mixture is comprised of up to 3 μg of purified RNA, gene specific primer, dNTP mix, reaction buffer, 25 mM MgCl.sub.2, DTT, RNASEOUT® (40 U/μl, INVITROGEN®), and SUPERSCRIPT® III RT (200 U/μl, INVTTROGEN® Cat #18080-051), and incubate at 50° C. for 50 minutes and 85° C. for 5 minutes. The resulting single-stranded cDNA was stored at −20° C., or the single-stranded DNA was PCR amplified. The PCR reaction was carried out using PLATINUM™ Pfx polymerase (INVITROGEN®). The v-region fragments were amplified by forward and reverse primers annealing to the leader sequences and constant regions of heavy, kappa and lambda chains, respectively, using optimized PCR conditions. The resulting PCR fragments were run on the gel and sequenced at GENEWIZ® using pre-designed primers to obtain v-region sequences. The resulting abi files of v-region sequences were collected and analyzed by the Sanger v-region sequence analysis program created at Janssen Biologics Discovery. The AA sequences of the recovered v-regions were registered in the internal database, codon optimized and cloned into the pUnder-based expression vector carrying the appropriate constant region of the desired human antibody isotype: IgG1 F405L and IgG4 PAA. A total of 76 OMNIRAT® antibodies and 8 OMNIMOUSE® antibodies were successfully cloned and proceeded for further characterization. The tables below summarize the sequences from the top 42 identified in the OMNIRAT® campaigns (see Table 2) and the 16 identified in the OMNIMOUSE® campaign (see Table 3) with several of the OMNIRAT® antibodies cloned into IgG1 as well as IgG4 PAA and all from the OMNIMOUSE® campaign were cloned into both IgG1 and IgG 4 PAA.
(240) TABLE-US-00002 TABLE 2 Antibody sequences identified via CD33 immunization in OMNIRAT ® Protein Nucleotide Protein Nucleotide mAb HC ID HC Isotype SEQ ID SEQ ID LC ID SEQ ID SEQ ID C33B46 C33H108 hulgG1F405L 12 54 C33L74 96 138 C33B48 C33H80 hulgG1F405L 13 55 C33L73 97 139 C33B52 C33H42 hulgG1F405L 14 56 C33L8 98 140 C33B54 C33H44 hulgG1F405L 15 57 C33L10 99 141 C33B55 C33H45 hulgG1F405L 16 58 C33L11 100 142 C33B56 C33H46 hulgG1F405L 17 59 IAPL24 101 143 C33B61 C33H48 hulgG1F405L 18 60 C33L58 102 144 C33B62 C33H49 hulgG1F405L 19 61 C33L59 103 145 C33B63 C33H51 hulgG1F405L 20 62 C33L34 104 146 C33B64 C33H52 hulgG1F405L 21 63 N46L109 105 147 C33B66 C33H55 hulgG1F405L 22 64 C33L42 106 148 C33B72 C33H65 hulgG1F405L 23 65 C33L47 107 149 C33B73 C33H66 hulgG1F405L 24 66 C33L60 108 150 C33B75 C33H70 hulgG1F405L 25 67 N46L109 109 151 C33B77 C33H72 hulgG1F405L 26 68 C33L40 110 152 C33B79 C33H74 hulgG1F405L 27 69 C33L38 111 153 C33B80 C33H76 hulgG1F405L 28 70 C33L39 112 154 C33B82 C33H78 hulgG1F405L 29 71 C33L57 113 155 C33B83 C33H81 hulgG1F405L 30 72 C33L53 114 156 C33B87 C33H87 hulgG1F405L 31 73 C33L35 115 157 C33B88 C33H88 hulgG1F405L 32 74 C33L61 116 158 C33B89 C33H90 hulgG1F405L 33 75 C33L51 117 159 C33B94 C33H98 hulgG1F405L 34 76 C33L69 118 160 C33B95 C33H98 hulgG1F405L 35 77 IAPL24 119 161 C33B96 C33H99 hulgG1F405L 36 78 C33L37 120 162 C33B101 C33H69 hulgG1F405L 37 79 C4LL152 121 163 C33B107 C33H68 hulgG1F405L 38 80 C33L17 122 164 C33B120 C33H87 hulgG1F405L 39 81 C33L41 123 165 C33B122 C33H92 hulgG1F405L 40 82 C33L30 124 166 C33B123 C33H91 hulgG1F405L 41 83 C33L44 125 167 C33B124 C33H73 hulgG1F405L 42 84 C33L32 126 168 C33B125 C33H84 hulgG1F405L 43 85 C33L66 127 169 C33B760 C33H45 huIgG4 PAA 44 86 C33L11 128 170 C33B777 C33H65 huIgG4 PAA 45 87 C33L47 129 171 C33B778 C33H66 huIgG4 PAA 46 88 C33L60 130 172 C33B782 C33H72 huIgG4 PAA 47 89 C33L40 131 173 C33B792 C33H87 huIgG4 PAA 48 90 C33L35 132 174 C33B799 C33H98 huIgG4 PAA 49 91 C33L69 133 175 C33B806 C33H69 huIgG4 PAA 50 92 C4LL152 134 176 C33B830 C33H84 huIgG4 PAA 51 93 C33L66 135 177 C33B836 C33H80 huIgG4 PAA 52 94 C33L73 136 178 C33B937 C33H66 huIGG4 PAA 53 95 C33L132 137 179 HC: Heavy Chain; LC: Light Chain
(241) TABLE-US-00003 TABLE 3 Antibody sequences identified via CD33 immunization in OMNIMOUSE ® Protein SEQ Nucleotide Protein SEQ Nucleotide mAb HC ID ID NO SEQ ID NO LC ID ID NO SEQ ID NO C33B901 C33H249 180 196 C33L115 212 228 C33B902 C33H250 181 197 C33L116 213 229 C33B903 C33H251 182 198 C33L117 214 230 C33B904 C33H252 183 199 C33L118 215 231 C33B905 C33H253 184 200 C33L119 216 232 C33B906 C33H254 185 201 C33L120 217 233 C33B907 C33H255 186 202 C33L121 218 234 C33B908 C33H256 187 203 C33L122 219 235 C33B909 C33H249 188 204 C33L115 220 236 C33B910 C33H250 189 205 C33L116 221 237 C33B911 C33H251 190 206 C33L117 222 238 C33B912 C33H252 191 207 C33L118 223 239 C33B913 C33H253 192 208 C33L119 224 240 C33B914 C33H254 193 209 C33L120 225 241 C33B915 C33H255 194 210 C33L121 226 242 C33B916 C33H256 195 211 C33L122 227 243 HC: Heavy Chain; LC: Light Chain
(242) EXPI293™ Small Scale Transfection and Purification
(243) Antibodies identified in the immunization campaigns and subsequent v region cloning (into IgG1 F405L and IgG4 PAA) were expressed and purified via small 2 ml scale. EXPI293™ cells (THERMO FISHER SCIENTIFIC®) were seeded at 1.25×10.sup.−5-2.25×10.sup.5 viable cells/mL density in EXPI293™ Expression Medium and cultured in polycarbonate, disposable, sterile, vented, non-baffled Erlenmeyer shake flasks in a 37° C., 7% CO.sub.2 shaker incubator (INFORS HT™ MULTITRON PRO™). For routine cell growth in 125 mL-2 L shake flasks, the shake speed was set to 130 rpm for shakers with a 19 mm shaking diameter. Cells were sub-cultured when density reached log phase growth at 3×10.sup.6-5×10.sup.6 viable cells/mL with a 98-99% viability.
(244) On day of transfection, the viable cell density and percent viability was determined. Cells were transfected at a density of 3×10.sup.6 viable cells/mL. For optimal transfection, sterile Heavy and Light Chain plasmid DNA at 0.1 mg/mL concentration in TE buffer (10 mM Tris-HCl, 1 mM EDTA, pH 8.0) is used.
(245) EXPI293™ cells were transfected following manufacturer's Transfection protocol (THERMO FISHER SCIENTIFIC® Publication Number MAN0007814). Transfection was performed in 24-well deepwell plates (GE® Healthcare). Briefly, plasmid DNA was diluted with 0.1 mL OptiMEM™ medium (THERMO FISHER SCIENTIFIC®) at the following ratio: 0.250 μg Heavy Chain DNA: 0.750 μg Light Chain DNA: 0.5 μg pAdvantage. 5 μL of EXPIFECTAMINE™ 293 Transfection Reagent was diluted and mixed gently with 95 μL OptiMEM™ medium and incubated for 1 min. The diluted EXPIFECTAMINE™ 293 Reagent was added to the diluted DNA, mixed gently and the EXPIFECTAMINE™ 293/plasmid DNA complexes were incubated at room temperature for 40 minutes. Post-incubation, 1.8 mL Expi293™ cells were added to the complexes incubated overnight in a 37° C., 7% CO.sub.2 shaker incubator.
(246) On Day 1 post-transfection, 10 μL EXPIFECTAMINE™ 293 Enhancer land 100 μL EXPIFECTAMINE™ Enhancer 2 were added and the plates were returned to the incubator for an additional 5 days. The culture was harvested on day 6 post-transfection by centrifugation at 850×G for 15 minutes before purification.
(247) 1.7 mls of clarified expression supernatants prepared above were transferred to a new 96 2 ml deepwell plate. Purification plates were prepared by pipetting 800 μl of a 1:4 mix of mAb Select Sure resin (GE® Healthcare) and DPBS −/− slurry into every well of a 96 well ACROPREP™ Advance 1 μm glass filter plate (PALL®). 200 mbar of vacuum pressure was applied to the plate to remove excess PBS and subsequently washed with 800 μl fresh PBS. 200 mbar vacuum pressure was applied to remove the wash buffer. The clarified supernatants were then transferred to the PBS washed resin, mixed gently and incubated for 15 minutes. Following the incubation, 200 mbar vacuum pressure was applied to remove the supernatant. The mAb Select Sure resin was washed three times with PBS and once with 25 mM Sodium Acetate, pH 5 (TEKNOVA; Hollister, Calif.) with 200 mbar vacuum pressure applied between washes to remove excess buffer. mAbs bound to the resin were eluted using 0.1 M Sodium Acetate, pH 3.5 and incubated for 10 minutes for effective dissociation. The filter plate was placed atop a 96 deepwell plate and the eluted mAbs were collected in the bottom plate via centrifugation at 1000 g for 2 minutes. 80 μl of 2.5 M Tris-Actetate, pH 7.2 was added to neutralize the mAbs. The mAbs were dialyzed into PBS overnight in a 96 well DispoDIALYZER plate (Harvard Apparatus; Holliston, Mass.), transferred to a 96 well ACROPREP™ Advance 0.2 μm Supor filter plate (PALL®; Port Washington, N.Y.), placed atop a 96 deepwell plate and the protein solutions filtered via centrifugation at 1,500 g for 15 minutes in a desktop centrifuge. Protein concentrations were determined by A280 measurement on the filtrate using a DROPSENSE™ Instrument (TRINEAN™).
Example 2: Characterization of Anti-CD33 mAbs
(248) OMNIRAT® antibodies identified via immunization, v-region cloned and subsequently expressed and purified were characterized further for binding to CD33 expressing cells and binding to recombinant antigens. The purified antibodies were assessed for binding to stably transfected HEK293F cells expressing human CD33 or cyno CD33 (generation described above) along with the parental HEK293F as negative control. Cells were harvested from tissue culture flasks using non-enzymatic dissociation buffer (THERMO FISHER SCIENTIFIC®). The flasks were rinsed twice with PBS and dissociation buffer was added to the flask, and the flask was incubated for 10 minutes at 37° C. until the cells became non-adherent. The cells were centrifuged at 300 g for 5 minutes and resuspended at 1.0×10.sup.6 cells/ml in staining buffer (Becton Dickinson; Franklin Lakes, N.J.). 50,000 cells/well of each cell type was plated in 50 μl of staining buffer in round bottom plates (Becton Dickinson). 50 μl of 2× concentration test mAb or isotype control was added at 3 dilutions and zero (120 nM, 12 nM, and 1.2 nM and 0 nM), and the resultant solution was incubated 30 min at 4° C. 100 μl staining buffer was added to all wells of each plate, the plates were spun at 300 g for 5 min, the buffer was removed, 200 μl staining buffer was added to all wells of each plate, the plates were spun at 300 g for 5 min, and the buffer was removed. 50 μl of 2 μg/ml of Goat-anti-human Fc AF647 secondary antibody (Jackson Immunoresearch; West Grove, Pa.) was added to all wells of the plates, and the plates were incubated for 30 min at 4° C. 100 μl staining buffer was added to all wells of the plates, the plates were spun at 300 g for 5 min, and the buffer was removed. 200 μl running buffer (running buffer is Staining buffer, 1 mM EDTA, 0.1% Pluronic Acid) was added to all wells of the plates, the plates were spun at 300 g for 5 min, and the buffer was removed. 30 ul running buffer containing Sytox Green live/dead dye (THERMO FISHER SCIENTIFIC®) was added to all wells with cells and the plates were read on an iQue IntelliCyt flow cytometer. Cells were gated on forward vs. side scatter to eliminate debris, then on singlets and then on live cells which excluded the Sytox stain. Antibody binding was assessed by the mean fluorescence intensity in the AF647 channel.
