Modified T cells and methods of their use
12459975 ยท 2025-11-04
Assignee
Inventors
- Marcela V. Maus (Lexington, MA, US)
- Matthew FRIGAULT (Somerville, MA, US)
- Mark Cobbold (Winchester, MA, US)
Cpc classification
C12N2710/16122
CHEMISTRY; METALLURGY
A61K40/11
HUMAN NECESSITIES
International classification
A61K40/11
HUMAN NECESSITIES
Abstract
The invention provides modified an isolated T lymphocytes having reduced or eliminated expression of the T Cell Receptor, due to reduced or eliminated expression of a CD3, T Cell Receptor Alpha Chain, or T Cell Receptor Beta Chain gene relative to a T lymphocyte without modification, where the isolated T lymphocyte expresses a protein comprising US6, UL40 viral protein and signal peptide, and UL18.
Claims
1. An isolated T lymphocyte modified to have reduced or eliminated expression of the T Cell Receptor (TCR), due to reduced or eliminated expression of a CD3, T Cell Receptor Alpha Chain (TRAC), or T Cell Receptor Beta Chain (TRBC) gene relative to a T lymphocyte without modification, wherein the isolated T lymphocyte expresses a protein comprising US6, UL40 viral protein and signal protein peptide, and UL18.
2. The isolated T lymphocyte of claim 1, comprising a genome in which a CD3, TRAC, and/or TRBC gene, regulatory sequence, coding sequence, exon, or a portion thereof, is mutated, resulting in reduced, null, or non-functional CD3, CD3eta, CD3theta, TRAC, or TRBC expression relative to a T lymphocyte without modification.
3. The isolated T lymphocyte of claim 2, wherein the mutation is a deletion or a frame shift mutation.
4. The isolated T lymphocyte of claim 2, wherein the mutation disrupts assembly of the T cell receptor or CD3 signaling.
5. The isolated T lymphocyte of claim 1, comprising a genome in which a CD3, TRAC, TRBC gene is deleted.
6. The isolated T lymphocyte of claim 5, comprising a genome in which two alleles of a CD3, TRAC, or TRBC gene are deleted.
7. The isolated T lymphocyte of claim 1, wherein the reduced expression of the CD3, TRAC, or TRBC gene is null expression.
8. The isolated T lymphocyte of claim 1, wherein an HLA locus, or a portion thereof, is deleted.
9. The isolated T lymphocyte of claim 8, wherein the HLA locus is on chromosome 6.
10. The isolated T lymphocyte of claim 1, further having decreased HLA Class I expression relative to a T lymphocyte without modification.
11. The isolated T lymphocyte of claim 1, wherein the isolated T lymphocyte is further modified to express HLA-G.
12. The isolated T lymphocyte of claim 1, further comprising a gene encoding a heterologous protein that facilitates the T lymphocyte in evading immune attack from a host to whom the T lymphocyte is administered.
13. The isolated T lymphocyte of claim 12, wherein the heterologous protein facilitates evasion of T cell or NK mediated rejection.
14. The isolated T lymphocyte of claim 1, further comprising a gene encoding a therapeutic protein.
15. The isolated T lymphocyte of claim 1, further comprising a gene that induces cell death.
16. The isolated T lymphocyte of claim 1, wherein the T lymphocyte has reduced or eliminated expression of a CD3 relative to a T lymphocyte without modification.
17. The isolated T lymphocyte of claim 1, wherein the isolated T lymphocyte expresses full length US6, UL40 viral protein and signal peptide, and UL18 having 90% sequence identity respectively to SEQ ID NO: 1, 5, and 6.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
DETAILED DESCRIPTION
(15) The invention provides T cells that are modified to have reduced expression (e.g., partial reduction in expression or complete inhibition of expression) of the T Cell Receptor (TCR), due to mutation or deletion of CD3, T Cell Receptor Alpha Chain (TRAC), and/or T Cell Receptor Beta Chain (TRBC) sequences. In one example, partial or complete inhibition of expression of a CD3 gene is achieved due to, e.g., mutation or deletion of CD3 sequences. In the absence of CD3, the T cell receptor complex cannot form.
(16) Accordingly, modified T cells of the invention can be used as universal T cells in the context of, e.g., adoptive T cell therapy. In one example, which is described further below, the modified T cells are transduced with sequences encoding a chimeric antigen receptor (CAR) directed against, e.g., a cancer-associated antigen, and then are administered to patients to treat, e.g., cancer. In other examples, the modified cells are used in the context of infectious disease or organ transplantation.
(17) Optionally, the modified T cells are further modified so as to avoid or reduce the incidence of rejection of the cells when administered to patients. These further modifications are particularly advantageous in the context of allogeneic T cell therapy, but may also be useful in autologous approaches, e.g., when a heterologous protein is expressed by an autologous, modified T cell.
(18) In addition to modified T cells, the invention also provides methods of using the modified T cells, as well as related compositions and kits. The modified T cells, methods, compositions, and kits of the invention are described in more detail, in an exemplary manner, below.
(19) T Cells
(20) T cells (e.g., human T cells) that can be used in the invention include autologous cells, obtained from the subject to whom the cells are later to be administered, after ex vivo modification and expansion. For example, the T cells can be obtained from an individual having or diagnosed as having cancer, an infectious disease, an autoimmune disease, or a plasma cell disorder. T cells can also be obtained from allogeneic donors, which are non-genetically identical individuals of the same species as the intended recipients of the cells. T cells are typically obtained from peripheral blood that is collected from a subject by, e.g., venipuncture or withdrawal through an implanted port or catheter. Optionally, the blood can be obtained by a process including leukapheresis, in which white cells are obtained from the blood of a subject, while other blood components are returned to the subject. Blood or leukapheresis product (fresh or cryopreserved) is processed to enrich for T cells using methods known in the art. Thus, for example, density gradient centrifugation (using, e.g., Ficoll) and/or counter-flow centrifugal elutriation can be carried out to enrich for mononuclear cells (including T cells). A T cell stimulation step employing, e.g., CD3/CD28 antibodies coated on magnetic beads or artificial antigen presenting cells (aAPCs) expressing, e.g., cell surface-bound anti-CD3 and anti-CD28 antibody fragments (see below), can further be carried out in order to stimulate T cells and to deplete other cells, e.g., B cells. The T cells of enriched T cell preparations can then be subject to genetic modification. As an alternative to peripheral blood, tissues including bone marrow, lymph nodes, spleen, and tumors can be used as a source for T cells. The T cells can be of human, primate, hamster, rabbit, rodent, cow, pig, sheep, horse, goat, dog, or cat origin, but any other mammalian cell may be used. In a certain embodiments of any aspect, the T cell is human.
(21) Modification of T Cells
(22) T cells can be modified in several ways, according to the invention, to enhance their use in therapeutic methods (e.g., adoptive T cell therapy). These modifications include: (i) reduced CD32, TRAC, and/or TRBC expression by, e.g., deletion/mutation (e.g., frame shift mutation) of CD3, TRAC, and/or TRBC sequences, (ii) expression of one or more proteins that facilitate immune surveillance evasion (e.g., a TAP inhibitor or an HLA homolog) (or deletion of HLA Class I and expression of HLA-G), (iii) expression of marker and/or suicide genes, and/or (iv) expression of therapeutic proteins, such as chimeric antigen receptors (CARs) or heterologous T cell receptors. Examples of each of these types of modifications are provided below.
(23) CD3, TRAC, or TRBC Mutation and Deletion
(24) The T cell receptor complex includes variable T cell receptor and chains, as well as three dimeric signaling molecules: CD3/, CD3/, and CD3 /. According to the present invention, expression of a CD3 (also referred to herein as CD3z or CD3 zeta), TRAC, and/or TRBC gene is reduced or eliminated. This can be achieved using any of a number of methods that are known in the art. In one example, CD3 sequences (e.g., coding or regulatory sequences; see, e.g., ENSEMBL ID ENSG00000198821, as of Jan. 10, 2018), TRAC sequences (e.g., coding or regulatory sequences), and/or TRBC (e.g., coding or regulatory sequences) are mutated or deleted from the genome of T cells using, for example, gene editing methods. Thus, for example, approaches employing RNA/DNA guided endonucleases (e.g., Clustered Regularly Interspersed Short Palindromic Repeats (CRISPR)/Cas9, Cpf1, and Argonaute), Transcription Activator-Like Effector (TALE)-nucleases, zinc finger nucleases (ZFN), or meganucleases can be adapted for use in the invention. Further, methods of engineering nucleases to achieve a desired sequence specificity, and which can be used in the invention, are described, e.g., in Kim (2014); Kim (2012); Belhaj et al. (2013); Urnov et al. (2010); Bogdanove et al. (2011); Jinek et al. (2012) Silva et al. (2011); Ran et al. (2013); Carlson et al. (2012); Guerts et al. (2009); Taksu et al. (2010); and Watanabe et al. (2012); each of which is incorporated by reference herein in its entirety.
(25) In various examples, insertions or deletions are made by gene editing to cause a frame shift mutation, leading to gene knock out (i.e., lack of expression of a functional gene product). In certain examples, such mutations are made to target early coding regions, close to the N-terminus of the protein, in order to maximize disruption and minimize the possibility of low-level protein expression. In various examples, any exon can be targeted for the creation of a frame shift (e.g., an exon coding sequence). As a specific example, a more proximal exon may be targeted.
(26) Specific examples of protocols used in the present invention in the context of CD3 include: (i) electroporation of guide RNA targeting CD3 with mRNA encoding Cas9 endonuclease, (ii) electroporation of ribonucleoprotein (RNP) made up of pre-complex guide RNA and cas9 endonuclease protein, and (iii) expression of guide RNA using a human RNA polymerase promoter encoded in a CAR lentiviral backbone with electroporation of cas9 protein or mRNA.
