Chimeric Antigen Receptors Targeting HER2

20250333471 ยท 2025-10-30

    Inventors

    Cpc classification

    International classification

    Abstract

    Chimeric transmembrane immunoreceptors (CAR) which include an extracellular domain targeted to HER2, a transmembrane region, a costimulatory domain and an intracellular signaling domain are described.

    Claims

    1. A nucleic acid molecule encoding a chimeric antigen receptor, wherein the chimeric antigen receptor comprises: a HER2 targeting sequence; a transmembrane domain selected from: a CD4 transmembrane domain or variant thereof having 1-5 amino acid modifications, a CD8 transmembrane domain or variant thereof having 1-5 amino acid modifications, a CD28 transmembrane domain or a variant thereof having 1-5 amino acid modifications, and a CD3 transmembrane domain or a variant thereof having 1-5 amino acid modifications; a costimulatory domain selected from a CD28 costimulatory domain or a variant thereof having 1-5 amino acid modifications and a 4-IBB costimulatory domain or a variant thereof having 1-5 amino acid modifications; and CD3 signaling domain of a variant thereof having 1-5 amino acid modifications.

    2. The nucleic acid molecule of claim 1 wherein the HER2 targeting domain is a HER2 scFv.

    3. The nucleic acid molecule of claim 1 wherein the HER2 scFv comprising the amino acid sequence: DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKGSTSGGGSGGGSG GGGSSEVOL VESGGGL VQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYP TNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDY WGQGTLVTVSS or a variant thereof having 1 to 5 amino acid modifications.

    4. (canceled)

    5. The nucleic acid molecule of claim 1 comprising a spacer region located between the HER2 targeting domain and the transmembrane domain.

    6. (canceled)

    7. The nucleic acid molecule of claim 5 wherein the spacer region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 2-12 or a variant thereof having 1-5 amino acid modifications.

    8. (canceled)

    9. (canceled)

    10. The nucleic acid molecule of claim 1 wherein the costimulatory domain is a 4-1 BB costimulatory domain comprising the amino acid sequence of SEQ ID NO:24 or a variant thereof having 1-5 amino acid modifications.

    11. (canceled)

    12. The nucleic acid molecule of claim 1 wherein a linker of 3 to 15 amino acids is located between the costimulatory domain or the variant thereof and the CD3 signaling domain or variant thereof.

    13. The nucleic acid molecule of claim 1 wherein the nucleic acid molecule expresses a polypeptide comprising an amino acid sequence selected from SEQ ID NO: 26 and 27 or a variant thereof having 1-5 amino acid modifications.

    14. The nucleic acid molecule of claim 1 wherein the chimeric antigen receptor comprises a 4-1 BB costimulatory domain and a spacer region comprising the amino acid sequence of any of SEQ ID NOs: 2-12 or a variant thereof having 1-5 amino acid modifications.

    15. The nucleic acid molecule of claim 1 wherein the chimeric antigen receptor comprises the amino acid sequence selected from SEQ ID NOs: 26 and 27.

    16. (canceled)

    17. (canceled)

    18. A population of human T cells transduced by a vector comprising the nucleic acid molecule of claim 1.

    19. (canceled)

    20. (canceled)

    21. A method of treating a HER2 expressing brain cancer in a patient comprising administering a population of autologous or allogeneic human T cells transduced by a vector comprising an expression cassette encoding a chimeric antigen receptor, wherein chimeric antigen receptor comprises an amino acid sequence selected from SEQ ID NOs: 26 and 27 or a variant thereof having 1-5 amino acid modifications.

    22. The method of claim 21 wherein the population of human T cells comprise CD62L+ memory T cells.

    23. The method claim 21 wherein the cancer is a breast to brain metastasis.

    24. The method of claim 21 wherein the transduced human T cells where prepared by a method comprising obtaining T cells from the patient, treating the T cells to isolate central memory T cells, and transducing at least a portion of the central memory cells to with a viral vector comprising an expression cassette encoding a chimeric antigen receptor, wherein chimeric antigen receptor comprises an amino acid sequence selected from SEQ ID NOs: 26 and 27 or a variant thereof having 1-5 amino acid modifications.

    25. The method of claim 21 wherein the T cells are administered intratumorally.

    26. The method of claim 21 wherein the T cells are administered intraventricularly.

    27. The method of claim 21 wherein the T cells are administered intraventricularly adjacent to a tumor.

    28. (canceled)

    29. A T cell expressing a polypeptide comprising an amino acid sequence that is identical to an amino acid sequence selected from SEQ ID NOs: 26 and 27 or a variant thereof having 1-5 amino acid modifications.