(249) To begin assessing the biophysical binding properties of the purified mAbs an off-rate screen was performed. 76 OMNIRAT® anti-CD33 mAbs were tested for binding to recombinant human CD33 ECD-HSA (C33W2) and cyno CD33 ECD-HSA (C33W1) proteins (Janssen production) and the off-rate was measured by IBIS MX96 SPRi array platform (Carterra; Newton, Pa.). Goat anti-human Fc IgG (Jackson Immunoresearch, Cat #109-005-098) was directly immobilized via amine coupling at 100 μg/mL in acetate buffer, pH 4.5 using a CMD50m sensor chip (Xantec, lot CMD50m0415.a) with an association time of 10 minutes in the IBIS instrument. An average GAH-Fc immobilization level of ˜9000 Rus was achieved. The sensor chip was transferred to the Continuous Flow Microspotter (CFM) unit to capture each anti-CD33 mAb at 10 μg/ml for 10 minutes. Binding was measured on IBIS SPRi by single cycle kinetics without regeneration. Each antigen concentration series (3 μM in 3 fold dilution series) was sequentially injected from low (0.46 nM) to high concentrations (3 μM) to bind to captured mAbs with an association time of 5 minutes and dissociation time of 15 minutes using PBST (PBS with 0.005% TWEEN) as running buffer. The raw binding data (.trix file format) were referenced and aligned using SprintX software (Wasatch, Ver 1.9.3.2), then exported (.ibmx file format) to Scrubber software (Ver. 2.0) for 1:1 binding kinetic analyses (Wasatch, version 2.0.0.33) to extract the k.sub.off results.
(250) Table 4 below summarizes the top 32 clones as assessed by binding to human and cyno CD33 expressing cell lines as well as towards recombinant antigen (off-rate of at least >10e-3 for one of the antigens). Of these 32, all but 4 showed appreciable binding to either human or cyno expressing cells. All 32 were carried for further characterization via epitope binning and full kinetic analysis.
(251) TABLE-US-00004 TABLE 4 Cell Binding and Off-Rate analysis of the anti-CD33 antibodies derived from OMNIRAT ® Prot. AA ID % Mon 60 nM CD33 6 nM CD33 0.6 nM CD33 0 nM CD33 kD C33B48 91.96 400995.84 428948.75 391157.69 91.12 5.47E−05 C33B73 100.00 201493.02 33443.28 4034.64 93.98 9.12E−05 C33B125 98.48 258779.13 79728.78 9203.75 78.26 1.54E−04 C33B55 96.39 188278.42 59155.10 7625.56 105.39 2.15E−04 C33B96 98.75 476040.28 475653.41 187925.80 55.23 2.28E−04 C33B124 100.00 798.33 126.37 90.26 172.03 2.38E−04 C33B72 96.94 328194.72 105474.59 12506.85 93.32 2.84E−04 C33B79 100.00 236644.03 41925.89 4988.81 77.78 3.28E−04 C33B77 92.11 241787.16 88691.05 11484.97 69.46 3.37E−04 C33B82 96.21 188508.56 41264.92 5033.60 73.44 3.41E−04 C33B87 100.00 242185.48 79532.87 12547.05 73.65 3.52E−04 C33B80 98.33 5799.64 409.97 114.93 88.88 3.84E−04 C33B101 96.91 268805.28 204984.16 35513.63 70.07 3.98E−04 C33B83 98.07 92956.55 7856.70 1020.48 87.37 4.61E−04 C33B46 95.81 509865.97 447627.97 418017.22 134.53 4.67E−04 C33B94 98.31 200142.00 93852.22 13274.87 89.59 5.38E−04 C33B88 98.36 393148.13 481100.91 274293.53 94.81 8.25E−04 C33B66 98.71 444680.31 313288.41 56628.04 129.73 8.59E−04 C33B120 97.63 190036.14 60357.11 7054.28 92.94 1.40E−03 C33B64 98.13 200158.36 54138.77 7556.04 114.85 1.71E−03 C33B52 96.76 196557.09 46286.13 6751.01 82.46 3.13E−03 C33B56 95.59 143.73 79.73 111.95 138.04 4.02E−03 C33B75 98.68 163795.25 29603.57 4517.81 95.94 4.16E−03 C33B107 96.90 375388.25 339798.53 161369.64 86.54 4.44E−03 C33B63 98.79 247758.77 62221.71 9671.48 86.34 4.57E−03 C33B95 97.77 154556.58 44354.07 6402.00 87.38 5.99E−03 C33B61 98.87 198777.34 38699.10 5308.45 79.84 6.71E−03 C33B89 100.00 315.38 119.12 65.61 70.94 8.11E−03 C33B122 98.49 259183.69 84281.03 14291.17 65.01 8.74E−03 C33B62 99.05 157786.36 37359.44 6092.03 75.00 1.00E−02 C33B123 95.08 224078.95 88155.99 8864.39 71.05 1.03E−02 C33B54 100.00 147753.30 27461.06 3766.69 61.26 2.48E−02 60 nM Cyno 6 nM Cyno 0.6 nM Cyno 0 nM Cyno Cyno CD33 Prot. AA ID CD33 CD33 CD33 CD33 binding kD C33B48 56491.32 47326.85 43351.12 94.01 1.20E−04 C33B73 14799.14 6987.92 795.57 72.51 4.08E−04 C33B125 15603.45 11526.47 3458.27 70.22 3.51E−04 C33B55 16020.78 9994.42 2433.94 69.38 1.16E−04 C33B96 37273.19 20087.29 11574.59 86.31 8.19E−04 C33B124 593.00 132.19 77.26 98.41 4.77E−04 C33B72 19422.07 13975.14 3894.84 90.81 7.63E−04 C33B79 15538.97 6427.73 1082.85 63.59 6.82E−03 C33B77 17516.20 11665.49 3601.76 85.23 4.18E−04 C33B82 14269.38 6622.07 1540.09 84.24 6.70E−04 C33B87 19597.18 12652.44 3266.36 103.07 2.28E−04 C33B80 4612.58 248.60 108.93 82.38 2.66E−04 C33B101 48016.75 46115.96 17989.37 79.69 1.06E−04 C33B83 5304.40 687.44 159.37 87.35 2.17E−03 C33B46 49840.14 49816.36 49729.78 92.05 1.48E−04 C33B94 16126.84 10782.54 3183.70 87.82 5.37E−04 C33B88 50388.18 43928.95 43940.23 90.13 3.89E−04 C33B66 48905.04 49076.39 42160.22 77.96 9.33E−05 C33B120 13211.32 7865.37 2726.18 75.77 8.54E−04 C33B64 21109.59 9685.04 3102.56 99.82 1.21E−03 C33B52 12582.90 8444.39 2063.44 75.24 1.20E−03 C33B56 104.27 85.94 78.56 83.31 8.46E−04 C33B75 12194.41 5577.80 1709.40 124.32 1.20E−03 C33B107 50325.07 47810.05 36786.69 55.11 1.35E−04 C33B63 18322.71 11642.38 2879.89 87.94 9.47E−04 C33B95 14774.34 9594.12 1637.99 80.81 6.98E−03 C33B61 13552.71 8211.09 1595.90 106.84 1.83E−03 C33B89 47301.14 34193.78 23334.20 112.80 4.65E−05 C33B122 19740.29 13907.32 5838.25 82.53 1.45E−03 C33B62 12737.71 5620.17 1922.97 934.44 1.32E−03 C33B123 10665.93 10404.03 3232.18 61.08 2.74E−03 C33B54 50466.68 43011.75 38091.89 28785.80 1.35E−04
(252) The panel of mAbs was then further characterized for full affinity analysis as well as epitope binning. The binding of anti-CD33 mAbs to recombinant human CD33 ECD-HSA (C33W2) and cyno CD33 ECD-HSA (C33W1) was measured by ProteOn SPR (Bio-Rad). Goat anti-human Fc IgG (Jackson Immunoresearch, Cat #109-005-098) was directly immobilized via amine coupling at 30 gig/mL in acetate buffer, pH 5.0 on all 6 ligand channels in vertical orientation on a GLC Sensor Chip (Bio-Rad, catalog no. 176-5011) with a flow rate of 30 μL/min in PBS containing 0.005% TWEEN®-20. The immobilization densities averaged about 5000 Response Units (RU) with less than 5% variation among different channels. Different mAbs were captured on the anti-human Fc IgG surface at 0.25 or 0.5 μg/ml (160-300 RU) in vertical ligand orientation, with the 6.sup.th ligand channel as no ligand surface control. Human and cyno CD33-HSA proteins at 0.3 μM concentration in 3-fold dilution series of 5 concentrations flew in as analyte to bind to captured mAbs in the horizontal orientation. A buffer sample was also injected in the 6 channel to monitor the dissociation of captured mAb and baseline stability. The dissociation phase for all concentrations of human and cyno CD33-HSA was monitored at a flow rate of 100 μL/min for 15 minutes for binding to C33B782, 60 minutes for binding to C33B912 (identical to C33B904 with hIgG4), followed by regeneration using an 18 second pulse of 0.85% phosphoric acid to remove the antigen and the bound mAb. The raw biding data were processed by double referencing after subtracting the response data from: 1) the inter-spot to correct for the non-specific interactions between the Ag and the empty chip surface; 2) the buffer channel to correct for baseline drifting due to the dissociation of captured mAb surface over time. The processed data at all antigen concentrations for each mAb were globally fit to a 1:1 simple Langmuir binding model to extract estimates of the kinetic (k.sub.on, k.sub.off) and affinity (KD) constants.
(253) To determine whether the panel of mAbs all bind 1 distinct epitope or if there was broad epitope coverage, an epitope binning experiment was performed. Competitive epitope binning of CD33 mAbs was performed on an IBIS SPRi instrument (Carterra) using a CMD-200M sensor prism chip. Each anti-CD33 antibody was directly immobilized via amine coupling on the chip at 10 μg/ml in acetate buffer (pH 4.5) using a separate Continuous Flow Microspotter (CFM). Printed sensor chip was then transferred to the IBIS instrument for the binning analyses using a Classical or “Sandwich” binning format. Binning was performed by sequential injection of human CD33 ECD-HSA, (C33W2) at 50 nM followed by a single anti-CD33 mAb injection as competing analyte in solution at 133 nM to bind immobilized anti-CD33 mAbs with surface regeneration after each sequential injection cycle of antigen and antibody.
(254) To monitor the activity of the immobilized mAbs before and after regeneration, a buffer injection without any competing mAb was performed at the beginning and at the end of the experiment to measure the antigen alone binding activity. The response of competing mAb binding relative to the buffer (antigen alone) binding is an indication whether the antibody in solution blocks or sandwiches the antigen binding to the immobilized mAbs. The raw binning data (.trix file format) were referenced and zeroed using SprintX software (Wasatch, Ver 1.9.3.2), then exported (.ibmx file format) to the binning software HtTools.exe (Wasatch, version 2.0.0.33) for analyses. Data were curated by removing antibodies with antigen responses below 20 RU, and antibodies that did not self-block. Competing mAb responses were normalized relative to the antigen alone binding response. Antibodies with normalized responses <0.25 were denoted blockers, those with normalized responses ≥0.25 were denoted as non-blockers/Sandwichers. Different bins were predicted using a cut at height 2.5 on the combined dendrogram plot.
(255) The table below summarizes the full kinetic analysis and epitope binning of 32 select mAbs. There are a total of 8 anti-CD33 mAbs that have sub-nanomolar affinity for both human and cyno CD33 and these mAbs correspond to 3 distinct epitope bins while the larger panel has a range of affinities and 7 distinct epitope bins.