(27) Alternatively, reduction or elimination of CD3, TRAC, and/or TRBC expression can be achieved by the use of an inhibitory nucleic acid. As used herein, an inhibitory nucleic acid refers to a nucleic acid molecule that can inhibit the expression of a target gene or mRNA and includes, e.g., double-stranded RNAs (dsRNAs), inhibitory RNAs (iRNAs), and the like. Inhibitory nucleic acid technology is more fully described in, e.g., Wilson, R C, and Doudna, J A (2013) Annual Review of Biophysics 42(217-239) and reference cited therein.
(28) Expression of Proteins that Facilitate Evasion of Immune Surveillance
(29) Modified T cells characterized by reduced or eliminated expression of a functional TOR (due to, e.g., a CD3, TRAC, and/or TRBC gene deletion, e.g., a frame shift mutation) can advantageously be used in the context of adoptive T cell therapy methods, such as those described herein. As described further below, these modified T cells can further be modified to express a chimeric antigen receptor (CAR), in order to direct the modified T cell to a target cell (e.g., a tumor cell). However, the function of the modified T cells can be further improved, particularly in the context of allogeneic transfer methods, by one or more additional genetic modifications. In more detail, genetically modified T cells lacking expression of an endogenous T cell receptor (due to, e.g., CD3, TRAC, and/or TRBC gene deletion or mutation, as described herein) are susceptible to attack by the immune system (T cell and NK-mediated rejection) of the subject to whom they are administered. Evasion of this attack can be achieved by the expression of certain heterologous proteins in the modified T cells. Accordingly, expression of these proteins can be used to increase persistence of the administered, modified T cells. Heterologous proteins that can be used in this context include, for example, viral proteins that facilitate immune evasion. Examples of these proteins are described as follows and include, e.g., transporter associated with antigen processing (TAP) inhibitors and HLA homologs. Expression of these proteins can also be applicable in the autologous setting, where reduced immune response to an expressed transgene may be desirable.
(30) Thus, in one example, viral inhibitors of TAP can be expressed in modified T cells of the invention. TAP plays a central role in antigen processing and, in particular, transport of cytosolic peptides into the endoplasmic reticulum (ER) for MHC presentation. Without effective TAP transport, cells are unable to load and express HLA class I molecules and, thus, inhibiting TAP can facilitate immune evasion. Viral inhibitors of TAP that can be used in the invention include, for example, cytomegalovirus (CMV) viral protein US6, herpes simplex virus (HSV) viral protein ICP47, bovine herpes virus-1 (BoHV-1) protein UL49.5, and Epstein Barr virus (EBV) protein BNLF2a.
(31) In another example, a complete or partial (signal peptide) CMV UL40 protein is expressed in the modified T cells of the invention. UL40 has homology with HLA Class I and does not require TAP-dependent processing for transport into the ER. Following transport, UL40 peptides are able to bind to non-classical HLA-E, facilitating surface expression. When expressed, HLA-E will inhibit NK-mediated rejection via the inhibitory receptor CD94/NKG2A. In this way, expression of UL40 provides protection to modified T cells from host immune system attack.
(32) In a further example, CMV UL18 is expressed in the modified T cells of the invention. UL18 is a viral HLA homolog that, when expressed, is able to inhibit LIR+NK-mediated rejection. UL18 requires beta-2 microglobulin for cell surface expression, and can be augmented by co-expression of UL40. Another example of an HLA homolog that can be used in the invention is UL142.
(33) As an alternative to (or in addition to) adding genes encoding proteins that facilitate immune surveillance evasion, the modified T cells of the invention can be further modified to delete the endogenous HLA locus on chromosome 6. In another example, the B2M locus is targeted (Ensembl ID ENSG00000166710, as of Jan. 10, 2018). If such a deletion is made, then the T cells will be susceptible to NK-mediated lysis. To counter this, the cells can be transduced to express the universal HLA molecule HLA-G or proteins, or portions of proteins that increase the expression of HLA-E on the surface of cells such as complete or partial UL40, or UL18.
(34) In certain embodiments, an individual gene expressing a protein that facilitates immune surveillance evasion is expressed in a modified T cell of the invention. In other embodiments, combinations of such proteins are expressed in such cells. In specific examples, UL40, US6, and UL18 are expressed together using, e.g., a multi-cistronic vector as described herein.
(35) Sequences of exemplary proteins that can be expressed in connection with facilitating evasion of immune surveillance include those listed below, as well as functional variants thereof.
(36) TABLE-US-00001 Protein SEQID Sequence CMVUS6 1 MDLLIRLGFLLMCALPTPGERSSRDPKTLLSLSPRQQACVPRTKSHRPVCYNDTG DCTDADDSWKQLGEDFAHQCLQAAKKRPKTHKSRPNDRNLEGRLTCQRVRRLL PCDLDIHPSHRLLTLMNNCVCDGAVWNAFRLIERHGFFAVTLYLCCGITLLVVILAL LCSITYESTGRGIRRCGS HSVICP47 2 MSWALEMADTFLDTMRVGPRTYADVRDEINKRGREDREAARTAVHDPERPLLRS PGLLPEIAPNASLGVAHRRTGGTVTDSPRNPVTR BoHV-1 3 MPRSPLIVAVVAAALFAIVRGRDPLLDAMRREGAMDFWSAGCYARGVPLSEPPQ UL49.5 ALVVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKESRGRG EBVBNLF2a 4 MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGL LCLLLI CMVUL40 5 MNKFSNTRIGFTCAVMAPRTLILTVGLLCMRIRSLLCSPAETTVTTAAVTSAHGPL CPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSNNTVVAFSHHPADNTLLIEVG NNTRRHVDGISCQDHFRAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEHSQ LSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYAL KKA CMVUL18 6 MMTMWCLTLFVLWMLRVVGMHVLRYGYTGIFDDTSHMTLTVVGIFDGQHFFTYH VNSSDKASSRANGTISWMANVSAAYPTYLDGERAKGDLIFNQTEQNLLELEIALGY RSQSVLTWTHECNTTENGSFVAGYEGFGWDGETLMELKDNLTLWTGPNYEISWL KQNKTYIDGKIKNISEGDTTIQRNYLKGNCTQWSVIYSGFQTPVTHPVVKGGVRNQ NDNRAEAFCTSYGFFPGEINITFIHYGNKAPDDSEPQCNPLLPTFDGTFHQGCYVA IFCNQNYTCRVTHGNWTVEIPISVTSPDDSSSGEVPDHPTANKRYNTMTISSVLLAL LLCALLFAFLHYFTTLKQYLRNLAFAWRYRKVRSS HLA-G 7 MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDT QFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGY YNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADT AAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHH PVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAV VVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAV AAVLWRKKSSD HLA-E 8 MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVD DTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVN LRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLT LNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEK GKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGH TQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLR WKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAE WSDSAQGSESHSL
Expression of Reporter or Suicide Genes
(37) Additional modifications that can be made to the modified T cells of the invention include, e.g., expression of one or more reporter genes. For example, truncated epidermal growth factor receptor (EGFR), lacking the intracellular signaling domain, can be used for in vivo depletion in the event of, e.g., toxicity, using anti-EGFR monoclonal antibodies.
(38) Another exemplary modification includes the expression of a suicide gene in modified T cells of the invention. This can be done to facilitate external, drug-mediated control of administered cells. For example, by use of a suicide gene, modified cells can be depleted from the patient in case of, e.g., an adverse event. In one example, the FK506 binding domain is fused to the caspase9 pro-apoptotic molecule. T cells engineered in this manner are rendered sensitive to the immunosuppressive drug tacrolimus. Other examples of suicide genes are thymidine kinase (TK), CD20, thymidylate kinase, truncated prostate-specific membrane antigen (PSMA), truncated low affinity nerve growth factor receptor (LNGFR), truncated CD19, and modified Fas, which can be triggered for conditional ablation by the administration of specific molecules (e.g., ganciclovir to TK+ cells) or antibodies or antibody-drug conjugates.
(39) Expression of Therapeutic Proteins-Chimeric Antigen Receptors (CARs)
(40) In addition the CD3, TRAC, and/or TRBC gene modification described above, as well as the additional optional modifications described above, the T cells of the invention can further optionally be modified to express a therapeutic protein, such as a chimeric antigen receptor (CAR). The terms chimeric antigen receptor or CAR or CARs as used herein refer to engineered T cell receptors, which graft a ligand or antigen specificity onto T cells (for example, nave T cells, central memory T cells, effector memory T cells, or combinations thereof). CARs are also known as artificial T-cell receptors, chimeric T-cell receptors, or chimeric immunoreceptors.
(41) A CAR places a chimeric extracellular target-binding domain that specifically binds a target, e.g., a polypeptide, expressed on the surface of a cell to be targeted for a T cell response onto a construct including a transmembrane domain and intracellular domain(s) of a T cell receptor molecule. In one embodiment, the chimeric extracellular target-binding domain comprises the antigen-binding domain(s) of an antibody (e.g., a single chain antibody) that specifically binds an antigen expressed on a cell to be targeted for a T cell response. The properties of the intracellular signaling domain(s) of the CAR can vary as known in the art and as disclosed herein, but the chimeric target/antigen-binding domains(s) render the receptor sensitive to signaling activation when the chimeric target/antigen binding domain binds the target/antigen on the surface of a targeted cell.
(42) With respect to intracellular signaling domains, so-called first-generation CARs include those that solely provide CD3 signals upon antigen binding. So-called second-generation CARs include those that provide both co-stimulation (e.g., CD28 or CD137) and activation (CD3) domains, and so-called third-generation CARs include those that provide multiple costimulatory (e.g., CD28 and CD137) domains and activation domains (e.g., CD3). In various embodiments, the CAR is selected to have high affinity or avidity for the target/antigenfor example, antibody-derived target or antigen binding domains will generally have higher affinity and/or avidity for the target antigen than would a naturally-occurring T cell receptor. This property, combined with the high specificity one can select for an antibody provides, highly specific T cell targeting by CAR T cells.