    30. The nucleic acid molecule of claim 1 wherein the nucleic acid molecule encodes a polypeptide comprising the amino acid sequence of any of SEQ ID NOs: 26-41.

    31. (canceled)

    32. (canceled)

    Description

    DESCRIPTION OF DRAWINGS

    [0027] FIG. 1 depicts the amino acid sequence of Her2scFv-IgG4(S228P,L235E,N297Q)-CD28tm-CD28gg-Zeta-T2A-CD19t (SEQ ID NO: 26). The various domains are listed in order below the sequence and are indicated by alternating underlining and non-underlining. The mature CAR sequence (SEQ ID NO: 34) does not include the GMCSFRa signal peptide, the T2A skip sequence or truncated CD 19. Also called HER2(EQ)28 in FIGS. 3A-8E and throughout the specification.

    [0028] FIG. 2 depicts the amino acid sequence of Her2scFv-IgG4(S228P,L235E,N297Q)-CD8tm-41BB-Zeta-T2A-CD 19t (SEQ ID NO:27). The various domains are listed in order below the sequence and are indicated by alternating underlining and non-underlining. The mature CAR sequence (SEQ ID NO: 35) does not include the GMCSFRa signal peptide, the T2A skip sequence or truncated CD 19. Also called HER2(EQ)BB in FIGS. 3A-8E and throughout the specification.

    [0029] FIGS. 3A-D depict HER2-specific CAR constructs and CAR T cell expansion data.

    [0030] FIGS. 4A-D depict in vitro characterization of HER2-CAR T cells against breast cancer cell lines.

    [0031] FIGS. 5A-5F depict the result of studies on the in vitro tumor activity of HER2-CAR T cells.

    [0032] FIGS. 6A-6I depict the result of studies on the in vivo anti-tumor efficacy of local intratumorally-delivered HER2-CAR T cells.

    [0033] FIGS. 7A-7D depict the results of studies on local delivery of HER2-CAR T cells in human orthotopic BBM xenograft models.

    [0034] FIGS. 8A-8E depict the results of studies on intraventrical delivery of HER2-CAR T cells.

    [0035] FIG. 9 depicts the amino acid sequence of Her2scFv-CD8hinge-CD8tm-41BB-Zeta-T2A-CD19t (SEQ ID NO: 28). The various domains are listed in order below the sequence and are indicated by alternating underlining and non-underlining. The mature CAR sequence (SEQ ID NO: 36) does not include the GMCSFRa signal peptide, the T2A skip sequence or truncated CD 19.

    [0036] FIG. 10 depicts the amino acid sequence of Her2scFv-IgG4hinge(S228P)-linker-CD8tm-41BB-Zeta-T2A-CD19t. (SEQ ID NO:29) The various domains are listed in order below the sequence and are indicated by alternating underlining and non-underlining. The mature CAR sequence (SEQ ID NO: 37) does not include the GMCSFRa signal peptide, the T2A skip sequence or truncated CD 19.

    [0037] FIG. 11 depicts the amino acid sequence of Her2scFv-IgG4(S228P)-Linker-IgG4 CH3-CD8tm-41BB-Zeta-T2A-CD19t (SEQ ID NO: 30). The various domains are listed in order below the sequence and are indicated by alternating underlining and non-underlining. The mature CAR sequence (SEQ ID NO: 38) does not include the GMCSFRa signal peptide, the T2A skip sequence or truncated CD19.

    [0038] FIG. 12 depicts the amino acid sequence of Her2scFv-IgG4(S228P)-Linker-IgG4 CH3-CD28tm-CD28gg-Zeta-T2A-CD19t (SEQ ID NO: 31). The various domains are listed in order below the sequence and are indicated by alternating underlining and non-underlining. The mature CAR sequence (SEQ ID NO: 39) does not include the GMCSFRa signal peptide, the T2A skip sequence or truncated CD19.

    [0039] FIG. 13 depicts the amino acid sequence of Her2scFv-Linker-CD28tm-CD28gg-Zeta-T2A-CD19t (SEQ ID NO: 32). The various domains are listed in order below the sequence and are indicated by alternating underlining and non-underlining. The mature CAR sequence (SEQ ID NO: 40) does not include the GMCSFRa signal peptide, the T2A skip sequence or truncated CD19.

    [0040] FIG. 14 depicts the amino acid sequence of Her2scFv-Linker-CD8tm-41BB-Zeta-T2A-CD19t. (SEQ ID NO: 33). The various domains are listed in order below the sequence and are indicated by alternating underlining and non-underlining. The mature CAR sequence (SEQ ID NO: 41) does not include the GMCSFRa signal peptide, the T2A skip sequence or truncated CD19.