(256) TABLE-US-00005 TABLE 5 Full Kinetics Analysis and Epitope Binning of OMNIRAT ® derived mAbs Prot. AA ID V Region ID ka (1/Ms) kd (1/s) KD (M) Epitope Bin Human CD33 ECD-HSA C33B48 C33F53 1.62E+06 1.82E−05 1.12E−11 1 C33B46 C33F51 1.45E+06 1.99E−03 1.38E−09 1 C33B66 C33F71 3.85E+04 2.03E−03 5.29E−08 1 C33B107 C33F112 binding/no fit binding/no fit binding/no fit 1 C33B88 C33F93 binding/no fit binding/no fit binding/no fit 1 C33B96 C33F101 2.26E+05 4.36E−04 1.92E−09 3 C33B101 C33F106 1.62E+05 1.08E−03 6.64E−09 3 C33B73 C33F78 5.59E+05 5.59E−05 1.00E−10 4 C33B125 C33F130 9.92E+05 1.34E−04 1.40E−10 4 C33B55 C33F60 9.85E+05 2.53E−04 2.60E−10 4 C33B82 C33F87 4.45E+05 2.70E−04 6.10E−10 4 C33B83 C33F88 2.70E+05 5.21E−04 1.93E−09 4 C33B75 C33F80 3.85E+05 4.41E−03 1.14E−08 4 C33B123 C33F128 1.02E+06 1.52E−02 1.48E−08 4 C33B52 C33F57 2.06E+05 3.96E−03 1.92E−08 4 C33B61 C33F66 4.89E+05 1.05E−02 2.14E−08 4 C33B62 C33F67 5.07E+05 1.26E−02 2.49E−08 4 C33B64 C33F69 4.33E+05 2.21E−03 5.10E−09 4 C33B63 C33F68 5.33E+05 3.74E−03 7.01E−09 4 C33B122 C33F127 7.47E+05 7.12E−03 9.53E−09 4 C33B72 C33F77 8.71E+05 2.00E−04 2.30E−10 5 C33B79 C33F84 5.15E+05 3.90E−04 7.60E−10 5 C33B77 C33F82 8.28E+05 2.62E−04 3.20E−10 6 C33B87 C33F92 7.20E+05 4.32E−04 6.00E−10 6 C33B94 C33F99 9.22E+05 5.85E−04 6.30E−10 6 C33B95 C33F100 4.82E+05 7.40E−03 1.54E−08 6 C33B120 C33F125 5.75E+05 1.68E−03 2.93E−09 6 C33B89 C33F94 low binding low binding low binding 8 C33B54 C33F59 low binding low binding low binding 9 C33B124 C33F129 3.57E+05 1.24E−04 3.50E−10 NB C33B80 C33F85 3.23E+05 4.25E−04 1.32E−09 NB C33B56 C33F61 low binding low binding low binding NB Cyno CD33 ECD-HSA C33B48 C33F53 4.31E+06 1.58E−04 3.66E−11 1 C33B46 C33F51 2.97E+06 3.75E−04 1.26E−10 1 C33B66 C33F71 1.22E+06 2.66E−04 2.17E−10 1 C33B107 C33F112 3.31E+05 7.01E−05 2.12E−10 1 C33B88 C33F93 binding/no fit binding/no fit binding/no fit 1 C33B96 C33F101 binding/no fit binding/no fit binding/no fit 3 C33B101 C33F106 2.25E+05 2.69E−04 1.20E−09 3 C33B73 C33F78 6.00E+05 5.08E−04 8.46E−10 4 C33B125 C33F130 1.12E+06 3.39E−04 3.04E−10 4 C33B55 C33F60 1.16E+06 8.37E−05 7.23E−11 4 C33B82 C33F87 5.45E+05 7.51E−04 1.38E−09 4 C33B83 C33F88 2.47E+05 2.88E−03 1.17E−08 4 C33B75 C33F80 6.16E+05 1.32E−03 2.15E−09 4 C33B123 C33F128 1.26E+06 3.39E−03 2.69E−09 4 C33B52 C33F57 3.13E+05 1.48E−03 4.74E−09 4 C33B61 C33F66 7.34E+05 1.62E−03 2.21E−09 4 C33B62 C33F67 8.05E+05 1.49E−03 1.85E−09 4 C33B64 C33F69 5.90E+05 1.01E−03 1.71E−09 4 C33B63 C33F68 7.23E+05 8.80E−04 1.22E−09 4 C33B122 C33F127 binding/no fit binding/no fit binding/no fit 4 C33B72 C33F77 9.19E+05 5.40E−04 5.87E−10 5 C33B79 C33F84 5.48E+05 2.20E−03 4.01E−09 5 C33B77 C33F82 1.08E+06 2.66E−04 2.47E−10 6 C33B87 C33F92 1.12E+06 2.64E−04 2.36E−10 6 C33B94 C33F99 1.10E+06 5.20E−04 4.73E−10 6 C33B95 C33F100 8.44E+05 8.06E−03 9.56E−09 6 C33B120 C33F125 8.76E+05 9.02E−04 1.03E−09 6 C33B89 C33F94 2.65E+05 2.01E−04 7.60E−10 8 C33B54 C33F59 1.32E+06 6.37E−04 4.84E−10 9 C33B124 C33F129 4.67E+05 4.72E−04 1.01E−09 NB C33B80 C33F85 4.92E+05 2.59E−04 5.27E−10 NB C33B56 C33F61 low binding low binding low binding NB
(257) The ONIMOUSE® panel (8 mAbs total) was generated separately and characterized further for binding to cells. Cell binding was performed as described above and summarized in the table below. Of the 8 mAbs tested 6 bound directly to CD33 expressing cells while 2 did not.
(258) TABLE-US-00006 TABLE 6 Cell Binding of OMNIMOUSE ® derived mAbs to human and cyno expressing cell lines Parental Human CD33 mAb 60 nM 6 nM 0.6 nM 0 nM 60 nM 6 nM 0.6 nM 0 nM C33B909 253.50 206.04 169.77 119.51 176.49 170.25 154.00 191.28 C33B910 193.52 176.14 108.46 190.17 213.55 183.33 151.25 155.29 C33B911 1466.02 389.41 186.22 113.30 237954.27 100333.48 13501.02 114.07 C33B912 977.91 273.07 140.62 124.53 237140.86 101295.70 15726.96 149.54 C33B913 174.49 118.08 123.26 129.07 518952.00 409071.06 204694.14 127.82 C33B914 181.37 142.74 139.10 113.48 304350.88 315129.56 153252.58 185.45 C33B915 101.28 147.65 143.51 100.00 390477.25 362902.66 138398.56 112.22 C33B916 416.08 145.16 115.70 91.75 447815.47 404033.19 192941.55 167.07 Cyno CD33 mAb 60 nM 6 nM 0.6 nM 0 nM C33B909 180.33 135.33 115.73 124.03 C33B910 202.42 135.18 116.71 175.97 C33B911 17036.56 7729.14 1935.16 97.94 C33B912 15070.88 7271.38 1726.03 124.69 C33B913 40661.90 36920.95 35224.10 106.19 C33B914 44964.85 33368.26 22086.01 86.76 C33B915 37495.34 35692.21 36165.59 113.92 C33B916 41004.43 33294.78 22790.61 104.43
(259) The 6 mAbs that bound CD33 on cells were further characterized biophysically via full kinetic analysis to recombinant antigen using the methods described above and summarized in the table below. Of the 6 mAbs tested, 1 bound to human CD33 with a picomolar affinity (C33B912) and subnamolar for cyno CD33, while 1 had very strong affinity for human CD33 but only nanomolar affinity towards cyno CD33 (C33B911). Two more clones were subnanomolar for both human and cyno CD33 (C33B913 and C33B916), but neither affinity was in the range of C33B912.
(260) TABLE-US-00007 TABLE 7 Full Kinetics Analysis of OMNIMOUSE ® derived mAbs Human CD33 ECD-HSA Cyno CD33 ECD-HSA mAb ka (1/Ms) kd (1/s) KD (M) ka (1/Ms) kd (1/s) KD (M) C33B911 1.10E+06 4.14E−05 3.78E−11 1.15E+06 1.15E−03 1.00E−09 C33B912 1.42E+06 4.29E−05 3.02E−11 1.50E+06 6.50E−04 4.33E−10 C33B913 6.60E+05 6.40E−04 9.69E−10 2.56E+06 3.08E−04 1.20E−10 C33B914 4.44E+05 9.80E−03 2.21E−08 5.29E+05 2.33E−04 4.40E−10 C33B915 2.18E+05 9.89E−04 4.53E−09 3.81E+06 8.93E−05 2.34E−11 C33B916 6.27E+05 4.11E−04 6.55E−10 4.73E+05 4.03E−04 8.52E−10
(261) An epitope binning experiment was performed on the 6 cell binding mAbs derived from OMNIMOUSE® along with several control mAbs previously identified in the earlier OMNIRAT® campaign. The control mAbs were chosen based on their subnanomolar affinity towards human CD33 and the number of distinct epitope bins. The binning software HtTools assigns Epitope Bin numbers on a per experiment basis and therefore having several controls to already defined epitope bins was critical for cross-comparison. The two OMNIMOUSE® derived human CD33 high affinity clones (C33B911 and C33B912) both binned with clones from bin 4 above (bin 4 in this experiment) while the subnanomolar clone (C33B916) binned into 2 here along with C33B836 (bin 1 in the above experiment).
(262) TABLE-US-00008 TABLE 8 Epitope Bins of OMNIMOUSE ® anti-CD33 mAbs mAb V region ID Epitope Bin C33B915 C33F553 1 C33B916 C33F554 2 C33B836 C33F53 2 C33B914 C33F552 2 C33B913 C33F551 3 C33B806 C33F106 3 C33B911 C33F549 4 C33B912 C33F550 4 C33B778 C33F78 4 C33B830 C33F130 4 C33B782 C33F82 5 C33B792 C33F92 5 C33B799 C33F99 5 C33B760 C33F60 6 C33B777 C33F77 7
(263) CD33 is comprised of 2 IgG domains, the membrane distal V domain and the membrane proximal C2 domain. The SNP rs12459419 can cause the selective alternative splicing of the CD33 pre-mRNA transcript to yield a C2 only form expressed on cells and therefore targeting this domain can provide clinical benefit. To ascertain which of the two domains, the mAbs were capable of binding, an off-rate screen was performed following the protocol above on 6 mAbs with the highest binding capability that covered 4 distinct epitope bins using Human CD33 ECD-HSA, Human CD33 V-HSA and Human CD33 C2-HSA as the binding antigens. As shown in the table below, the two clones previously grouped in bin 4 both bound to the huCD33 C2 domain but not the huCD33 V domain, while the clones in bin 2 and 3 bound the V domain but not the C2 domain. Two clones grouped into bin 5 did not bind either domain, and, therefore, their exact binding location could span the two domains. Three (3) commercially available mAbs were included in this experiment (WM53 (EMD MILLIPORE®; Darmstadt, Germany), P67.7 (BIOLEGEND®, San Diego, Calif.), and LSBio clone 906 (LIFESPAN BIOSCIENCES®, Seattle, Wash.)) and all showed binding to the V domain, but not the C2 domain. Looking at the epitope bins in Tables 5 and 8 in relation to the C2 domain binding data in Table 9, there are a total of 15 mAbs that could potentially bind the C2 domain ranging in affinities from ˜25 nM to ˜30 μM on the human full length protein.
(264) TABLE-US-00009 TABLE 9 Off-rate Domain Binding huCD33 huCD33- huCD33- ECD-HSA V-HSA C2-HSA Epitope Protein ID kd (1/s) kd (1/s) kd (1/s) Bin C33B912 1.29E−05 No/low 6.68E−05 4 binding response C33B778 4.72E−05 No/low 2.57E−03 4 binding response C33B782 2.58E−04 No/low No/low 5 binding binding response response C33B792 4.27E−04 No/low No/low 5 binding binding response response C33B836 5.52E−05 3.71E−05 No/low 2 binding response C33B806 1.36E−03 3.18E−03 No/low 3 binding response WM53 2.37E−03 3.78E−02 No/low binding response P67.7 1.05E−03 2.43E−03 No/low binding response LSBio clone 2.45E−03 4.34E−02 No/low 906 binding response
(265) To support further in vivo and in vitro studies, select clones (C33B836, C33B782, C33B778, C33B904, C33B806, C33B830, C33B937, C33B792, C33B760, and C33B777) were chosen for scale-up and fab arm exchange to produce bi-specific DUOBODY® molecules with anti-CD3 antibodies. EXPICHO-S™ cells (THERMO FISHER SCIENTIFIC®) were seeded at 1.25×10.sup.5-2.25×10.sup.5 viable cells/mL in EXPICHO™ Expression Medium and cultured in polycarbonate, disposable, sterile, vented, non-baffled Erlenmeyer shake flasks in a 37° C., 7% CO.sub.2 shaker incubator (INFORS HT™ MULTITRON PRO™). For routine cell growth in 125 mL-2 L shake flasks, the shake speed was set to 130 rpm for shakers with a 19 mm shaking diameter. Cells were sub-cultured when the density reached log phase growth at 4×10.sup.6-6×10.sup.6 viable cells/mL with a 98-99% viability.