(43) As used herein, a CAR T cell or CAR-T refers to a T cell which expresses a CAR. When expressed in a T cell, CARs have the ability to redirect T-cell specificity and reactivity toward a selected target in a non-MHC-restricted manner, exploiting the antigen-binding properties of monoclonal antibodies. The non-MHC-restricted antigen recognition gives T-cells expressing CARs the ability to recognize an antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape. The CAR T cells of the present invention include, in addition to a CAR, a further modification, as described herein (i.e., a modification resulting in decreased or eliminated TCR expression, due to mutation or deletion of CD3, TRAC, and/or TRBC sequences as described herein). These modifications are optionally in combination with one or more further modifications including, e.g., the expression of one or more protein that facilitates immune surveillance evasion (e.g., a TAP inhibitor or an HLA homolog), suicide genes, and/or marker genes, as noted above. As an alternative to expressing a protein that facilitates immune surveillance evasion, the cell can be deleted for expression of the HLA locus on chromosome 6, and further optionally express HLA-G, as explained above.
(44) As used herein, the term extracellular target binding domain refers to a polypeptide found on the outside of the cell which is sufficient to facilitate binding to a target. The extracellular target binding domain will specifically bind to its binding partner, i.e., the target. As non-limiting examples, the extracellular target-binding domain can include an antigen-binding domain of an antibody, or a ligand, which recognizes and binds with a cognate binding partner (for example, CD19, BCMA, or CD3) protein. In this context, a ligand is a molecule which binds specifically to a portion of a protein and/or receptor. The cognate binding partner of a ligand useful in the methods and compositions described herein can generally be found on the surface of a cell. Ligand: cognate partner binding can result in the alteration of the ligand-bearing receptor, or activate a physiological response, for example, the activation of a signaling pathway. In one embodiment, the ligand can be non-native to the genome. Optionally, the ligand has a conserved function across at least two species. In one embodiment, the extracellular target binding domain comprises a non-antibody ligand (e.g., A PRoliferation-Inducing Ligand (APRIL)).
(45) Antibody Reagents
(46) In various embodiments, the CARs described herein include an antibody reagent or an antigen-binding domain thereof as an extracellular target-binding domain.
(47) As used herein, the term antibody reagent refers to a polypeptide that includes at least one immunoglobulin variable domain or immunoglobulin variable domain sequence and which specifically binds a given antigen. An antibody reagent can comprise an antibody or a polypeptide comprising an antigen-binding domain of an antibody. In some embodiments of any of the aspects, an antibody reagent can comprise a monoclonal antibody or a polypeptide comprising an antigen-binding domain of a monoclonal antibody. For example, an antibody can include a heavy (H) chain variable region (abbreviated herein as V.sub.H), and a light (L) chain variable region (abbreviated herein as V.sub.L). In another example, an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions. The term antibody reagent encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab)2, Fd fragments, Fv fragments, scFv, CDRs, and domain antibody (dAb) fragments (see, e.g., de Wildt et al., Eur J. Immunol. 1996; 26 (3): 629-39; which is incorporated by reference herein in its entirety)) as well as complete antibodies. An antibody can have the structural features of IgA, IgG, IgE, IgD, or IgM (as well as subtypes and combinations thereof). Antibodies can be from any source, including mouse, rabbit, pig, rat, and primate (human and non-human primate) and primatized antibodies. Antibodies also include midibodies, humanized antibodies, chimeric antibodies, and the like. Fully human antibody binding domains can be selected, for example, from phage display libraries using methods known to those of ordinary skill in the art.
(48) The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). The extent of the framework region and CDRs has been precisely defined (see, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, and Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917; which are incorporated by reference herein in their entireties). Each V.sub.H and V.sub.L is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
(49) In one embodiment, the antibody or antibody reagent is not a human antibody or antibody reagent, (e.g., the antibody or antibody reagent is mouse), but has been humanized. A humanized antibody or antibody reagent refers to a non-human antibody or antibody reagent that has been modified at the protein sequence level to increase its similarity to antibody or antibody reagent variants produced naturally in humans. One approach to humanizing antibodies employs the grafting of murine or other non-human CDRs onto human antibody frameworks.
(50) In one embodiment, an extracellular target binding domain of a CAR comprises or consists essentially of a single-chain Fv (scFv) fragment created by fusing the V.sub.H and V.sub.L domains of an antibody, generally a monoclonal antibody, via a flexible linker peptide. In various embodiments, the scFv is fused to a transmembrane domain and to a T cell receptor intracellular signaling domain, e.g., an engineered intracellular signaling domain as described herein.
(51) In one embodiment, the CARs useful in the technology described herein comprise at least two antigen-specific targeting regions, an extracellular domain, a transmembrane domain, and an intracellular signaling domain. In such embodiments, the two or more antigen-specific targeting regions target at least two different antigens and may be arranged in tandem and separated by linker sequences. In another embodiment, the CAR is a bispecific CAR. A bispecific CAR is specific to two different antigens.
(52) Target/Antigen
(53) Any cell-surface moiety can be targeted by a CAR. Most often, the target will be a cell-surface polypeptide differentially or preferentially expressed on a cell one wishes to target for a T cell response. In this regard, tumor antigens or tumor-associated antigens are attractive targets, providing a means to target tumor cells while avoiding or at least limiting collateral damage to non-tumor cells or tissues. Non-limiting examples of tumor antigens or tumor-associated antigens include CD19, BCMA, CD3, CEA, Immature laminin receptor, TAG-72, HPV E6 and E7, BING-4, Calcium-activated chloride channel 2, Cyclin B1, 9D7, Ep-CAM, EphA3, Her2/neu, Telomerase, Mesotheliun, SAP-1, Survivin, BAGE family, CAGE family, GAGE family, MAGE family, SAGE family, XAGE family, NY-ESO-1/LAGE-1, PRAME, SSX-2, Melan-A/MART-1, Gp100/pmel17, Tyrosinase, TRP-1/-2, MC1R, BRCA1/2, CDK4, MART-2, p53, Ras, MUC1, and TGF-RII.
(54) In one embodiment, the target is B cell maturation antigen (BCMA), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17). BCMA is a cell surface receptor expressed preferentially on mature B lymphocytes that specifically recognizes B cell activating factor (BAFF). BCMA sequences are known for a number of species, e.g., human BCMA (NCBI Gene ID: 608) polypeptide (e.g., NCBI Ref Seq NP_001183.2) and mRNA (e.g., NCBI Ref Seq NM_001192.2). BCMA can refer to human BCMA, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, BCMA can refer to the BCMA of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human BCMA are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference BCMA sequence.
(55) In one embodiment, the BCMA-binding sequence comprises a ligand of BCMA or an antibody reagent that specifically binds BCMA. In one embodiment, the antibody reagent that specifically binds BCMA is a scFv from a humanized anti-BCMA m murine antibody. The orientation of a humanized murine antibody-derived single-chain variable fragment can be V.sub.L-V.sub.H or V.sub.H-V.sub.L.
(56) In one embodiment, the target is CD37. CD37 is cell surface protein that contains four hydrophobic transmembrane domains. CD37 is expressed exclusively on immune cells; CD37 is highly expressed on mature B cells, and moderately expressed on T cells and myloid cells. CD37 sequences are known for a number of species, e.g., human CD37 (NCBI Gene ID: 951) polypeptide (e.g., NCBI Ref Seq NP_001035120.1) and mRNA (e.g., NCBI Ref Seq NM_001040031.1). CD37 can refer to human CD37, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, CD37 can refer to the CD37 of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human CD37 are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference CD37 sequence. In one embodiment, the CD37-binding sequence comprises a ligand of CD37 or an antibody reagent that specifically binds CD37.
(57) Transmembrane Domain
(58) Each CAR as described herein necessarily includes a transmembrane domain that joins the extracellular target-binding domain to the intracellular signaling domain.
(59) As used herein, transmembrane domain (TM domain) refers to the generally hydrophobic region of the CAR which crosses the plasma membrane of a cell. The TM domain can be the transmembrane region or fragment thereof of a transmembrane protein (for example a Type I transmembrane protein or other transmembrane protein), an artificial hydrophobic sequence, or a combination thereof. While specific examples are provided herein, other transmembrane domains will be apparent to those of skill in the art and can be used in connection with alternate embodiments of the technology. A selected transmembrane region or fragment thereof would preferably not interfere with the intended function of the CAR. As used in relation to a transmembrane domain of a protein or polypeptide, fragment thereof refers to a portion of a transmembrane domain that is sufficient to anchor or attach a protein to a cell surface.
(60) In one embodiment, the transmembrane domain or fragment thereof of a CAR is derived from or comprises the transmembrane domain of CD8. In an alternate embodiment, the transmembrane domain or fragment thereof of the CAR described herein comprises a transmembrane domain selected from the transmembrane domain of an alpha, beta or zeta chain of a T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, KIRDS2, OX40, CD2, CD27, LFA-1 (CDI Ia, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRFI), CD160, CD19, IL2R beta, IL2R gamma, IL7R a, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDI Id, ITGAE, CD103, ITGAL, CDI Ia, LFA-1, ITGAM, CDI Ib, ITGAX, CDI Ic, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), SLAMF6 (NTB-A, Lyl08), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, PAG/Cbp, NKp44, NKp30, NKp46, NKG2D, and/or NKG2C.
(61) CD8 is an antigen preferentially found on the cell surface of cytotoxic T lymphocytes. CD8 mediates cell-cell interactions within the immune system, and acts as a T cell co-receptor. CD8 consists of an alpha (CD8) and beta (CD8) chain. CD8a sequences are known for a number of species, e.g., human CD8a, (NCBI Gene ID: 925) polypeptide (e.g., NCBI Ref Seq NP_001139345.1) and mRNA (e.g., NCBI Ref Seq NM_000002.12). CD8 can refer to human CD8, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, CD8 can refer to the CD8 of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human CD8 are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference CD8 sequence.