(266) Two days before transfection, EXPICHO-S™ cells were seeded at 1.5×10.sup.6 viable cells/mL for the required culture volume. On the day of transfection, the viable cell density and percent viability was determined. Cells were transfected at a density of 6×10.sup.6 viable cells/mL. For optimal transfection, sterile heavy and light chain plasmid DNA at ≥1 mg/mL concentration in TE buffer (10 mM Tris-HCl, 1 mM EDTA, pH 8.0) was used.
(267) EXPICHO-S™ cells were transfected following manufacturer's Max Titer Transfection protocol (THERMO FISHER SCIENTIFIC® Publication Number MAN0014337). All amounts and volumes shown below were per mL of the final transfected culture volume. Briefly, plasmid DNA was diluted with 0.04 mL cold OptiPRO™ medium (THERMO FISHER SCIENTIFIC®) at the following ratio: 0.125 μg Heavy Chain DNA: 0.375 μg Light Chain DNA: 0.5 μg pAdvantage. 6.4 μL of EXPIFECTAMINE™ CHO Transfection Reagent was diluted and mixed gently with 0.04 mL cold OptiPRO™ medium and incubated for 1 min. The diluted EXPIFECTAMINE™ CHO Reagent was added to the diluted DNA, mixed gently and the EXPIFECTAMINE™ CHO/plasmid DNA complexes were incubated at room temperature for 5 minutes. Post-incubation, the complexes were added to the EXPICHO-S™ cells in a shaker flask and incubated overnight in a 37° C., 7% CO.sub.2 shaker incubator.
(268) For the Max Titer protocol, on Day 1 post-transfection, 6 μL EXPIFECTAMINE™ CHO Enhancer and 160 μL EXPICHO-S™ Feed were added and the flask was transferred to a 32° C., 7% CO.sub.2 shaker incubator. On Day 5 post-transfection, 160 μL of EXPICHO-S™ Feed was added for the second time to the flask and returned to the 32° C. incubator with shaking. The culture was harvested on Day 12 post-transfection, centrifuged at 5000 rpm for 15 mins and clarified through a 0.2 nm ACROPAK™ 1500 filter capsule (PALL®).
(269) Expressed antibodies were purified from the clarified supernatants using MABSELECT SURE™ Resin (GE® Healthcare). MABSELECT SURE™ Protein A columns were equilibrated with 1×D-PBS, pH 7.2 prior to loading individual culture supernatants. Unbound proteins were removed by washing extensively with 1×D-PBS, pH 7.2. Bound proteins were eluted with 0.1 M Na-acetate, pH 3.5. Peak fractions were neutralized with 2.5M Tris pH 7.2 and pooled. The neutralized fraction pools were either dialyzed into 1×dPBS for assays and biophysical characterization or utilized for bispecific DUOBODY® assembly.
(270) The protein concentration for each elution pool was determined by measuring absorbance at OD280 nm and calculated using absorbance extinction coefficient based on the amino acid sequence.
Example 3: Fab-Arm Exchange Using Purified Parental mAbs
(271) The formation of the CD33×CD3 bispecific antibodies requires two parental mAbs, one specific for the targeting arm (e.g. CD33) and one specific for the effector arm (e.g. CD3). CD33 mAbs were recombined with a high affinity (CD3B219) or low affinity CD3 arm (CD3B376) arms. These parental mAbs are in the IgG4 PAA format (Labrijn et al, 2013) where the targeting parent (CD33) contains the K409R mutation (native amino acid for IgG4), while the killing parent (CD3) contains the F405L mutation and R409K. The monospecific anti-CD3 antibody was expressed as IgG4, having Fc substitutions S228P, F234A, L235A, F405L, and R409K (CD3 arm) (numbering according to EU index) in their Fc regions. The monospecific antibodies were expressed and purified as described above. Post purification the parental CD33 antibodies were mixed with the desired parental CD3 antibody under reducing conditions in 75 mM cysteamine-HCl and incubated at 31° C. for 5 hours. The recombination reactions were based on molar ratios, where a set amount of CD33 antibody (e.g., 10 mg, or ˜74.6 nanomoles) was combined with CD3 antibody (e.g., ˜67.8 nanomoles), where the CD33 antibody was added in a 6% excess of the CD3 antibody. The concentrations of the CD33 antibody stocks varied from 0.8 to 6 mg/mL, and the volumes of the recombination reactions varied for each pairing. The recombination reactions were subsequently dialyzed overnight against PBS to remove the reductant. The CD33×CD3 bispecific antibody reactions were performed with an excess of the CD33 antibody (ratio) to minimize the amount of unreacted CD3 parental antibody remaining after recombination.
(272) The final CD33×CD3 bispecific antibodies produced, along with the parental mAbs (i.e. CD33, CD3, or Null) used in the recombination reactions are listed in Table 10.
(273) Selected CD33 hits were also paired with a non-killing arm (Null) to create negative controls for testing purposes. For control bispecific antibodies, B2M1, an RSV antibody in the IgG4 PAA format was generated, purified and, combined with either the CD3 arms CD3B219 and CD3B376-F405L, R409K to generate CD3B288 (CD3×Null) and CD3B510 (CD3B376×Null) or CD33 arms, C33B836, C33B806, C33B782, C33B792, C33B760, C33B830, C33B799, C33B778, C33B777 to generate C33B941, C33B943, C33B946, C33B945, C33B949, C33B942, C33B944, C33B947, C33B948, respectively (CD33×Null).
(274) TABLE-US-00010 TABLE 10 CD33 × CD3 bispecific antibodies HC Pep HC Nuc LC Pep LC Nuc Bispec Ab Parental HC Pep ID SEQ ID SEQ ID LC Pep ID SEQ ID SEQ ID C3CB7 C33B836 C33H80 52 94 C33L73 136 178 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB5 C33B830 C33H84 51 93 C33L66 135 177 CD3B219 CD3H141 244 147 CD3L66 250 253 C3CB4 C33B806 C33H69 50 92 C4LL152 134 176 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB16 C33B799 C33H98 49 91 C33L69 133 175 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB14 C33B792 C33H87 48 90 C33L35 132 174 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB12 C33B782 C33H72 47 89 C33L40 131 173 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB11 C33B778 C33H66 46 88 C33L60 130 172 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB10 C33B777 C33H65 45 86 C33L47 129 171 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB8 C33B760 C33H45 44 85 C33L11 128 170 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB97 C33B836 C33H80 52 94 C33L73 136 178 CD3B376 CD3H219 245 248 CD3L150 251 254 C3CB98 C33B830 C33H84 51 93 C33L66 135 177 CD3B376 CD3H219 245 248 CD3L150 251 254 C3CB99 C33B806 C33H69 50 92 C4LL152 134 176 CD3B376 CD3H219 245 248 CD3L150 251 254 C3CB100 C33B799 C33H98 49 91 C33L69 133 175 CD3B376 CD3H219 245 248 CD3L150 251 254 C3CB101 C33B792 C33H87 48 90 C33L35 132 174 CD3B376 CD3H219 245 248 CD3L150 251 254 C3CB102 C33B782 C33H72 47 89 C33L40 131 173 CD3B376 CD3H219 245 248 CD3L150 251 254 C3CB103 C33B778 C33H66 46 88 C33L60 130 172 CD3B376 CD3H219 245 248 CD3L150 251 254 C3CB104 C33B777 C33H65 45 86 C33L47 129 171 CD3B376 CD3H219 245 248 CD3L150 251 254 C3CB105 C33B760 C33H45 44 85 C33L11 128 170 CD3B376 CD3H219 245 248 CD3L150 251 254 C33B941 C33B836 C33H80 52 94 C33L73 136 178 B23B49 B23H1 246 249 B23L3 252 255 C33B942 C33B830 C33H84 51 93 C33L66 135 177 B23B49 B23H1 246 249 B23L3 252 255 C33B943 C33B806 C33H69 50 92 C4LL152 134 176 B23B49 B23H1 246 249 B23L3 252 255 C33B944 C33B799 C33H98 49 91 C33L69 133 175 B23B49 B23H1 246 249 B23L3 252 255 C33B945 C33B792 C33H87 48 90 C33L35 132 174 B23B49 B23H1 246 249 B23L3 252 255 C33B946 C33B782 C33H72 47 89 C33L40 131 173 B23B49 B23H1 246 249 B23L3 252 255 C33B947 C33B778 C33H66 46 88 C33L60 130 172 B23B49 B23H1 246 249 B23L3 252 255 C33B948 C33B777 C33H65 45 86 C33L47 129 171 B23B49 B23H1 246 249 B23L3 252 255 C33B949 C33B760 C33H45 44 85 C33L11 128 170 B23B49 B23H1 246 249 B23L3 252 255 CD3B288 B23B39 B23H1 246 249 B23L3 252 255 CD3B219 CD3H141 244 247 CD3L66 250 253 CD3B510 B23B39 B23H1 246 249 B23L3 252 255 CD3B376 CD3H219 245 248 CD3L150 251 254 C3CB87 C33B903 C33H251 182 198 C33L117 214 230 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB88 C33B904 C33H252 183 199 C33L118 215 231 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB89 C33B905 C33H253 184 200 C33L119 216 232 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB90 C33B907 C33H255 186 202 C33L121 218 234 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB91 C33B908 C33H256 187 203 C33L122 219 235 CD3B219 CD3H141 244 247 CD3L66 250 253 C3CB189 C33B904 C33H252 183 199 C33L118 215 231 CD3B376 CD3H219 245 248 CD3L150 251 254 Pep: Peptide; Nuc: Nucleotide; SEQ ID: SEQ ID NO
Example 4: In Vitro T Cell Mediated Cytotoxicity Assays with CD33×CD3 Bispecific Antibodies
(275) In vitro T cell mediated cytotoxicity assays were performed to assess whether CD33 hits paired with CD3 arm (CD3B219) mediate killing of CD33 expressing AML cell line OCI-AML5. Briefly, effector cells (pan T cells purchased from BIOLOGICAL SPECIALTY®) were harvested, counted, washed, and resuspended to 1×10.sup.6 cells/ml in RPMI (INVITROGEN®) with 10% FBS (INVITROGEN®) cell media. Target cells (MOLM13) were labeled with CFSE (INVITROGEN®) and resuspended to 2×10.sup.5 cells/mL in RPMI with 10% FBS. Effectors and CFSE-labeled target cells were mixed at E:T=5:1 in sterile 96-well round bottom plates. 10 μL of Fc block (REOPRO® Fc fragment) along with a 5 μL aliquot of bispecific antibody was added to each well containing various concentrations. Cultures were incubated at 37° C. for 48 hours under 5% CO.sub.2. After 48 hr, the LIVE/DEAD® Fixable Near-IR Dead Cell Stain buffer (LIFE TECHNOLOGIES™) was added to samples and cultures were incubated for 20 min in the dark at RT, washed, and resuspended in 100-200 μL FACs buffer. The drug-induced cytotoxicity was determined using CANTO™ II flow cytometer (BD® Biosciences; Franklin Lakes, N.J.) and analyzed with FLOWJO™ Software or Dive software (BD® Biosciences). The population of interest is the double positive CFSE+/live/dead+ cells. As shown in
(276) TABLE-US-00011 TABLE 11 CD33 × CD3 T-cell mediated cytotoxicity assays. Summary of EC.sub.50 values for 13 CD33×CD3 bispecific antibodies Leads C3CB8 C3CB10 C3CB28 C3CB12 C3CB14 C3CB16 C3CB5 C3CB7 Cytotoxicity 0.513 0.4728 0.6041 0.2677 0.538 0.6669 1.262 0.02129 EC.sub.50 (nM) Leads C3CB87 C3CB88 C3CB89 C3CB90 C3CB91 Cytotoxicity 0.067 0.11 0.41 10.56 0.35 EC.sub.50 (nM)
Example 5: Ex Vivo CD33×CD3 Mediated Reduction of AML Blasts and T Cell Activation in an AML Primary Sample
(277) To further assess the cytotoxicity potential of CD33×CD3 bispecific antibodies, an ex vivo cytotoxicity assay was performed using AML patient whole blood using the top four antibodies (
(278) As shown in
(279) TABLE-US-00012 TABLE 12 CD33 × CD3 T-cell mediated ex vivo cytotoxicity assays. Summary of the EC.sub.50 values for 8 CD33 × CD3 bispecific antibodies Primary AML Cell Killing Bispecifc Ab ID EC.sub.50 (nM) C3CB11 3.958 C3CB12 2.635 C3CB7 0.3315 C3CB88 0.6722 C3CB103 4.186 C3CB102 4.973 C3CB97 ~0.2316 C3CB189 0.5782
Example 6: Demonstration that the CD33×CD3 Bispecific Antibodies Binds to the C2 Domains of CD33 and Induces Cytotoxicity of CD33 Single Nucleotide Polymorphism (SNP) Expressing Cell Lines
(280) In Vitro T Cell Mediated Cytotoxicity Assays with CD33×CD3 Bispecific Antibodies
(281) Recent studies showed that a single nucleotide polymorphism (SNP) rs12459419 was present in ˜50% of the AML population and leads to skipping of exon 2 of CD33 which results in the deletion of the V domain of CD33. This study also showed that MYLOTARG™ which binds to the V domain of CD33, had no efficacy in patients that express the SNP, and, therefore, reduced risk of relapse and improved survival in ˜50% of the AML population (Lamba et al 2017, JCO, CD33 Splicing Polymorphism Determines Gemtuzumab Ozogamicin Response in De Novo Acute Myeloid Leukemia: Report From Randomized Phase III Children's Oncology Group Trial AAML0531). Given the data with MYLOTARG™ in the above mentioned study, in vitro T cell mediated cytotoxicity assays were performed to assess whether CD33 hits (V binding C33B836 vs C2 binding C33B904) paired with CD3 arms (CD3B219 or CD3B376) mediate killing of SNP rs12459419 expressing cell lines. Briefly, effector cells (pan T cells purchased from BIOLOGICAL SPECIALTY®) were harvested, counted, washed, and resuspended to 1×10.sup.6 cells/ml in RPMI (INVITROGEN®) with 10% FBS (INVTTROGEN®) cell media. Target cells (KG1, SH2 and OCIAML3) were labeled with CFSE (INVITROGEN®) and resuspended to 2×10.sup.5 cells/mL in RPMI with 10% FBS. KG1, SH2 and OCIAML3 were chosen to represent wildtype, heterozygous and homozygous for the CD33 SNP rs12459419 mutation, respectively. Effectors and CFSE-labeled target cells were mixed at effector:target ratio (E:T)=5:1 in sterile 96-well round bottom plates. 10 μl of Fc block (REOPRO® Fc fragment) along with 5 μL aliquot of bispecific antibody was added to each well containing various concentrations. Cultures were incubated at 37° C. for 48 hours under 5% CO.sub.2. After 48 hrs, the LIVE/DEAD® Fixable Near-IR Dead Cell Stain buffer (LIFE TECHNOLOGIES™) was added to samples and cultures were incubated for 20 min in the dark at RT, washed, and resuspended in 100-200 μL FACs buffer. The drug-induced cytotoxicity was determined using CANTO™ II flow cytometer (BD® Biosciences) and analyzed with FLOWJO™ Software or Dive software (BD® Biosciences). The population of interest is the double positive CFSE+/live/dead+ cells. As shown in
Example 7: Ex Vivo CD33×CD3 Mediated Reduction of Spiked in MOLM-13 and Monocytes in an Ex Vivo Whole Blood MOLM-13 Cytotoxicity Assay
(282) To assess the cytotoxicity potential of CD33×CD3 bispecific antibodies at eliminating spiked in MOLM-13 cells and normal human monocytes, an ex vivo cytotoxicity assay using normal healthy human whole blood with exogenously added CD33.sup.+ AML cell line MOLM-13 was utilized. Similar to the above experiment, various bispecific antibodies (CD33 antibodies paired with either CD3 arm CD3B219 and CD3B376) were added to diluted whole blood from 6 different normal human donors for a period of 48 hr without providing additional T-cells, since this assay relies on the presence of autologous T-cells in the donor's blood. Prior to dilution, the concentration of T cells in the blood of each donor was enumerated. The blood was then diluted with CFSE ( ) labeled MOLM-13 cells, such that effector:target ratio (E:T) is 1:5 to mimic the effector: target ratio in AML patient samples. At 48 hs, the samples were stained with CD3 PerCPCy5.5, CD25 PE, CD33 FITC and CD14 Pacific Blue (all antibodies were purchased from BIOLEGEND®). The samples were then washed at least 3 times in 1× Lyse RBC Lysis Buffer (EBIOSCIENCE®). The samples were then stained with the LIVE/DEAD® Fixable Near-IR Dead Cell Stain buffer (LIFE TECHNOLOGIES™). The extent of tumor cytotoxicity was determined by first quantifying the live CD33.sup.+ cells in the fraction of CD14.sup.+ monocytes in the presence of the bispecific antibodies. Cytotoxicity of MOLM-13 cells was determined by enumerating the percentage of dead CFSE.sup.+ cells. Cytotoxicity of monocytes was calculated as a percentage relative to PBS/untreated control using the following equation: (% CD33.sup.+ CD14.sup.+ in PBS/untreated control−% CD33.sup.+ CD14.sup.+ in treated sample)/(% CD33.sup.+ CD14.sup.+ in PBS/untreated control). The data in
(283) TABLE-US-00013 TABLE 13 CD33 × CD3 T-cell mediated ex vivo cytotoxicity assays. Summary of EC.sub.50 values for 2 CD33 × CD3 bispecific antibodies. Bispecific MOLM13 CD33.sup.+ CD14.sup.+ Ab ID Killing EC.sub.50 (nM) Killing EC.sub.50 (nM) C3CB189 0.1677 1.156 C3CB88 0.671 0.506
Example 8: Demonstration of Species Cross-Reactivity of CD33×CD3 Bispecific Antibodies to Cynomolgus Monkey
(284) Ex Vivo CD33×CD3 Mediated Reduction of Monocytes in an Ex Vivo Cytotoxicity Assay with Cynomolgus Whole Blood
(285) To demonstrate functional cross-reactivity and to assess the cytotoxicity potential of CD33×CD3 bispecific antibodies at eliminating normal cynomolgus monocytes, an ex vivo cytotoxicity assay using healthy cynomolgus whole blood was utilized. Similar to the above experiment, various bispecific antibodies (CD33 antibodies paired with either CD3 arm CD3B219 and CD3B376) were added to diluted whole blood from 6 different normal cynomolgus monkey donors for a period of 48 hr without providing additional T-cells, since this assay relies on the presence of autologous T-cells in the donor's blood. At 48 hrs, the samples were stained with CD3 PerCPCy5.5, CD25 PE, CD33 FITC and CD14 Pacific Blue (all antibodies were purchased from BIOLEGEND® except for the CD33 antibody which was purchased from Miltenyi; Bergisch Gladbach, Germany). The samples were then washed at least 3 times in 1× Lyse RBC Lysis Buffer (EBIOSCIENCE®) prior to staining with the LIVE/DEAD® Fixable Near-IR Dead Cell Stain buffer (LIFE TECHNOLOGIES™). The extent of monocyte cytotoxicity was determined by first quantifying the live CD33.sup.+ cells in the fraction of CD4.sup.+ monocytes in the presence of the bispecific antibodies. Cytotoxicity was calculated as a percentage relative to PBS/untreated control using the following equation: (% CD33.sup.+CD14.sup.+ in PBS/untreated control−% CD33.sup.+ CD4.sup.+ in treated sample)/(% CD33.sup.+ CD14.sup.+ in PBS/untreated control). T cell activation was calculated as a percentage of CD25.sup.+ events in CD3.sup.+ fraction. The data in
(286) TABLE-US-00014 TABLE 14 CD33 × CD3 T-cell mediated ex vivo cytotoxicity assays. Summary of the EC.sub.50 values for 2 CD33 × CD3 bispecific antibodies. Protein CD33.sup.+ CD14.sup.+ T cell activation AA ID Killing EC.sub.50 (nM) EC.sub.50 (nM) C3CB189 3.60 0.02 C3CB88 0.89 0.02
Example 9: Efficacy of C3CB189 and C3CB88 in MOLM-13 Human AML Xenografts in T Cell Humanized NSG Mice
(287) Efficacy of C3CB189 and C3CB88 was evaluated in established luciferase-transfected disseminated MOLM-13 human acute myeloid leukemia (AML) xenografts in female NOD.Cg-Prkdc.sup.scid Il2rg.sup.tm1Wjl/SzJ (NSG) mice humanized with 20 million T cells. Animals were randomized into n=10/group by live bioluminescence imaging (BLI) on day 5 post-i.v. tumor implantation. C3CB189 and C3CB88 at 0.005, 0.05 and 0.5 mg/kg or Null×CD3 antibody control at 0.5 mg/kg were dosed i.p. every 3-4 days for 6 weeks.
(288) On day 13 post-tumor implantation, when at least eight animals remained per group, tumor growth inhibition (% TGI) as determined by bioluminescence was calculated. Statistically significant tumor growth inhibition was observed with C3CB189 (
(289) Treatment with C3CB189 and C3CB88 resulted in reduced tumor burden and increased life span (ILS) greater than the 16-day median survival of the Null×CD3 control group. Animals treated with C3CB189 had a median survival of 19-27.5 days (
Example 10: Demonstration of Internalization of CD33 Antibodies in an In Vitro Protein a Drug Conjugate Cell Viability Assay
(290) An in vitro cell viability assay using pre-loaded protein A drug conjugate, A-MMAF, was performed to detect internalization of ligand-bound target antibodies. This cell-based functional assay was performed with a panel of anti-CD33 antibodies, C33B782, C33B806, C33B836, C33B904, C33B937, and an isotype control antibody CNTO9412 in an AML cell line MOLM13. The target antibody alone was tested as a control in this assay to differentiate cytotoxicity due to antibody internalization and cytotoxicity due to the activity of the test antibodies on their own.
(291) The results also indicated that antibody C33B836 has better internalization in MOLM13 cells than others.
(292) TABLE-US-00015 TABLE 14 CD33 internalization assays. Summary of the EC.sub.50 values for five anti-CD33 antibodies. C33B782 C33B806 C33B836 C33B904 C33B937 CNTO9412 EC.sub.50 (nM) 0.88 0.22 0.04 0.96 1.92
Example 11: Demonstration that the CD33 Antibodies can Mediate ADCC Activity
(293) To characterize the antibody-dependent cell-mediated cytotoxicity (ADCC) activity of anti-CD33 mAbs, in vitro ADCC assays were conducted utilizing healthy donor NK effector cells and MOLM-13 and MV4-11 AML target cells. Healthy donor NK cells (BIOLOGICAL SPECIALTY® Corporation donor CC00061 and M7015; Colmar, Pa.) were plated in MYELOCULT™ H5100 growth media (STEMCELL TECHNOLOGIES™; Vancouver, Calif.) supplemented with 1×10.sup.−6 M hydrocortisone (STEMCELL TECHNOLOGIES™), 7.5 ng/ml recombinant human IL-2 (R&D Systems; Minneapolis, Minn.), 1% sodium pyruvate (LIFE TECHNOLOGIES™), 1% non-essential amino acids (LIFE TECHNOLOGIES™), 1% penicillin streptomycin (LIFE TECHNOLOGIES™) 16-24 hours prior to initiating ADCC assays. The day of the assay, 1×10.sup.6 cells/ml of MOLM-13 and MV4-11 cells were labeled with 10 μM calcein AM at 37° C. for 30 minutes. After labeling, cells were washed three times to remove excess calcein AM. Subsequently, 1×10.sup.5 calcein AM labeled MOLM-13 or MV4-11 target cells were incubated for 1.5 hours at 37° C. with healthy donor NK cells (3×10.sup.5) in the presence of varying concentrations of anti-CD33 antibodies. Maximum lysis control samples were generated by addition of TRITON®-X100 to designated control sample wells at a final concentration of 0.5%. Calcein AM release was measured by fluorescence at 485-535 nm with a SPECTRAMAX® M5 multimode plate reader (MOLECULAR DEVICES®, LLC; Sunnyvale, Calif., USA). Percent cell lysis was determined by normalizing the data to maximal (TRITON® X100 mediated) and minimal (effector cells alone) lysis using the following equation. % Lysis=[(Experimental lysis−Spontaneous lysis)/(Max Lysis−Spontaneous lysis)]*100.