(62) Co-Stimulatory Domain
(63) Each CAR described herein can comprise an intracellular domain of a co-stimulatory molecule, or co-stimulatory domain. As used herein, the term co-stimulatory domain refers to an intracellular signaling domain of a co-stimulatory molecule. Co-stimulatory molecules are cell surface molecules other than antigen receptors or Fc receptors that provide a second signal required for efficient activation and function of T lymphocytes upon binding to antigen. Illustrative examples of such co-stimulatory molecules include CARD11, CD2, CD7, CD27, CD28, CD30, CD40, CD54 (ICAM), CD83, CD134 (OX40), CD137 (4-1BB), CD150 (SLAMF1), CD152 (CTLA4), CD223 (LAG3), CD270 (HVEM), CD273 (PD-L2), CD274 (PD-L1), CD278 (ICOS), DAP10, LAT, NKD2C SLP76, TRIM, and ZAP70. In one embodiment, the intracellular domain is the intracellular domain of 4-1BB.
(64) 4-1BBL is a type 2 transmembrane glycoprotein belonging to the TNF superfamily. 4-1BBL is expressed on activated T lymphocytes. 4-1BBL sequences are known for a number of species, e.g., human 4-1BBL, also known as TNFSF9 (NCBI Gene ID: 8744) polypeptide (e.g., NCBI Ref Seq NP_003802.1) and mRNA (e.g., NCBI Ref Seq NM_003811.3). 4-1BBL can refer to human 4-1BBL, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, 4-1BBL can refer to the 4-1BBL of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human 4-1BBL are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference 4-1BBL sequence.
(65) Intracellular Signaling Domain
(66) CARs as described herein comprise an intracellular signaling domain. An intracellular signaling domain refers to the part of a CAR polypeptide that participates in transducing the message of effective CAR binding to a target antigen into the interior of the immune effector cell to elicit effector cell function, e.g., activation, cytokine production, proliferation, and cytotoxic activity, including the release of cytotoxic factors to the CAR-bound target cell, or other cellular responses elicited following antigen binding to the extracellular CAR domain.
(67) As noted above, CD3 is a T cell co-receptor that facilitates T lymphocyte activation when simultaneously engaged with the appropriate co-stimulation (e.g., binding of a co-stimulatory molecule). A CD3 complex consists of 4 distinct chains; mammalian CD3 consists of a CD3 chain, a CD3 chain, and two CD3& chains. These chains associate with a molecule known as the T cell receptor (TCR) and CD3 to generate an activation signal in T lymphocytes. A complete TCR complex comprises a TCR, CD3, and the complete CD3 complex.
(68) In some embodiments of any aspect, a CAR polypeptide described herein comprises an intracellular signaling domain that comprises an Immunoreceptor Tyrosine-based Activation Motif or ITAM from CD3 zeta (CD3). In some embodiments of any aspect, the ITAM comprises three motifs of ITAM of CD3(ITAM3). In some embodiments of any aspect, the three motifs of ITAM of CD3 are mutated.
(69) ITAMs are known as a primary signaling domains which regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way. Primary signaling domains that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs. Non-limiting examples of ITAM-containing intracellular signaling domains that are of particular use in the technology include those derived from TCR, FcR, FcR, CD3, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, and CD66d.
(70) One skilled in the art will be capable of introducing mutations into the nucleic acid sequence of a gene or gene product, for example an ITAM, using standard techniques. For example, point mutations can be introduced via site-directed point mutagenesis, a PCR technique. Site-directed mutagenesis kits are commercially available, for instance, through New England Biolabs; Ipswich, MA. Non-limiting examples of alternative methods to introduce point mutations into the nucleic acid sequence of a gene or gene product include cassette mutagenesis or whole plasmid mutagenesis.
(71) In one embodiment, the ITAM utilized in the CAR is based on alternatives to CD3, including mutated ITAMs from CD3 (which contains 3 ITAM motifs), truncations of CD3, and alternative splice variants known as CD3, CD3, and artificial constructs engineered to express fusions between CD3 or CD3 and CD3.
(72) In one embodiment, the CD3ITAM3 sequence corresponds to the sequence of SEQ ID NO: 9; or comprises the sequence of SEQ ID NO: 9; or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity to the sequence of SEQ ID NO: 9.
(73) In one embodiment, the intracellular signaling domain comprises a CD3 ITAM3 sequence selected from SEQ ID NOs: 9, 10, 11, or 12. In one embodiment, the tyrosine residues are mutated to phenylalanine residues, thereby inhibiting the phosphorylation of the native tyrosine residues. Exemplary tyrosine residues that can be mutated include It is contemplated that the tyrosine residues can be mutated to any residue that results in the inhibition of tyrosine phosphorylation. In another embodiment of any aspect, tyrosines are mutated in at least one, at least two, or all three ITAMs (e.g., ITAM I, II, and III).
(74) In one embodiment, the T-cell intracellular signaling domain comprises the ITAMs of CD3 eta (CD3), CD3 theta (CD3), or CD3. In one embodiment, the T-cell intracellular signaling domain is the ITAM of CD3 eta (CD3), CD3 theta (CD3), or CD3.
(75) In one embodiment, the intracellular signaling domain comprises a CD35 ITAM3 sequence comprising a deletion relative to the CD35 ITAM3 sequence of SEQ ID NO: 9.
(76) The sequence of SEQ ID NO: 9 is provided below, followed by additional information concerning SEQ ID NOs: 10, 11, and 12:
(77) TABLE-US-00002 (SEQIDNO:9) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
(78) CD3-mutITAM 1 (SEQ ID NO: 10). As described herein, certain residues are mutated in CD32-ITAM 3 to inhibit the function of CD3-ITAM 3, namely: Y21 and Y32. The locations of these residues are depicted below with bold type.
(79) TABLE-US-00003 (SEQIDNO:10) RVKFSRSADAPAYQQGQNQLFNELNLGRREEFDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
(80) CD3-mutITAM1 and mutITAM2 (SEQ ID NO: 11). As described herein, certain residues are mutated in CD3-ITAM 3 to inhibit the function of CD3-ITAM 3, namely: Y21, Y32, Y59 and Y71. The locations of these residues are depicted below with bold type.
(81) TABLE-US-00004 (SEQIDNO:11) RVKFSRSADAPAYQQGQNQLFNELNLGRREEFDVLDKRRGRDPEMGGKPR RKNPQEGLFNELQKDKMAEAFSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
(82) CD3-mutITAM1 and mutITAM3 (SEQ ID NO: 12). As described herein, certain residues are mutated in CD3-ITAM 3 to inhibit the function of CD3-ITAM 3, namely: Y21, Y32, Y90 and Y100. The locations of these residues are depicted below with bold type.
(83) TABLE-US-00005 (SEQIDNO:12) RVKFSRSADAPAYQQGQNQLFNELNLGRREEFDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLFQGLSTATKDT FDALHMQALPPR
(84) A deletion relative to the CD3 ITAM3 sequence can be performed using techniques well known in the art, for example, CRISPR, TALEN, or ZFN technology (also see above). Methods of engineering nucleases to achieve a desired sequence specificity are known in the art and are described, e.g., in the references cited above.
(85) A more detailed description of CARs and CAR T cells, which can be adapted for use in the invention, can be found, e.g., in Maus et al., Blood 2014 123:2624-35; Reardon et al., Neuro-Oncology 2014 16:1441-1458; Hoyos et al., Haematologica 2012 97:1622; Byrd et al., J Clin Oncol 2014 32:3039-47; Maher et al., Cancer Res 2009 69:4559-4562; and Tamada et al., Clin Cancer Res 2012 18:6436-6445; each of which is incorporated by reference herein in its entirety.
(86) In one embodiment, the CAR further comprises a linker domain. As used herein linker domain refers to an oligo- or polypeptide region from about 2 to 100 amino acids in length, which links together any of the domains/regions of the CARs as described herein. In some embodiments, linkers can include or be composed of flexible residues such as glycine and serine so that the adjacent, linked protein domains are free to move relative to one another. Longer linkers may be used when it is desirable to ensure that two adjacent domains do not sterically interfere with one another. Linkers may be cleavable or non-cleavable. Examples of cleavable linkers include 2A linkers (for example T2A), 2A-like linkers or functional equivalents thereof and combinations thereof. In one embodiment, the linker region is T2A derived from Thosea asigna virus. Non-limiting examples of linkers that can be used in this technology include P2A and F2A. In addition to use in the context of CARs, these cleavable linkers can also be used in the multicistronic vectors described herein.
(87) In one embodiment, a CAR as described herein further comprises a reporter molecule, e.g., to permit for non-invasive imaging (e.g., positron-emission tomography PET scan). In a bispecific CAR that includes a reporter molecule, the first extracellular binding domain and the second extracellular binding domain can include different or the same reporter molecule. In a bispecific CAR T cell, the first CAR and the second CAR can express different or the same reporter molecule. In another embodiment, a CAR as described herein further comprises a reporter molecule (for example, hygromycin phosphotransferase (hph)) that can be imaged alone or in combination with a substrate or chemical (for example, 9-[4-[.sup.18F]fluoro-3-(hydroxymethyl)butyl] guanine ([.sup.18F]FHBG)). In another embodiment, a CAR as described herein further comprises nanoparticles at can be readily imaged using non-invasive techniques (e.g., gold nanoparticles (GNP) functionalized with .sup.64Cu.sup.2+). Labeling of CAR T cells for non-invasive imaging is reviewed, for example, in Bhatnagar P, et al., Integr. Biol. (Camb). 2013 January; 5 (1): 231-238, and Keu K V, et al., Sci Transl Med. 2017 Jan. 18; 9 (373), which are incorporated herein by reference in their entireties.
(88) GFP and mCherry are demonstrated herein as fluorescent tags useful for imaging a CAR expressed on a T cell (e.g., a CAR T cell). It is expected that essentially any fluorescent protein known in the art can be used as a fluorescent tag for this purpose. For clinical applications, the CAR need not include a fluorescent tag or fluorescent protein.
(89) Constructs, Vectors, and Expression
(90) The invention also provides constructs and vectors for use in generating modified T cells, as described herein. In various examples, the invention provides constructs that each include separate coding sequences for multiple proteins to be expressed in a modified T cell of the invention. These separate coding sequences can be separated from one another by a cleavable linker sequence as described herein. For example, sequences encoding viral 2A proteins (e.g., T2A, P2A, E2A, and F2A) can be placed between the separate genes and, when transcribed, can direct cleavage of the generated polyprotein. As noted above, constructs and vectors of the invention can include any of a number of different combinations of sequences. For example, a construct or vector of the invention can include sequences encoding one or more full length or partial sequences (e.g., each) of UL40, US6, UL18, HLA-E, and HLA-G, optionally in combination with a CAR.