(294) IgG1 low fucose anti-CD33 antibodies induced ADCC in a concentration dependent manner (
(295) TABLE-US-00016 TABLE 16 CD33 ADCC assays. Summary of the EC.sub.50 values for 2 anti- CD33 antibodies and 2 cell lines EC.sub.50 ADCC EC.sub.50 ADCC C33B48.CLF (nM) C33B912.CLF (nM) MOLM-13 0.023 0.292 MV4-11 0.113 2.008
Example 12: Binding Characteristics of C3CB189 Antibody that Targets CD33, an Antigen Abundantly Expressed by Leukemic Blasts
(296) C3CB189 is a fully human immunoglobulin G (IgG)4-PAA bispecific antibody targeting the CD3 receptor complex on T cells and CD33 on myeloid cells. C3CB189 binds to human recombinant (r)CD33 with an affinity (K.sub.d) of 0.89 μM and to cynomolgus (cyno) rCD33 with an affinity (K.sub.d) of 363 μM. C3CB189 also binds to human and cyno monkey rCD3ε with affinities (K.sub.d) of 151.32 and 43.83 nM, respectively. C3CB189 bound specifically to CD33 expressing AML cells lines KG-1, MOLM-13, Kasumi-1 and OCI-AML3 (
Example 13: C3CB189 Kills CD33.SUP.+ AML Cell Lines and Activates T Cells In Vitro
(297) A T cell mediated cytotoxicity assay was next used to evaluate the activity of C3CB189 in vitro in various cell lines including CD33.sup.+ cell lines such as MOLM-13, KG-1, SKNO-1, Kasumi-1, and OCI-AML3 as well as CD33.sup.no/low cell lines such as CARNAVAL and KG1ACD33. The assays were set up with isolated pan human CD3.sup.+ T cells from six healthy donors and fragment crystallizable region (Fc) blocker. An Fc blocker was added to prevent Fc-mediated recruitment of C3CB189 since the PAA mutations in the IgG4 Fc region do not render it completely silent (Vafa et al., 2014) and because Fc gamma receptors (FcγR) are often expressed on AML cells (Ball et al., 1989).
(298) As seen in
(299) The extent of T cell activation induced by C3CB189 in the presence of CD33′ tumor cell lines was also evaluated in vitro in the cytotoxicity assays, with CD25 expression measured as an indicator of activation. As shown in
(300) Lastly, cytokine responses were also assessed in the above in vitro T cell redirection assay with Kasumi-1 cell line. C3CB189 led to the secretion of several cytokines including interferon gamma (IFN-γ), tumor necrosis factor alpha (TNF-α), interleukin (IL)-2, and IL-8. These data are consistent with the cytotoxicity and T cell activation data shown in
(301) TABLE-US-00017 TABLE 17 Effective concentration values for C3CB189-mediated cytokine release in a T cell redirection assay with purified T Cells and Kasumi-1 target cells. EC values are in nM. n represents the number of donors out of 6 for which EC values could be determined. Median Median Median Cytokine n EC.sub.20 EC.sub.50 EC.sub.90 IFN- 6 0.048 0.16 1.409 gamma IL-1beta 6 0.013 0.045 0.226 IL-2 4 0.090 0.346 5.282 IL-4 4 0.054 0.078 0.153 IL-8 6 0.015 0.042 0.246 IL-10 6 0.052 0.123 1.271 IL-13 5 0.008 0.034 0.103 TNF- 6 0.049 0.208 3.530 alpha
Example 14: C3CB189 Shows Effective Anti-Tumor Activity In Vivo
(302) The function of C3CB189 in two established xenograft tumor models in T cell humanized NSG mice was evaluated. In established subcutaneous KG-1 tumor-bearing mice, treatment with C3CB189 at 0.1, 0.5, and 1 mg/kg elicited tumor growth inhibition of 41%, 92%, and 87%, respectively, compared with null×CD3 treated control animals (p<0.0001 for 0.5 and 1 mg/kg,
(303) In the established disseminated luciferase expressing MOLM-13 model (MOLM-13-luc), C3CB189 treatment was initiated after homing of AML cells to bone marrow (BM) was confirmed following intravenous injection. C3CB189 at 0.005, 0.05, and 0.5 mg/kg was administered every 3 to 4 days significantly inhibited tumor growth as assessed by bioluminescence (76%, 100%, and 82%, respectively) compared with null×CD3 control treated mice (
(304) Furthermore, MOLM-13-luc tumor-bearing mice treated with C3CB189 at 0.05 mg/kg, and to a lesser extent at 0.005 mg/kg, showed decreased tumor cells and increased CD3.sup.+ T cell infiltration in the bone marrow as measured by flow cytometry (
Example 15: C3CB189 Mediates Cytotoxicity of AML Cells Spiked in Healthy Whole Blood as Well as AML Blasts from Primary Patient Samples
(305) The extracellular domain (ECD) of CD33 is reported to be shed from cells; therefore normal and patient samples could contain soluble CD33 (sCD33). A study showed that there is approximately 4-30 ng/mL of sCD33 detected in the plasma of AML patients (Biedermann, B., Gil, D., Bowen, D. T., and Crocker, P. R. (2007). Leuk Res 31, 211-220.). This value is higher than 0.6-5.8 ng/mL concentration determined in healthy human serum (Biedermann, B., Gil, D., Bowen, D. T., and Crocker, P. R. (2007). Leuk Res 31, 211-220.).
(306) To determine the physiological sCD33 levels in normal and AML donors, an immunocapture coupled mass spectrometry (MS) assay was developed. Analysis of the normal and AML serum samples showed similar mean sCD33 levels of 53.03 ng/mL (1.91 nM) and 52.90 ng/mL (1.90 nM), respectively (Table 18).
(307) TABLE-US-00018 TABLE 18 Assessment of sCD33 levels in normal and AML patient samples. Healthy human and AML serum samples (n = 20/each) were analyzed for sCD33 levels using mass spectroscopy. Concentration Concentration Sample (nM) (ng/mL) Normal Individual 1 0.23 6.15 Human Individual 2 NR NR Serum Individual 3 NR NR (NHS) Individual 4 0.21 5.59 Individual 5 NR NR Individual 6 0.25 6.73 Individual 7 0.24 6.39 Individual 8 NR NR Individual 9 0.23 6.14 Individual 10 0.21 5.69 Mean NHS 0.23 6.12 (Reportable) AML AML Donor 1 0.14 3.76 Donor AML Donor 2 0.14 3.71 Serum AML Donor 3 NR NR (AML) AML Donor 4 0.15 3.92 AML Donor 5 0.16 4.32 AML Donor 6 0.13 3.61 AML Donor 7 NR NR AML Donor 8 0.17 4.44 AML Donor 9 0.14 3.81 AML Donor 10 NR NR Mean AML 0.15 3.94 (Reportable)
(308) To assess the activity of C3CB189 in a more physiologically relevant setting, we performed T cell mediated cytotoxicity assays using human peripheral whole blood as a source of effector T cells, with various CD33.sup.+ tumor cells added as targets and incubated for 48 hours. C3CB189 induced T cell-mediated cytotoxicity of CD33.sup.+ MOLM-13 and Kasumi-1 cells, with median EC.sub.50 [EC.sub.20] values of 0.111 [0.054] and 0.124 [0.06] nM, respectively (
(309) The ability of C3CB189 to induce cytotoxicity in a more clinically relevant context was next assessed in an ex vivo cytotoxicity assay using whole blood from AML donors. This system relies on the presence of autologous T cells in the patient's own blood to kill AML cells. The extent of T cell-mediated cytotoxicity of CD33.sup.+ cells and T cell activation were measured. C3CB189 induced a concentration-dependent cytotoxicity of CD33.sup.+ blasts (
Example 16: Assessment of Cynomolgus Cross-Reactivity for C3CB189
(310) To assess if the cynomolgus (cyno) monkey was an appropriate model to evaluate the activity of C3CB189, we first investigated by FACS analysis the CD33 expression on leukocytes obtained from 6 healthy cyno monkeys. T and B cells in cyno monkey peripheral blood were found to have low to zero levels of CD33 expression (
(311) Next to demonstrate cyno cross-reactivity and to assess the cytotoxicity potential of C3CB189 at eliminating normal cyno monkey monocytes and neutrophils, we performed ex vivo cytotoxicity assays using healthy cyno monkey whole blood with exogenously added CD33.sup.+ MOLM-13 cells was utilized. In this system, depletion of CD33.sup.+ normal cyno monkey monocytes and normal cyno monkey neutrophils were also monitored along with activation of T cells. Indeed, C3CB189 mediated killing of CD33.sup.+ MOLM-13 cells (EC.sub.50: 0.013-0.452 nM) along with CD33.sup.+ normal cyno monkey monocytes (EC.sub.50: 0.625-5.636 nM) and normal cynomolgus monkey neutrophils (EC.sub.50: 0.013-0.714 nM) in vitro after 48 hours of ex vivo incubation (
Example 17: C3CB189 Mediates Reduction of CD33+ Leukocytes in Cynomolgus Monkeys
(312) To assess the pharmacokinetics (PK) and pharmacodynamics (PD) of C3CB189 in vivo, C3CB189 was administered as a single IV dose to cyno monkeys. The PK profiles are shown in
(313) Consistent with the anticipated mechanism of action, dose-dependent increases in T cell activation (% CD25.sup.+) were observed following a single IV dose of C3CB189, with peak % CD25.sup.+ on T-cytotoxic lymphocytes (CD8.sup.+/CD4.sup.−) observed at the first time point at 24 hours post dose (
(314) Dosing of C3CB189-related led to sustained reduction in CD33.sup.+ granulocytes (neutrophils). Consistent with the lower CD33 expression levels on monocytes, a more transient reduction in CD33.sup.+ monocytes was also observed. The concentration-time profiles for granulocytes and monocytes are shown in
(315) C3CB189 was also studied in another two cynomolgus monkey studies following multiple IV administrations at dose levels ranging from 0.01 mg/kg to 30 mg/kg. C3CB189 related changes were generally consistent with that observed following a single dose and C3CB189 was well tolerated at these dose levels (data not shown). Together these data provide evidence of C3CB189 mediating activity while maintaining tolerability in cynomolgus monkeys.
Example 18: C3CB189-Mediated Cytotoxicity of CD33.SUP.+ Cell Lines and Patient Samples Regardless of Genotypes of Rs12459419 SNP
(316) An SNP, rs12459419 (C>T; Ala14Val in exon 2) occurs within a regulatory splice site of CD33, in which a T allele results in increased expression of transcripts predicted to code for a CD33 protein isoform lacking the V set domain. Recent data further demonstrated subjects with SNP rs12459419 CC genotype (about 50% of study entrants) had a significantly lower risk of relapse and better event-free survival (EFS) and disease-free survival after GO therapy, whereas this benefit was not seen in patients with the CT or TT genotypes (Lamba, J. K., Chauhan, L., Shin, M., Loken, M. R., Pollard, J. A., Wang, Y. C., Ries, R. E., Aplenc, R., Hirsch, B. A., Raimondi, S. C., et at. (2017). J Clin Oncol 35, 2674-2682.). Given the data with GO in the above-mentioned study, we assessed the impact of SNP-rs12459419 genotypes on the activity of C3CB189. We first confirmed via hydrogen deuterium exchange (HDX) mapping, that C33B904 (IgG.sub.4 version of the CD33 parental arm of C3CB189) binds to distinct regions in the C2 domain (IgC in
(317) We then performed ex vivo cytotoxicity assays using AML patient whole blood to extend and confirm our above observations. Based on genotyping data, patient samples 6095, 6116, and 6152 were identified as being CC genotype, while patient samples 6129 and USAML0078 were identified as being heterozygous CT for the CD33 SNP rs12459419, respectively (
(318) It will be appreciated by those skilled in the art that changes could be made to the embodiments described above without departing from the broad inventive concept thereof. It is understood, therefore, that this invention is not limited to the particular embodiments disclosed, but it is intended to cover modifications within the spirit and scope of the present invention as defined by the present description.