(91) Constructs including sequences encoding proteins for expression in the modified T cells of the invention can be comprised within vectors, which are also provided by the invention. In various examples, the vectors are retroviral vectors. Retroviruses, such as lentiviruses, provide a convenient platform for delivery of nucleic acid sequences encoding a gene, or chimeric gene of interest. A selected nucleic acid sequence can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells, e.g., in vitro or ex vivo. Retroviral systems are well known in the art and are described in, for example, U.S. Pat. No. 5,219,740; Kurth and Bannert (2010) Retroviruses: Molecular Biology, Genomics and Pathogenesis Calster Academic Press (ISBN: 978-1-90455-55-4); and Hu and Pathak Pharmacological Reviews 2000 52:493-512; which are incorporated by reference herein in their entirety. Lentiviral system for efficient DNA delivery can be purchased from OriGene; Rockville, MD. In various embodiments, the protein is expressed in the T cell by transfection or electroporation of an expression vector comprising nucleic acid encoding the protein using vectors and methods that are known in the art.
(92) Efficient expression of proteins in modified T cells as described herein can be assessed using standard assays that detect the mRNA, DNA, or gene product of the nucleic acid encoding the proteins. For example, RT-PCR, FACS, northern blotting, western blotting, ELISA, or immunohistochemistry can be used. In various embodiments, the proteins described herein are constitutively expressed. In other embodiments, the proteins are encoded by recombinant nucleic acid sequence.
(93) Therapeutic Methods, Compositions, and Kits
(94) The invention provides methods and compositions for use in treating and preventing diseases and conditions including, for example, cancer, infectious diseases, autoimmune diseases or disorders, plasma cell diseases or disorders, or conditions relating to transplantation in a subject in need thereof (e.g., a subject having or diagnosed as having the disease or condition). These methods include modifying a T cell in a manner described herein, and then administering the modified T cell to the subject. In some embodiments of any of the aspect, the modified T cell (e.g., a CAR-T cell including one or more additional modification as described herein) is stimulated and/or activated prior to administration to the subject.
(95) As used herein, a condition includes cancer, an infectious disease, an autoimmune disease or disorder, a plasma cell disease or disorder, or a condition relating to transplantation. Subjects having a disease or condition can be identified by a physician using current methods of diagnosing the disease or condition. Symptoms and/or complications of the disease or condition, which characterize these conditions and aid in diagnosis are well known in the art and include, but are not limited to, fatigue, persistent infections, and persistent bleeding. Tests that may aid in a diagnosis of, e.g., the disease or condition include, but are not limited to, blood screening and bone marrow testing, and are known in the art for a given condition. A family history for a disease or condition, or exposure to risk factors for a disease or condition, can also aid in determining if a subject is likely to have the disease or condition or in making a diagnosis of the disease or condition.
(96) Cancer as used herein can refer to a hyperproliferation of cells whose unique traitloss of normal cellular controlresults in unregulated growth, lack of differentiation, local tissue invasion, and metastasis, and can be leukemia, lymphoma, multiple myeloma, or a solid tumor. Non-limiting examples of leukemia include acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), and chronic lymphocytic leukemia (CLL). In one embodiment, the cancer is ALL or CLL. Non-limiting examples of lymphoma include diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), mantle cell lymphoma (MCL), marginal zone lymphomas, Burkitt lymphoma, hairy cell leukemia (HCL). In one embodiment, the cancer is DLBCL or follicular lymphoma. Non-limiting examples of solid tumors include adrenocortical tumor, alveolar soft part sarcoma, carcinoma, chondrosarcoma, colorectal carcinoma, desmoid tumors, desmoplastic small round cell tumor, endocrine tumors, endodermal sinus tumor, epithelioid hemangioendothelioma, Ewing sarcoma, germ cell tumors (solid tumor), giant cell tumor of bone and soft tissue, hepatoblastoma, hepatocellular carcinoma, melanoma, nephroma, neuroblastoma, non-rhabdomyosarcoma soft tissue sarcoma (NRSTS), osteosarcoma, paraspinal sarcoma, renal cell carcinoma, retinoblastoma, rhabdomyosarcoma, synovial sarcoma, and Wilms tumor. Solid tumors can be found in bones, muscles, tissues, or organs, and can be sarcomas or carinomas. It is contemplated that any aspect of the technology described herein can be used to treat all types of cancers, including cancers not listed in the instant application. As used herein, the term tumor refers to an abnormal growth of cells or tissues, e.g., of malignant type or benign type.
(97) As used herein, an autoimmune disease or disorder is characterized by the inability of one's immune system to distinguish between a foreign cell and a healthy cell. This results in one's immune system targeting one's healthy cells for programmed cell death. Non-limiting examples of autoimmune diseases or disorders include inflammatory arthritis, type 1 diabetes mellitus, multiples sclerosis (MS), psoriasis, inflammatory bowel diseases, systemic lupus erythematosus (SLE), vasculitis, allergic inflammation, such as allergic asthma, atopic dermatitis, and contact hypersensitivity. Other examples of auto-immune-related diseases or disorders, include but are not limited to, rheumatoid arthritis, Graves' disease (overactive thyroid), Hashimoto's thyroiditis (underactive thyroid), celiac disease, Crohn's disease, ulcerative colitis, Guillain-Barre syndrome, primary biliary sclerosis/cirrhosis, sclerosing cholangitis, autoimmune hepatitis, Raynaud's phenomenon, scleroderma, Sjogren's syndrome, Goodpasture's syndrome, Wegener's granulomatosis, polymyalgia rheumatica, temporal arteritis/giant cell arteritis, chronic fatigue syndrome CFS), autoimmune Addison's Disease, ankylosing spondylitis, acute disseminated encephalomyelitis, antiphospholipid antibody syndrome, aplastic anemia, idiopathic thrombocytopenia purpura, myasthenia gravis, opsoclonus myoclonus syndrome, optic neuritis, Ord's thyroiditis, pemphigus, pernicious anaemia, polyarthritis in dogs, Reiter's syndrome, Takayasu's arteritis, warm autoimmune hemolytic anemia, Wegener's granulomatosis, and fibromyalgia (FM).
(98) In one embodiment, the mammalian T cell is obtained for a patient having an immune system disorder that results in abnormally low activity of the immune system, or immune deficiency disorders, which hinders one's ability to fight a foreign cell (i.e., a virus or bacterial cell).
(99) A plasma cell is a white blood cell produced from B lymphocytes, which function to generate and release antibodies needed to fight infections. As used herein, a plasma cell disorder or disease is characterized by abnormal multiplication of a plasma cell. Abnormal plasma cells are capable of crowding out healthy plasma cells, which results in a decreased capacity to fight a foreign object, such as a virus or bacterial cell. Non-limiting examples of plasma cell disorders include amyloidosis, Waldenstrom's macroglobulinemia, osteosclerotic myeloma (POEMS syndrome), monoclonal gammopathy of unknown significance (MGUS), and plasma cell myeloma.
(100) The compositions described herein (see below) can be administered to a subject having or diagnosed as having a disease or condition. In some embodiments, the methods described herein comprise administering an effective amount of modified T cells (e.g., activated CAR T cells) described herein to a subject in order to alleviate a symptom of the condition. As used herein, alleviating a symptom of the condition is ameliorating any condition or symptom associated with the condition. As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99%, or more as measured by any standard technique. A variety of means for administering the compositions described herein to subjects are known to those of skill in the art. In one embodiment, the compositions described herein are administered systemically or locally. In another embodiment, the compositions described herein are administered intravenously. In another embodiment, the compositions described herein are administered at the site of a tumor.
(101) The term effective amount as used herein refers to the amount of modified T cells (e.g., activated CAR T cells) needed to alleviate at least one or more symptom of the disease or disorder, and relates to a sufficient amount of the cell preparation or composition to provide the desired effect. The term therapeutically effective amount therefore refers to an amount of modified T cells (e.g., activated CAR T cells) that is sufficient to provide a particular anti-disease or condition effect when administered to a typical subject. An effective amount as used herein, in various contexts, would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom disease (for example, but not limited to, slowing the progression of a disease or condition), or reverse a symptom of the condition. Thus, it is not generally practicable to specify an exact effective amount. However, for any given case, an appropriate effective amount can be determined by one of ordinary skill in the art using only routine experimentation.
(102) Effective amounts, toxicity, and therapeutic efficacy can be evaluated by standard pharmaceutical procedures in cell cultures or experimental animals. The dosage can vary depending upon the dosage form employed and the route of administration utilized. The dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio LD50/ED50. Compositions and methods that exhibit large therapeutic indices are preferred. A therapeutically effective dose can be estimated initially from cell culture assays. Also, a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of modified T cells, which achieves a half-maximal inhibition of symptoms) as determined in cell culture, or in an appropriate animal model. Levels in plasma can be measured, for example, by high performance liquid chromatography. The effects of any particular dosage can be monitored by a suitable bioassay, e.g., assay for bone marrow testing, among others. The dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.
(103) In one aspect, the technology described herein relates to pharmaceutical compositions comprising modified T cells as described herein, and optionally a pharmaceutically acceptable carrier. The active ingredients of the pharmaceutical composition at a minimum comprise modified T cells as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist essentially of modified T cells as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist of modified T cells as described herein. Pharmaceutically acceptable carriers for cell-based therapeutic formulation include saline and aqueous buffer solutions, Ringer's solution, and serum component, such as serum albumin, HDL, and LDL. The terms such as excipient, carrier, pharmaceutically acceptable carrier, or the like are used interchangeably herein.
(104) In some embodiments, the pharmaceutical composition comprising modified T cells as described herein can be a parenteral dose form. Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, the components apart from the modified T cells themselves are preferably sterile or capable of being sterilized prior to administration to a patient. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions. Any of these can be added to the modified T cell preparations prior to administration.
(105) Suitable vehicles that can be used to provide parenteral dosage forms of modified T cells as disclosed herein are well known to those skilled in the art. Examples include, without limitation: saline solution; glucose solution; aqueous vehicles including but not limited to, sodium chloride injection, Ringer's injection, dextrose Injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water-miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
(106) The invention further includes kits for use in carrying out the methods of the invention. The kits can thus optionally include one or more reagents for making the modified T cells (e.g., nucleic acid molecules and/or enzymes used to carry out the deletions and/or additions of genetic sequences). The kits can further include the universal T cells generated by the methods of the invention, which can be used as an of the shelf source of therapeutic materials for patient treatment. The kits can further include instruments or devices that can be used to administer the modified T cells, as well as, optionally, directions for use of the compositions and methods of the invention.
(107) Dosage
(108) Unit dosage form as the term is used herein refers to a dosage for suitable one administration. By way of example a unit dosage form can be an amount of therapeutic disposed in a delivery device, e.g., a syringe or intravenous drip bag. In one embodiment, a unit dosage form is administered in a single administration. In another, embodiment more than one unit dosage form can be administered simultaneously.
(109) In some embodiments, the modified T cells described herein are administered as a monotherapy, i.e., another treatment for the condition is not concurrently administered to the subject.
(110) A pharmaceutical composition comprising the modified T cells described herein can generally be administered at a dosage of 10.sup.4 to 10.sup.9 cells/kg body weight, in some instances 10.sup.5 to 10.sup.6 cells/kg body weight, including all integer values within those ranges. If necessary, the modified T cell compositions can also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988).
(111) In certain aspects, it may be desired to administer modified T cells to a subject and then subsequently redraw blood (or have an apheresis performed), activate T cells therefrom as described herein, and reinfuse the patient with these activated and expanded T cells. This process can be carried out multiple times every few weeks. In certain aspects, T cells can be activated from blood draws of from 10 cc to 400 cc. In certain aspects, T cells are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or 100 cc.
(112) Modes of administration can include, for example, intravenous (i.v.) injection or infusion. The compositions described herein can be administered to a patient transarterially, intratumorally, intranodally, or intramedullary. In some embodiments, the compositions of modified T cells may be injected directly into a tumor, lymph node, or site of infection. In one embodiment, the compositions described herein are administered into a body cavity or body fluid (e.g., ascites, pleural fluid, peritoneal fluid, or cerebrospinal fluid).
(113) In a particular exemplary aspect, and as described above, subjects may undergo leukapheresis, wherein leukocytes are collected, enriched, or depleted ex vivo to select and/or isolate the cells of interest, e.g., T cells. This process can include standard methods, e.g., stimulation by the use of magnetic beads coated with antibodies against CD3 and CD28. Alternatively, the T cells can be expanded by contact with an artificial antigen presenting cell (aAPC). These cells are engineered to express chimeric stimulatory receptors (CSRs) and, optionally, the cells are modified by knockdown or inactivation of low density lipoprotein receptor (LDLR) expression. The CSRs each comprise (i) an antibody reagent or natural ligand for a T cell co-stimulatory receptor (e.g., CD3, CD28, OX40, or 4-1BB, among others) or a T cell receptor; (ii) a linker domain, and (iii) a transmembrane domain. In one example, an aAPC is engineered to express CSRs against CD3 and CD28. Antibody reagents, linker domains, and transmembrane domains are, e.g., as described elsewhere herein. Cells that can be used to make aAPCs include, e.g., human cells, such as, e.g., erythromyeloid cells (e.g., K562 cells), myeloid cells, or cells engineered to lack HLA expression or functional HLA. Thus, T cell isolates can be expanded by contact with an aAPC as described herein (e.g., an aAPC expressing anti-CD28 and anti-CD3 CDRs as described herein) and treated such that one or more CAR constructs of the technology may be introduced, thereby creating a CAR T cell. Subjects in need thereof can subsequently undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. Following or concurrent with the transplant, subjects can receive an infusion of the expanded CAR T cells. In one embodiment, expanded cells are administered before or following surgery.
(114) In some embodiments, lymphodepletion is performed on a subject prior to administering one or more modified T cell as described herein. In such embodiments, the lymphodepletion can comprise administering one or more of melphalan, cytoxan, cyclophosphamide, and fludarabine.
(115) The dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment. The scaling of dosages for human administration can be performed according to art-accepted practices.
(116) In some embodiments, a single treatment regimen is required. In others, administration of one or more subsequent doses or treatment regimens can be performed. For example, after treatment biweekly for three months, treatment can be repeated once per month, for six months or a year or longer. In some embodiments, no additional treatments are administered following the initial treatment.
(117) The dosage of a composition as described herein can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to administer further cells, discontinue treatment, resume treatment, or make other alterations to the treatment regimen. The dosage should not be so large as to cause adverse side effects, such as cytokine release syndrome. Generally, the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art. The dosage can also be adjusted by the individual physician in the event of any complication.
(118) Combination Therapy
(119) The modified T cells (e.g., activated CAR T cells) described herein can be used in combination with other known agents and therapies. Administered in combination, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder (e.g., disease or condition), e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons. In some embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as simultaneous or concurrent delivery. In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered. The modified T cells (e.g., activated CAR T cells) described herein and the at least one additional therapeutic agent can be administered simultaneously, in the same or in separate compositions, or sequentially. For sequential administration, the modified T cells (e.g., CAR-expressing cells) can be administered first, and the additional agent can be administered second, or the order of administration can be reversed. The CAR T therapy and/or other therapeutic agents, procedures, or modalities can be administered during periods of active disorder, or during a period of remission or less active disease. The modified T cell therapy can be administered before another treatment, concurrently with the treatment, post-treatment, or during remission of the disorder.
(120) When administered in combination, the modified T cells and the additional agent (e.g., second or third agent), or all, can be administered in an amount or dose that is higher, lower, or the same as the amount or dosage of each agent used individually, e.g., as a monotherapy. In certain embodiments, the administered amount or dosage of the modified T cells, the additional agent (e.g., second or third agent), or all, is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50%) than the amount or dosage of each agent used individually. In other embodiments, the amount or dosage of the modified T cells, the additional agent (e.g., second or third agent), or all, that results in a desired effect (e.g., treatment of cancer) is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50% lower) than the amount or dosage of each agent individually required to achieve the same therapeutic effect. In further embodiments, the modified T cells described herein can be used in a treatment regimen in combination with surgery, chemotherapy, radiation, an mTOR pathway inhibitor, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, or a peptide vaccine, such as that described in Izumoto et al., J. Neurosurg. 108:963-971, 2008.
(121) In one embodiment, the modified T cells described herein can be used in combination with a checkpoint inhibitor. Exemplary checkpoint inhibitors include anti-PD-1 inhibitors (Nivolumab, MK-3475, Pembrolizumas, Pidilizumab, AMP-224, AMP-514), anti-CTLA4 inhibitors (Ipilimumab and Tremelimumab), anti-PDL1 inhibitors (Atezolizumab, Avelomab, MSB0010718C, MEDI4736, and MPDL3280A), and anti-TIM3 inhibitors.