(319) TABLE-US-00019 TABLE 19 Heavy Chain Variable Region Sequences HC ID ID Amino Acid Sequence B23H1 256 QITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGMGVSWIRQPPGKALEWLAHIYWDDD KRYNPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCARLYGFTYGFAYWGQG TLVTVSS CD3H141 257 EVQLVESGGGLVQPGGSLRLSCAASGFTFNTYAMNWVRQAPGKGLEWVARIRSKY NNYATYYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCARHGNFGNSYVS WFAYWGQGTLVTVSS CD3H219 258 QVQLQQSGPRLVRPSQTLSLTCAISGDSVFNNNAAWSWIRQSPSRGLEWLGRTYYRS KWLYDYAVSVKSRITVNPDTSRNQFTLQLNSVTPEDTALYYCARGYSSSFDYWGQG TLVTVSS C33H42 259 QLQLQESGPGLVNPSETLSHTCTVSGGSISSSSHYWGWIRQPPGKGLEWIGKIYYSGN TYYNPSLKSRVTISIDTSKNQFSLKMSSVTAADTAVYYCARLADVVVVPAARYFDS WGQGTLVTVSS C33H44 260 QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRS KWYNDYAVSVRSRITINPDTSKNQFSLQLNSVTPEDTAVYHCARETMFRGLMDYWG QGTLVTVSS C33H45 261 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQSPGKGLEWVAVISYDGS NKYCADSVKGRFTISRDNSKSTLYLQMNSLRAEDTAVYYCAKDFRSLDWLPPDSTS YDGMDVWGQGTTVTVSS C33H46 262 QVQLVQSGSELKKPGASVKVSCKASGYTFTNYAMNWVRQAPGQGLEWMGWINTN TGNPTYAQAFTGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCARDREVRDYWGQGT LVTVSS C33H48 263 QLQLQESGPGLVKPSETLSLTCTVSGGSIRSTNYYWGWIRQPPGKGLEWIGTIYYSGN TYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARLADVVVVPAARYFDY WGQGILVTVSS C33H49 264 QLQLQESGPGLVKPSETLSLTCTVSGGSIRSSGFYWGWIRQPPRKGLEWIGTIYYSGN TYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYFCARLADVVVVPAARYFDN WGQGTLVTVSS C33H51 265 QLQLQESGPGLVKPSETLSLTCTVSGGSISTGRYYWGWIRQPPGKGVIWIGNIYYSGN TYYNPSLKSRVTISVDTSKNQFSLKLNSVTAADTAVYYCARLGSLVVVPAAMSFDY WGQGTLVTVSS C33H52 266 QLQLQESGPGLVKPSETLSLTCTVSGGSIRGSSYYWGWVRQPPGKGLEWIGSIYSSGN TYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTALYYCARLGSLVVVPAAMSFDY WGQGTLVTVSS C33H55 267 QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGRGLEWIGEIYHSGN TNNSPSLKSRVTISADKSKNQFSLKLSSVTAADTAVYFCARIIAVARYFDSWGQGTLV TVSS C33H65 268 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVVVISYDG SNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDFRDFDWLPPDST SYHGMDVWGQGTTVTVSS C33H66 269 QVQLVESGGGVVQPGRSLRLSCVASGFTFSSYGMHWVRQAPGKGLEWVAVISYDG SNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEGTAVYYCAKDFRSFDWLPPDSA SYHGMDVWGQGTTVTVSS C33H68 270 EVQLLESGGGLVQPGGSLGLSCAASGFTFSGYAMSWVRQAPGKGLNWVSAIDYSGN DTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKESQLLHGLIAEHWG QGILVTVSS C33H69 271 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSSYYWGWIRQPPGKGLDWIGSINYSGS TYYNPSLKSRVTISVDTSKIQFSLKLRSVTAADTAVYYCARLDGYESPFDYWGQGTL VTVSS C33H70 272 QLQLQESGPGLVKPSETLSLTCTVSGGSIRGSSYYWGWIRQPPGKGLEWIGSIYSSGN TYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARLGSLVVVPAAMSFDY WGQGTLVTVSS C33H72 273 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKQHG SEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDRDLGYFDYWGQ GTLVTVSS C33H73 274 EVQLLESGGGLVQPGGSLRLSCAASRFTFSSYAMTWVRQAPGKGLEWVSTINISGGS TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTKGGYSSGPFDYWGQG TLVSVSS C33H74 275 QVQLVESGGGVVQPGRSLRLSCAASRFTFSSYGMHWVRQAPGKGLEWVAVISYDG SNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVHYCAKDFRSFDWLPPDSA SYHGMDVWGQGTTVTVSS C33H76 276 EVQLLESGGGLVQPGGSLRLSCAASGFTFNYAMSWVRQAPGKGLEWVSAISGSGGS TYYADSVKGRFTISRDISKNTLYLQMNSLRAEDTAVYYCARTYNSGYYDGDFDYW GQGTLVTVSS C33H78 277 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDG SNKYYADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCAKDFRYFDWLPPDSS SYYGMDVWGQGTTVTVSS C33H80 278 QVQLVQSGSELRKPGASVKVSCKASGYTFTNYAMNWVRQAPGQGLEWMGWINTN TGNPTYAQGFTGRFVFSLDTSVSSAYLQISSLKAEDTAMYYCATDRDRGTDYWGQG TLVTVSS C33H81 279 QVQLVESGGGVVQPGRSLRLSCAASGFTFSAYGMHWVRQAPGKGLEWVAVISYDG SNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEGTAVYYCAKDFRSFDWLPPDSA SYHGMDVWGQGTTVTVSS C33H84 280 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDG SNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDFRSFDWLPPDST SYYGMDVWGQGTTVTVSS C33H87 281 EVQLVESGGGFVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKQHG SEKYYVDSVKGRFTISRDNVKNSLYLQMNSLRTEDTAVYYCARDRDLGYFDYWGQ GTLVTVSS C33H88 282 QVQLVQSGSELKKPGASVKVSCKASGYTLTRSAMNWVRQAPGQGLEWMGWINTN TGNPTYAQGFTGRFVFSLDTSVNTAYLLISSLKTEDTAVYYCASDILPGYHEDYWGQ GTLVTVSS C33H90 283 QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRS KWYNDYALSVQSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAREVAVAASFDYWG QGTLVTVSS C33H91 284 QLQLQESGPGLVKPSETLSLTCTVSGGSISSRSHYWGWIRQPPGVGLEWIGSIYYTGS TYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARLADIVVVPAARYFDYW GQGTLVTVSS C33H92 285 QLQLQESGPGLVKPSETLSLTCTVSGGSIRSSSYYWGWIRQPPGKGPEWIGSIYSSGNT YYNPSLKSRVTISVDTSKNQFSLKLISMTAADTAVFYCARLAATIVVPAARYFDCWG QGTLVTVSS C33H98 286 EVQLVESGGGFVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKQHG SEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDRDLGYFDYWGQ GTLVTVSS C33H99 287 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMTWVRPAPGKGLEWVANIKRDG GEKYYVDSVKGRFTISRDNAANSLYLQMNSLRVEDTAVYYCARPFYDHFDYWGQG TLVTVSS C33H108 288 QVQLVQSGSELKKPGASVKVSCKASGYTFSTYAMNWVRQAPGQGLEWMGWINTN TGNPTYAQGFTGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCARDRDRGTDYWGQG TLVTVSS C33H249 289 EVQLVESGGGLVQPGRSLRLSCVASGFTFDDYAIHWVRQAPGKGLEWVSGLSWNG GNIGYADSVKGRFTISRDNAKNSLYLQMNSLKTEDTAFYYCTKDTPYGDYFDYWGQ GTLVTVSS C33H250 290 EVQLVESGGGLVQPGRSLRLSCAGSGFTFDDYAIHWVRQAPGKGLEWVSGLSWNG GNIGYADSVKGRFTISRDNAKNSLYLQLNSLKTEDTAFYYCAKDSPYGDYFDYWGQ GTLVTVSS C33H251 291 EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGIGWSG GSIVYADSVKGRFKISRDNAKNSLYLQMNSLRAEDTALYYCAKDSPYGDFFDYWGQ GTLVTVSS C33H252 292 EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGIGWSG GSIVYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDSPYGDFFDYWGQ GTLVTVSS C33H253 293 EVQLLESGGGLVQPGGSLKLSCTASGFTFRSYAMSWVRQAPGKGLEWVSAINGYGD GRYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYSCAKDQGFGELFFDYWG QGTLVTVSS C33H254 294 QVQLVESGGGVVQPGRSLRLSCAASGFTFSYYGMHWVRQAPDKGLEWVAVIWFDG NNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRELLFDYWGQG TLVTVSS C33H255 295 EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQVPGEGLEWVSGISWNG GDMVYADSVKGRFTISRDNAKNSLYLQMNSLRPEDTALYYCVKDMPYFDFLTGSD YYYYGMDVWGQGTTVTVSS C33H256 296 QVQLVESGGGVVQPGRSLRLSCATSGFTFSNYGMHWVRQAPGKGLEWVAVIWYVG SHKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDGSLCFDYWGQG TLVTVSS
(320) TABLE-US-00020 TABLE 20 Light Chain Variable Regions LC ID ID AMINO ACID SEQUENCE B23L3 297 DIVMTQSPDSLAVSLGERATINCRASQSVDYNGISYMHWYQQKPGQPPKLLIYAASN PESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQIIEDPWTFGQGTKVEIK CD3L66 298 QTVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQQKPGQAPRGLIGGTNKR APGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNLWVFGGGTKLTVL CD3L150 299 QSALTQPASVSGSPGQSITISCTGTSSNIGTYKFVSWYQQHPDKAPKVLLYEVSKRPS GVSSRFSGSKSGNTASLTISGLQAEDQADYHCVSYAGSGTLLFGGGTKLTVL C33L8 300 SYELTQPPSVSVSPGQTASIICSGDKLGNKYACWYQQKPGQSPVLVIYQDSKRPSGIP ERFSGSNSGNTATLTISGTQAVDEADYYCQAWDSSTYVFGTGTKVTVL C33L10 301 SYVLTQPPSVSVAPGQTARITCGGSNIGSKSVHWYQQKPGQAPVMVVYDDSDRPSGI PERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDVVFGGGTKLTVL C33L11 302 SYELTQPPSVSVSPGQTASITCSGHKLGDKYACWYQQKPGQSPVVVIYKDSKRPSGIP ERFSGSNFGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVL IAPL24 303 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDSKRPSGIP ERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVL C33L58 304 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDYKRPSGIP ERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTYVFGTGTKVTVL C33L59 305 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDYKRPSGIP ERFSGSNSGNTATLTISGTQTMDEADYYCQAWDISTYVFGTGTKVTVL C33L34 306 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQLRPGQSPILVIYQDSNRPSGIPE RFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTWVFGGGTKLTVL N46L109 307 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDSKRPSGIP ERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTWVFGGGTKLTVL C33L42 308 SYVLTQPPSVSVAPGQTARITCGGNNIGIKSVHWYQQKPGQAPVLVVYDDSDRPPGI PERFSGSNSGNTATLTITRVEAGDEADYYCQVWDSSSDHVVFGGGTKLTVL C33L47 309 