(122) In one embodiment, the modified T cells described herein can be used in combination with a chemotherapeutic agent. Exemplary chemotherapeutic agents include an anthracycline (e.g., doxorubicin (e.g., liposomal doxorubicin)), a vinca alkaloid (e.g., vinblastine, vincristine, vindesine, vinorelbine), an alkylating agent (e.g., cyclophosphamide, decarbazine, melphalan, ifosfamide, temozolomide), an immune cell antibody (e.g., alemtuzamab, gemtuzumab, rituximab, tositumomab), an antimetabolite (including, e.g., folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors (e.g., fludarabine)), an mTOR inhibitor, a TNFR glucocorticoid induced TNFR related protein (GITR) agonist, a proteasome inhibitor (e.g., aclacinomycin A, gliotoxin or bortezomib), an immunomodulator such as thalidomide or a thalidomide derivative (e.g., lenalidomide). General chemotherapeutic agents considered for use in combination therapies include anastrozole (Arimidex), bicalutamide (Casodex), bleomycin sulfate (Blenoxane), busulfan (Myleran), busulfan injection (Busulfex), capecitabine (Xeloda), N4-pentoxycarbonyl-5-deoxy-5-fluorocytidine, carboplatin (Paraplatin), carmustine (BiCNU), chlorambucil (Leukeran), cisplatin (Platinol), cladribine (Leustatin), cyclophosphamide (Cytoxan or Neosar), cytarabine, cytosine arabinoside (Cytosar-U), cytarabine liposome injection (DepoCyt), dacarbazine (DTIC-Dome), dactinomycin (Actinomycin D, Cosmegan), daunorubicin hydrochloride (Cerubidine), daunorubicin citrate liposome injection (DaunoXome), dexamethasone, docetaxel (Taxotere), doxorubicin hydrochloride (Adriamycin, Rubex), etoposide (Vepesid), fludarabine phosphate (Fludara), 5-fluorouracil (Adrucil, Efudex), flutamide (Eulexin), tezacitibine, Gemcitabine (difluorodeoxycitidine), hydroxyurea (Hydrea), Idarubicin (Idamycin), ifosfamide (IFEX), irinotecan (Camptosar), L-asparaginase (ELSPAR), leucovorin calcium, melphalan (Alkeran), 6-mercaptopurine (Purinethol), methotrexate (Folex), mitoxantrone (Novantrone), mylotarg, paclitaxel (Taxol), phoenix (Yttrium90/MX-DTPA), pentostatin, polifeprosan 20 with carmustine implant (Gliadel), tamoxifen citrate (Nolvadex), teniposide (Vumon), 6-thioguanine, thiotepa, tirapazamine (Tirazone), topotecan hydrochloride for injection (Hycamptin), vinblastine (Velban), vincristine (Oncovin), and vinorelbine (Navelbine). Exemplary alkylating agents include, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas, and triazenes): uracil mustard (Aminouracil Mustard, Chlorethaminacil, Demethyldopan, Desmethyldopan, Haemanthamine, Nordopan, Uracil nitrogen Mustard, Uracillost, Uracilmostaza, Uramustin, Uramustine), chlormethine (Mustargen), cyclophosphamide (Cytoxan), Neosar, Clafen, Endoxan, Procytox, Revimmune), ifosfamide (Mitoxana), melphalan (Alkeran), Chlorambucil (Leukeran), pipobroman (Amedel, Vercyte), triethylenemelamine (Hemel, Hexalen, Hexastat), triethylenethiophosphoramine, Temozolomide (Temodar), thiotepa (Thioplex), busulfan (Busilvex, Myleran), carmustine (BICNU), lomustine (CeeNU), streptozocin (Zanosar), and Dacarbazine (DTIC-Dome). Additional exemplary alkylating agents include, without limitation, Oxaliplatin (Eloxatin); Temozolomide (Temodar and Temodal); Dactinomycin (also known as actinomycin-D, Cosmegen); Melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, Alkeran); Altretamine (also known as hexamethylmelamine (HMM), Hexalen); Carmustine (BiCNU); Bendamustine (Treanda); Busulfan (Busulfex and Myleran); Carboplatin (Paraplatin); Lomustine (also known as CCNU, CeeNU); Cisplatin (also known as CDDP, Platinol and Platinol-AQ); Chlorambucil (Leukeran); Cyclophosphamide (Cytoxan and Neosar); Dacarbazine (also known as DTIC, DIC and imidazole carboxamide, DTIC-Dome); Altretamine (also known as hexamethylmelamine (HMM), Hexalen); Ifosfamide (Ifex); Prednumustine; Procarbazine (Matulane); Mechlorethamine (also known as nitrogen mustard, mustine and mechloroethamine hydrochloride, Mustargen); Streptozocin (Zanosar); Thiotepa (also known as thiophosphoamide, TESPA and TSPA, Thioplex); Cyclophosphamide (Endoxan, Cytoxan), Neosar, Procytox, Revimmune); and Bendamustine HCl (Treanda). Exemplary mTOR inhibitors include, e.g., temsirolimus; ridaforolimus (formally known as deferolimus, (IR,2R,45)-4-[(2R)-2 [(1R,95,125,15R,16E,18R,19R,21R,235,24E,26E,28Z,305,325,35R)-I, 18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-| 1,36-dioxa-4-azatricyclo[30.3.1.049] hexatriaconta-16,24,26,28-tetraen-12-yl]propyl]-2-methoxycyclohexyl dimethylphosphinate, also known as AP23573 and MK8669, and described in PCT Publication No. WO 03/064383); everolimus (Afinitor or RADOOI); rapamycin (AY22989, Sirolimus); simapimod (CAS 164301-51-3); emsirolimus, (5-{2,4-Bis[(35,)-3-methylmorpholin-4-yl]pyrido[2,3-(i]pyrimidin-7-yl}-2-methoxyphenyl) methanol (AZD8055); 2-Amino-8-[iraw5,-4-(2-hydroxyethoxy)cyclohexyl]-6-(6-methoxy-3-pyridinyl)-4-methyl-pyrido[2,3-JJpyrimidin-7 (8H)-one (PF04691502, CAS 1013101-36-4); and N2-[1,4-dioxo-4-[4-(4-oxo-8-phenyl-4H-I-benzopyran-2-yl) morpholinium-4-yl]methoxy]butyl]-L-arginylglycyl-L-a-aspartyIL-serine-, inner salt (SF1126, CAS 936487-67-1), and XL765. Exemplary immunomodulators include, e.g., afutuzumab (available from Roche); pegfilgrastim (Neulasta); lenalidomide (CC-5013, Revlimid); thalidomide (Thalomid), actimid (CC4047); and IRX-2 (mixture of human cytokines including interleukin 1, interleukin 2, and interferon , CAS 951209-71-5, available from IRX Therapeutics). Exemplary anthracyclines include, e.g., doxorubicin (Adriamycin and Rubex); bleomycin (Ienoxane); daunorubicin (dauorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, Cerubidine); daunorubicin liposomal (daunorubicin citrate liposome, DaunoXome); mitoxantrone (DHAD, Novantrone); epirubicin (Ellence); idarubicin (Idamycin, Idamycin PFS); mitomycin C (Mutamycin); geldanamycin; herbimycin; ravidomycin; and desacetylravidomycin. Exemplary vinca alkaloids include, e.g., vinorelbine tartrate (Navelbine), Vincristine (Oncovin), and Vindesine (Eldisine)); vinblastine (also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ and Velban); and vinorelbine (Navelbine). Exemplary proteosome inhibitors include bortezomib (Velcade); carfilzomib (PX-171-007, (5)-4-Methyl-N-((5)-I-(((5)-4-methyl-I-((R)-2-methyloxiran-2-yl)-I-oxopentan-2-yl)amino)-I-oxo-3-phenylpropan-2-yl)-2-((5,)-2-(2-morpholinoacetamido)-4-phenylbutanamido)-pentanamide); marizomib (NPT0052); ixazomib citrate (MLN-9708); delanzomib (CEP-18770); and O-Methyl-N-[(2-methyl-5-thiazolyl) carbonyl]-L-seryl-O-methyl-N-[(IIS)-2-[(2R)-2-methyl-2-oxiranyl]-2-oxo-I-(phenylmethyl)ethyl]-L-serinamide (ONX-0912).
(123) One of skill in the art can readily identify a chemotherapeutic agent of use (e.g., see Physicians' Cancer Chemotherapy Drug Manual 2014, Edward Chu, Vincent T. DeVita Jr., Jones & Bartlett Learning; Principles of Cancer Therapy, Chapter 85 in Harrison's Principles of Internal Medicine, 18th edition; Therapeutic Targeting of Cancer Cells: Era of Molecularly Targeted Agents and Cancer Pharmacology, Chs. 28-29 in Abeloff's Clinical Oncology, 2013 Elsevier; and Fischer D S (ed): The Cancer Chemotherapy Handbook, 4th ed. St. Louis, Mosby-Year Book, 2003).
(124) In one example, the modified T cells described herein are administered to a subject in combination with a molecule that decreases the level and/or activity of a molecule targeting GITR and/or modulating GITR functions, a molecule that decreases the Treg cell population, an mTOR inhibitor, a GITR agonist, a kinase inhibitor, a non-receptor tyrosine kinase inhibitor, a CDK4 inhibitor, and/or a BTK inhibitor.
(125) Efficacy
(126) The efficacy of modified T cells (e.g., activated CAR T cells) in, e.g., the treatment of a condition described herein, or to induce a response as described herein (e.g., a reduction in cancer cells) can be determined by the skilled clinician. However, a treatment is considered effective treatment, as the term is used herein, if one or more of the signs or symptoms of a condition described herein is altered in a beneficial manner, other clinically accepted symptoms are improved, or even ameliorated, or a desired response is induced, e.g., by at least 10% following treatment according to the methods described herein. Efficacy can be assessed, for example, by measuring a marker, indicator, symptom, and/or the incidence of a condition treated according to the methods described herein or any other measurable parameter appropriate. Treatment according to the methods described herein can reduce levels of a marker or symptom of a condition, e.g., by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% or more.
(127) Efficacy can also be measured by a failure of an individual to worsen as assessed by hospitalization, or need for medical interventions (i.e., progression of the disease is halted). Methods of measuring these indicators are known to those of skill in the art and/or are described herein.
(128) Treatment includes any treatment of a disease in an individual or an animal (some non-limiting examples include a human or an animal) and includes: (1) inhibiting the disease, e.g., preventing a worsening of symptoms (e.g., pain or inflammation); or (2) relieving the severity of the disease, e.g., causing regression of symptoms. An effective amount for the treatment of a disease means that amount which, when administered to a subject in need thereof, is sufficient to result in effective treatment as that term is defined herein, for that disease. Efficacy of an agent can be determined by assessing physical indicators of a condition or desired response. It is well within the ability of one skilled in the art to monitor efficacy of administration and/or treatment by measuring any one of such parameters, or any combination of parameters. Efficacy of a given approach can be assessed in animal models of a condition described herein, for example, treatment of ALL. When using an experimental animal model, efficacy of treatment is evidenced when a statistically significant change in a marker is observed.
(129) All patents and other publications; including literature references, issued patents, published patent applications, and co-pending patent applications; cited throughout this application are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the technology described herein. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior technology or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.
(130) The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize. For example, while method steps or functions are presented in a given order, alternative embodiments may perform functions in a different order, or functions may be performed substantially concurrently. The teachings of the disclosure provided herein can be applied to other procedures or methods as appropriate. The various embodiments described herein can be combined to provide further embodiments. Aspects of the disclosure can be modified, if necessary, to employ the compositions, functions and concepts of the above references and application to provide yet further embodiments of the disclosure. Moreover, due to biological functional equivalency considerations, some changes can be made in protein structure without affecting the biological or chemical action in kind or amount. These and other changes can be made to the disclosure in light of the detailed description. All such modifications are intended to be included within the scope of the appended claims.
(131) Specific elements of any of the foregoing embodiments can be combined or substituted for elements in other embodiments. Furthermore, while advantages associated with certain embodiments of the disclosure have been described in the context of these embodiments, other embodiments may also exhibit such advantages, and not all embodiments need necessarily exhibit such advantages to fall within the scope of the disclosure.
(132) The technology described herein is further illustrated by the following examples which in no way should be construed as being further limiting.
EXAMPLES
Example 1: Knock-Out of CD3 in Jurkat T Cells and Primary T Cells, and Transduction of CD3 Knock Out Cells with CARs
(133) To achieve gene knockout using CRISPR, guides were developed to target various coding sequences of CD3, with the goal of CRISPR-mediated gene disruption by generation of insertions and/or deletions in the target genomic sequences, leading to frameshift mutations in the absence of expression.