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVVVIYQDRKRPSGIP ERFSGSNFGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVL C33L60 310 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDGKRPSGIP ERFSGSNFGNKATLTISGTQAMDEADYYCQAWDRNTVVFGGGTKLTVL C33L17 311 DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKAGQPPKLLIYW ASTRESGVPDRFSGSGSGTDFILIISSLQAEDVAVYYCQQYYGTPWTFGQGTKVEIK C4LL152 312 DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSG VPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFPFTFGPGTKVDIK C33L40 313 SYELTQPPSVSVSPGQTASITCSGNKLGAKFASWYQQKPGQSPVLVIYQDNKRPSGIP ERFSGSNSGNTATLTISGTQAVDEADYYCQAWDSSTVVFGGGTKLTVL C33L32 314 SYELTQPPSVSVSPGQTASITCSGDKLGDKYVRWYQQKTGQSPVLVMYQDSKRPSGI RERFYGSNSGNTATPTISGTQAVDEAEYYCQAWDSSTGVVFGGGTKLTVL C33L38 315 SYELTQPPSVSVPPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDNKRPSGIP ERFSGSNSGNTATLTISGTQAMDEADYYCQAWGRNTVVFGGGTKLTVL C33L39 316 QSALTQPASVSGSPGQSIPISSTGTSSDDGKNNIVSWYQQHPGKAPKLMIYKDSKRPS GVSNRFSGSKSGNTASLTISGLQADDEADYHCCSYAGASNHVVFGGGTKLTVL C33L57 317 SYELTQPPSVSVSPGQTASITCSGDELGNKYACWYQQKPGQSPVVVVYQDRKRPSGI PERFSGSNFGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVL C33L73 318 QSALTQPASVSGSPGQSITISCTGTSSDVGDYNYVSWYQQHPGKVPKLMIYDVSNRP SGVSNRFSGSMSGNTASLTISGLQAEDEADYYCSSYSSSSALEVFGGGTKLTVL C33L53 319 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDNKRPSGIP ERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSNTVVFGGGTKLTVL C33L66 320 SYELTQPPSVSVSPGQTASITCSGDKLGDKYVCWYQQKPGQSPVVVIHQDRKRPSGIP ERFSGSNFGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVL C33L35 321 SYELTQPPSVSVSPGQTASITCSGDKLGNKYASWYQQKPGQSPVLVIYQDTKRPSGIP ERVSGSNSGNTATLTISGTQAMDEADYHCQAWDSSTVVFGGGTKLTVL C33L61 322 QSALTQPASVSGSPGQSITISCTGINSDVGSYDLVSWYQQHPGKAPKLLIYDGSERPS GVFGRFSGSKSDNTTSLTISGLQAEDEAAYYCCSYEVTTTYVVFGGGTKLTVL C33L51 323 SYVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWSQQKPGQAPVLVVYDDSDRPSGI PERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSNSDHVVFGGGTKLTVL C33L44 324 SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDSNRPSGIP ERFSGSNSGNTATLTISETQAMDEADYYCQAWDSSTYVFGTGTKVTVL C33L30 325 SYELTQPPSVSVSPGQTVSISCSGDRLGDKYACWYQQKPGQSPVLVIYQDSKRPSGIP ERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSSYVFGTGTKVTVL C33L69 326 SYELTQPPSVSVSPGQTASITCSGDKLGSKFACWYQQKPGQSPVLVIYQDSKRPSGIP ERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVL C33L37 327 SYVLTQPPSVAVAPGQTARITCGGSNIGKISVHWYQQKAGQAPVLVVHDDRARPSGI PERLSGSNSGTTATLTISRVEVGDEADYYCQVWNSSSVHPVFGGGTKLTVL C33L74 328 QSALTQPASVSGSPGQSITISCTGTSSDVGDDNYVSWYQQHPGKAPKLMIYDVSNRP SGVSNRFSGSKSGNTASLTISGLQSEDEADYYCSSYSSSTTLEVFGGGTKLTVL C33L115 329 DIQMTQSPSSVWASVGDRVTITCRASQGISSWLAWYQQQPGKAPNLLIYRSSSLQSG VPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQDNSFPYTFGQGTKLEIK C33L116 330 DIQMTQSPSSEWASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYGASSWQSG VPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQDNSFPYTFGQGTKLEIK C33L117 331 DIVMTQSPDSLAVSLGERATINCKSSQTVLYSSNNKNYLAWYQQKPGQPPKLLISWA STRKSGVPDRFSGSGSGTDFTLTVSSLQAEDVAVYYCQHYYSTPYTFGQGTKLEIK C33L118 332 DIVMTQSPDSLAVSLGERATINCKSSQTVFYSSNNKNYLAWYQQKPGQPPKLLISWA STRKSGVPDRFSGSGSGTDFTLTVSSLQAEDVAVYYCQHYYSTPYTFGQGTKLEIK C33L119 333 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGV PSRFSGSGSGTEFTLTISSLQPDDFATYCCQQYNSYPWTFGQGTKVEEK C33L120 334 SYELTQPPSVSVSPGQTASITCSGDELGDMYACWYQQKPGQSPLVVIYQDSKRPSGIP ERFSGSNSGNTATLTISGTQAMDEAAYYCQTWDTRIAVFGGGTNLTVL C33L121 335 SYELTQPPSVSVSPGQTASITCSGDNLGNEHVCWYHQKPGQSPVLVIYQNNKRPSGIP ERFSGSNSGNTATLSISGTQATDEADYYCQAWDSTTAVFGGGTKLTVL C33L122 336 SYELTQPPSVSVSPGQTANISCSGVTLGYNYAYWYQQKPGQSPILVISQDTQRPSGIPE RFSGSNSGNTATLTISGTQAMDEAAYYCQAWDITTVLFGGGTKLTVL C33L132 337 SYELTQPPSVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPVLVIYQDGKRPSGIP ERFSGSNFGNKATLTISGTQAMDEADYYCQAWDRNTVVFGGGTKLTVL C33L41 338 SYELTQPPSVSVSPGQTASITCSGDKLGNKYASWYQQKPGQSPVLVIYQDSKRPSGIP ERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVL
(321) TABLE-US-00021 TABLE 21 Heavy Chain CDR1-3 sequences HC ID ID CDR1 ID CDR2 ID CDR3 ID B23H1 256 GFSLSTSGM 339 YWDDD 340 LYGFTYGFA 341 CD3H141 257 GFTFNTY 342 RSKYNNYA 343 HGNFGNSYVSWFA 344 CD3H219 258 GDSVFNNNA 345 YYRSKWL 346 GYSSSFD 347 C33H42 259 GGSISSSSH 348 YYSGN 349 LADVVVVPAARYFD 350 C33H44 260 GDSVSSNSA 351 YYRSKWY 352 ETMFRGLMD 353 C33H45 261 GFTFSSY 354 SYDGSN 355 DFRSLDWLPPDSTSYDGMD 356 C33H46 262 GYTFTNY 357 NTNTGN 358 DREVRD 359 C33H48 263 GGSIRSTNY 360 YYSGN 361 LADVVVVPAARYFD 362 C33H49 264 GGSIRSSGF 363 YYSGN 364 LADVVVVPAARYFD 365 C33H51 265 GGSISTGRY 366 YYSGN 367 LGSLVVVPAAMSFD 368 C33H52 266 GGSIRGSSY 369 YSSGN 370 LGSLVVVPAAMSFD 371 C33H55 267 GGSISSSN 372 YHSGN 373 IIAVARYFD 374 C33H65 268 GFTFSSY 375 SYDGSN 376 DFRDFDWLPPDSTSYHGMD 377 C33H66 269 GFTFSSY 378 SYDGSN 379 DFRSFDWLPPDSASYHGMD 380 C33H68 270 GFTFSGY 381 DYSGND 382 ESQLLHGLFE 383 C33H69 271 GGSISSSSY 384 NYSGS 385 LDGYESPFD 386 C33H70 272 GGSIRGSSY 387 YSSGN 388 LGSLVVVPAAMSFD 389 C33H72 273 GFTFSSY 390 KQHGSE 391 DRDLGYFD 392 C33H73 274 RFTFSSY 393 NISGGS 394 GGYSSGPFD 395 C33H74 275 RFTFSSY 396 SYDGSN 397 DFRSFDWLPPDSASYHGMD 398 C33H76 276 GFTFNY 399 SGSGGS 400 TYNSGYYDGDFD 401 C33H78 277 GFTFSSY 402 SYDGSN 403 DFRYFDWLPPDSSSYYGMD 404 C33H80 278 GYTFTNY 405 NTNTGN 406 DRDRGTD 407 C33H81 279 GFTFSAY 408 SYDGSN 409 DFRSFDWLPPDSASYHGMD 410 C33H84 280 GFTFSSY 411 SYDGSN 412 DFRSFDWLPPDSTSYYGMD 413 C33H87 281 GFTFSSY 414 KQHGSE 415 DRDLGYFD 416 C33H88 282 GYTLTRS 417 NTNTGN 418 DILPGYHED 419 C33H90 283 GDSVSSNSA 420 YYRSKWY 421 EVAVAASFD 422 C33H91 284 GGSISSRSH 423 YYTGS 424 LADIVVVPAARYFD 425 C33H92 285 GGSIRSSSY 426 YSSGN 427 LAATIVVPAARYFD 428 C33H98 286 GFTFSSY 429 KQHGSE 430 DRDLGYFD 431 C33H99 287 GFTFSSY 432 KRDGGE 433 PFYDHFD 434 C33H108 288 GYTFSTY 435 NTNTGN 436 DRDRGTD 437 C33H249 289 GFTFDDY 438 SWNGGN 439 DTPYGDYFD 440 C33H250 290 GFTFDDY 441 SWNGGN 442 DSPYGDYFD 443 C33H251 291 GFTFDDY 444 GWSGGS 445 DSPYGDFFD 446 C33H252 292 GFTFDDY 447 GWSGGS 448 DSPYGDFFD 449 C33H253 293 GFTFRSY 450 NGYGDG 451 DQGFGELFFD 452 C33H254 294 GFTFSYY 453 WFDGNN 454 DRELLFD 455 C33H255 295 GFTFDDY 456 SWNGGD 457 DMPYFDFLTGSDYYYYGMD 458 C33H256 296 GFTFSNY 459 WYVGSH 460 DGSLCFD 461
(322) TABLE-US-00022 TABLE 22 Light Chain CDR1-3 sequences LC ID ID CDR1 ID CDR2 ID CDR3 ID B23L3 297 SQSVDYNGISY 462 AAS 463 IIEDPW 464 CD3L66 298 STGAVTTSNY 465 GTN 466 WYSNLW 467 CD3L150 299 TSSNIGTYKF 468 EVS 469 YAGSGTL 470 C33L8 300 DKLGNKY 471 QDS 472 WDSSTY 473 C33L10 301 SNIGSKS 474 DDS 475 WDSSSDV 476 C33L11 302 HKLGDKY 477 KDS 478 WDSSTV 479 IAPL24 303 DKLGDKY 480 QDS 481 WDSSTV 482 C33L58 304 DKLGDKY 483 QDY 484 WDSSTY 485 C33L59 305 DKLGDKY 486 QDY 487 WDISTY 488 C33L34 306 DKLGDKY 489 QDS 490 WDSSTW 491 N46L109 307 DKLGDKY 492 QDS 493 WDSSTW 494 C33L42 308 NNIGIKS 495 DDS 496 WDSSSDHV 497 C33L47 309 DKLGDKY 498 QDR 499 WDSSTV 500 C33L60 310 DKLGDKY 501 QDG 502 WDRNTV 503 C33L17 311 SQSVLYSSNNKNY 504 WAS 505 YYGTPW 506 C4LL152 312 SQGISSW 507 AAS 508 ANSFPF 509 C33L40 313 NKLGAKF 510 QDN 511 WDSSTV 512 C33L32 314 DKLGDKY 513 QDS 514 WDSSTGV 515 C33L38 315 DKLGDKY 516 QDN 517 WGRNTV 518 C33L39 316 TSSDDGKNNI 519 KDS 520 YAGASNHV 521 C33L57 317 DELGNKY 522 QDR 523 WDSSTV 524 C33L73 318 TSSDVGDYNY 525 DVS 526 YSSSSALE 527 C33L53 319 DKLGDKY 528 QDN 529 WDSNTV 530 C33L66 320 DKLGDKY 531 QDR 532 WDSSTV 533 C33L35 321 DKLGNKY 534 QDT 535 WDSSTV 536 C33L61 322 INSDVGSYDL 537 DGS 538 YEVTTTYV 539 C33L51 323 NNIGSKS 540 DDS 541 WDSNSDHV 542 C33L44 324 DKLGDKY 543 QDS 544 WDSSTY 545 C33L30 325 DRLGDKY 546 QDS 547 WDSSSY 548 C33L69 326 DKLGSKF 549 QDS 550 WDSSTV 551 C33L37 327 SNIGKIS 552 DDR 553 WNSSSVHP 554 C33L74 328 TSSDVGDDNY 555 DVS 556 YSSSTTLE 557 C33L115 329 SQGISSW 558 RSS 559 DNSFPY 560 C33L116 330 SQGISSW 561 GAS 562 DNSFPY 563 C33L117 331 SQTVLYSSNNKNY 564 WAS 565 YYSTPY 566 C33L118 332 SQTVFYSSNNKNY 567 WAS 568 YYSTPY 569 C33L119 333 SQSISSW 570 KAS 571 YNSYPW 572 C33L120 334 DELGDMY 573 QDS 574 WDTRIA 575 C33L121 335 DNLGNEH 576 QNN 577 WDSTTA 578 C33L122 336 VTLGYNY 579 QDT 580 WDITTV 581 C33L132 337 DKLGDKY 582 QDG 583 WDRNTV 584 C33L41 338 DKLGNKY 585 QDS 586 WDSSTV 587