(134) CRISPR was used to knock out CD3 or T cell receptor alpha chain (TRAC) in Jurkat cells (
(135) A T7E1 disruption assay using S. pyogenes Cas9 (SpCas9) was carried out to screen for percent gene disruption obtained using various gRNAs directed against CD3(
(136) Jurkat cells knocked out for CD3 by CRISPR using gRNA (2) were enriched by CD3e negative selection using magnetic beads (
(137) Parental, unmodified Jurkat cells, as well as cells knocked out for CD3 using gRNA (2) and enriched for by negative selection for CD3e, were subjected to single cell sorting (
(138) Single cell clones (n=24) were expanded post sort and assessed for CD3 and CD3e staining (
(139) Parental, unmodified cells and cells knocked out for CD3 using CRISPR, as described above, were transduced with a vector encoding a various CAR directed against CD19 utilizing multiple intracellular signaling domains. Following transduction cells were analyzed for T cell receptor expression by means of CD3e in combination with various CAR constructs (
(140) CD19 CAR transduced T cells were stimulated overnight with either plate bound OKT3 (anti-CD3) or Nalm6 (2:1) (
Example 2: Modification of CD3 Knock Out T Cells to Reduce Rejection
(141) Lentiviral vectors were constructed for use in transducing T cells (
(142) Ninja (pMGH82) is a construct expressing modified anti-human CD19_BBz chimeric antigen receptor, as well as CMV UL40 CMV viral protein and signal peptide. The signal peptide is loaded onto non-classical HLA-E which, when expressed, will help inhibit NK cell killing. CMV US6 and UL18 are also included, as well as mCherry, which is included as a reporter gene for transgene expression. Viral 2A elements (T2A, P2A, and E2A) are included to direct cleavage of the encoded polyprotein, as noted above.
(143) Jurkat and primary human T cells were transduced with virus encoded by the Ninja vector (
(144)
Example 3: Knock-Out of T Cell Receptor Alpha Chain (TRAC)
(145) TRAC was targeted using methods similar to those described above with respect to CD3. The specific gRNA used for TRAC was AGAGTCTCTCAGCTGGTACA (SEQ ID NO: 17). As shown in
(146) Various aspects of the invention are described in the following numbered paragraphs. 1. An isolated T lymphocyte modified to have reduced or eliminated expression of the T Cell Receptor (TCR), due to reduced or eliminated expression of a CD3, T Cell Receptor Alpha Chain (TRAC), and/or T Cell Receptor Beta Chain (TRBC) gene. 2. The isolated T lymphocyte of paragraph 1, comprising a genome in which a CD3, TRAC, and/or TRBC gene, regulatory sequence, coding sequence, exon, or a portion thereof, is mutated, resulting in reduced, null, or non-functional CD3, CD3eta, CD3theta, TRAC, and/or TRBC expression. 3. The isolated T lymphocyte of paragraph 2, wherein the mutation is a deletion. The mutation can optionally be a frame shift mutation or deletion. 4. The isolated T lymphocyte of paragraph 2 or 3, wherein the mutation disrupts assembly of the T cell receptor or CD3 signaling. 5. The isolated T lymphocyte of any one of paragraphs 1-4, comprising a genome in which a CD3, TRAC, and/or TRBC gene is deleted. 6. The isolated T lymphocyte of paragraph 5, comprising a genome in which two alleles of a CD3, TRAC, and/or TRBC gene are deleted. 7. The isolated T lymphocyte of any one of paragraphs 1-6, wherein the reduced expression of the CD3, TRAC, and/or TRBC gene is null expression. 8. The isolated T lymphocyte of any one of paragraphs 1-7, having reduced expression of CD3 eta or CD3 theta. 9. The isolated T lymphocyte of any one of paragraphs 1-8, wherein an HLA locus, or a portion thereof, is deleted. 10. The isolated T lymphocyte of paragraph 9, wherein the HLA locus is on chromosome 6. 11. The isolated T lymphocyte of any one of paragraphs 1-10, further having decreased HLA Class I expression. 12. The isolated T lymphocyte of any one of paragraphs 1-11, wherein the isolated T lymphocyte is further modified to express HLA-G. 13. The isolated T lymphocyte of any one of paragraphs 1-12, further comprising a gene encoding a heterologous protein that facilitates the T lymphocyte in evading immune attack from a host to whom the T lymphocyte is administered. 14. The isolated T lymphocyte of paragraph 13, wherein the heterologous protein facilitates evasion of T cell or NK mediated rejection. 15. The isolated T lymphocyte of paragraph 13 or 14, wherein the heterologous protein is a viral protein. 16. The isolated T lymphocyte of paragraph 15, wherein the viral protein is from a virus selected from the group consisting of cytomegalovirus (CMV), Epstein Barr virus (EBV), herpes simplex virus (HSV), and bovine herpes virus-1 (BoHV-1). 17. The isolated T lymphocyte of paragraph 16, wherein the viral protein is from CMV and is selected from the group consisting of US6, UL40, and UL18. 18. The isolated T lymphocyte of paragraph 16, wherein the viral protein inhibits transporter associated with antigen processing (TAP). 19. The isolated T lymphocyte of paragraph 18, wherein the viral protein is selected from the group consisting of CMV US6, HSV ICP47, BoHV-1 UL49.5, and EBV BNLF2a. 20. The isolated T lymphocyte of any one of paragraphs 1-19, further comprising a gene encoding a reporter gene. 21. The isolated T lymphocyte of paragraph 20, wherein the reporter gene comprises a truncated epidermal growth factor receptor (EGFR) gene, truncated prostate-specific membrane antigen (PSMA), truncated low affinity nerve growth factor receptor (LNGFR). truncated CD19. 22. The isolated T lymphocyte of any one of paragraphs 1-21, further comprising a gene encoding a therapeutic protein. 23. The isolated T lymphocyte of paragraph 22, wherein the therapeutic protein comprises an antigen receptor. 24. The isolated T lymphocyte of paragraph 23, wherein the antigen receptor confers specificity to a select target antigen. 25. The isolated T lymphocyte of paragraph 23, wherein the antigen receptor confers specificity to a select ligand. 26. The isolated T lymphocyte of paragraph 23, wherein the antigen receptor is a chimeric antigen receptor (CAR). 27. The isolated T lymphocyte of paragraph 26, wherein the CAR comprises an extracellular domain, a transmembrane region domain, and an intracellular region domain. 28. The isolated T lymphocyte of paragraph 27, wherein the extracellular domain comprises a single chain antibody and the intracellular domain comprises a T cell activating domain. 29. The isolated T lymphocyte of any one of paragraphs 1-28, further comprising a gene that induces cell death. 30. The isolated T lymphocyte of paragraph 29, wherein the gene is an activatable suicide gene. 31. The isolated T lymphocyte of paragraph 30, wherein the suicide gene is activated by a drug. 32. The isolated T lymphocyte of paragraph 31, wherein the suicide gene expresses an FK506 binding domain fused to a caspase9 pro-apoptotic molecule. 33. A method for producing a modified T lymphocyte, the method comprising inactivating a CD3, TRAC, and/or TRBC gene in a T lymphocyte. 34. The method of paragraph 33, wherein the inactivation of the CD3, TRAC, and/or TRBC gene is carried out using a nuclease or system selected from the group of zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), and the clustered regularly interspaced short palindromic repeats (CRISPR/cas9 system). 35. The method of paragraph 33 or 34, wherein the modified T lymphocyte is a modified T lymphocyte of any one of paragraphs 1-32. 36. A method of treating a subject for a disease, the method comprising administering to the subject an isolated T lymphocyte of any one of paragraphs 1-32. 37. The method of paragraph 36, wherein the disease is selected from the group consisting of cancer, an infectious disease, and an indication resulting from a transplantation procedure. 38. A method of reducing an immunogenic reaction in a subject, the method comprising administering to a subject a T lymphocyte according to any one of paragraphs 1-32. 39. The method of paragraph 38, wherein the T lymphocyte expresses a transgene. 40. The method of paragraph 38, wherein the T lymphocyte has reduced competition with endogenous T cell receptor signaling molecules. 41. The method of any one of paragraphs 36-40, wherein the T lymphocyte is autologous with respect to the subject. 42. The method of any one of paragraphs 36-40, wherein the T lymphocyte is allogeneic with respect to the subject. 43. The method of any one of paragraphs 36-42, wherein the modified T lymphocytes are expanded in vivo. 44. The method of any one of paragraphs 36-43, wherein the modified T lymphocytes are expanded in the subject's blood. 45. The method of any one of paragraphs 36-44, wherein the modified T lymphocytes are expanded in vitro, prior to administration. 46. A vector comprising a gene encoding a therapeutic protein and a heterologous protein that facilitates immune system evasion. 47. The vector of paragraph 46, wherein the heterologous protein is a viral protein. 48. The vector of paragraph 47, wherein the viral protein is from a virus selected from the group consisting of cytomegalovirus (CMV), Epstein Barr virus (EBV), herpes simplex virus (HSV), and bovine herpes virus-1 (BoHV-1). 49. The vector of paragraph 48, wherein the viral protein is from CMV and is selected from the group consisting of US6, UL40, and UL18. 50. The vector of paragraph 48, wherein the viral protein inhibits transporter associated with antigen processing (TAP). 51. The vector of paragraph 50, wherein the viral protein is selected from the group consisting of CMV US6, HSV ICP47, BoHV-1 UL49.5, and EBV BNLF2a. 52. The vector of any one of paragraphs paragraph 46-51, wherein the therapeutic protein is a CAR. 53. A method of transducing T lymphocytes with one or more of the vectors of paragraphs 46-52. 54. A modified T lymphocyte or cell line made according to the method of any one of paragraphs 33-35 or 53, or a subculture thereof. 55. A pharmaceutical composition comprising at least one modified T lymphocyte of any one of paragraphs 1-32. 56. A method of treating a subject comprising the steps of (a) preparing a population of modified T lymphocytes according to the method of any one of paragraphs 33-35 or 53, and (b) administering the modified T lymphocytes to the subject. 57. The method of paragraph 56, wherein the T lymphocytes originate from the subject to be treated. 58. The method of paragraph 56, wherein the T lymphocytes originate from a healthy donor.