    [0041] FIGS. 15A-15C depict the results of studies characterizing certain additional CAR with various spacers. The IgG3(EQ) is in FIG. 2; DeltaCh2 is in FIG. 11; CD8h is in FIG. 9; HL is in FIG. 10; and L is in FIG. 14.

    [0042] FIGS. 16A-16C show the results of studies examining CD107a and INF gamma produced when TCM expressing the various CAR are exposed to cells not expressing HER2 (MDA-MB-468), low HER2 (231BR), low HER2 (231BRHER2LO) or high HER2 (231BRHER2HI).

    [0043] FIGS. 17A-17D show the results of studies examining PD-1 production and tumor cell killing ins various cell lines with the CAR of FIG. 2 (HER2(EQ)BB or FIG. 14 (HER2(L)BB).

    [0044] FIGS. 18A-18B show the results of studies examining CD107a and INF gamma produced when TCM expressing the various CAR are exposed to cells not expressing HER2 (MDA-MB-468), low HER2 (231BR), low HER2 (231BRHER2LO) or high HER2 (231BRHER2HI).

    DETAILED DESCRIPTION

    [0045] Described below is the structure, construction and characterization of various chimeric antigen receptors targeting HER2 and useful in treating HER2-expressing breast cancer as well as breast to brain metastasis. Importantly, the CAR described herein can be used in ACT to treat HER2 expressing tumors in the brain by intraventricular or intratumoral delivery.

    [0046] A chimeric antigen (CAR) is a recombinant biomolecule that contains, at a minimum, an extracellular recognition domain, a transmembrane region, and an intracellular signaling domain. The term antigen, therefore, is not limited to molecules that bind antibodies, but to any molecule that can bind specifically to a target. For example, a CAR can include a ligand that specifically binds a cell surface receptor. The extracellular recognition domain (also referred to as the extracellular domain or simply by the recognition element which it contains) comprises a recognition element that specifically binds to a molecule present on the cell surface of a target cell. The transmembrane region anchors the CAR in the membrane. The intracellular signaling domain comprises the signaling domain from the zeta chain of the human CD3 complex and optionally comprises one or more costimulatory signaling domains. CARs can both to bind antigen and transduce T cell activation, independent of MHC restriction. Thus, CARs are universal immunoreceptors which can treat a population of patients with antigen-positive tumors irrespective of their HLA genotype. Adoptive immunotherapy using T lymphocytes that express a tumor-specific CAR can be a powerful therapeutic strategy for the treatment of cancer.

    [0047] In some cases the CAR described herein can be produced using a vector in which the CAR open reading frame is followed by a T2A ribosome skip sequence and a truncated CD19 (CD19t), which lacks the cytoplasmic signaling tail (truncated at amino acid 323). In this arrangement, co-expression of CD19t provides an inert, non-immunogenic surface marker that allows for accurate measurement of gene modified cells, and enables positive selection of gene-modified cells, as well as efficient cell tracking and/or imaging of the therapeutic T cells in vivo following adoptive transfer. Co-expression of CD 19t provides a marker for immunological targeting of the transduced cells in vivo using clinically available antibodies and/or immunotoxin reagents to selectively delete the therapeutic cells, and thereby functioning as a suicide switch.

    [0048] The CAR described herein can be produced by any means known in the art, though preferably it is produced using recombinant DNA techniques. Nucleic acids encoding the several regions of the chimeric receptor can be prepared and assembled into a complete coding sequence by standard techniques of molecular cloning known in the art (genomic library screening, PCR, primer-assisted ligation, site-directed mutagenesis, etc.) as is convenient. The resulting coding region is preferably inserted into an expression vector and used to transform a suitable expression host cell line, preferably a T lymphocyte cell line, and most preferably an autologous T lymphocyte cell line.

    [0049] Various T cell subsets isolated from the patient, including unselected PBMC or enriched CD3 T cells or enriched CD3 or memory T cell subsets or T.sub.CM or T.sub.CM/SCM/N can be transduced with a vector for CAR expression. Central memory T cells are one useful T cell subset. Central memory T cell can be isolated from peripheral blood mononuclear cells (PBMC) by enriching for CD45RO+/CD62L+ cells, using, for example, the CliniMACS device to immunomagnetically select cells expressing the desired receptors. The cells enriched for central memory T cells can be activated with anti-CD3/CD28, transduced with, for example, a SIN lentiviral vector that directs the expression of the CAR as well as a truncated human CD19 (CD19t), a non-immunogenic surface marker for both in vivo detection and potential ex vivo selection. The activated/genetically modified central memory T cells can be expanded in vitro with IL-2/IL-15 and then cryopreserved.

    Example 1: Structure of Two HER2-CAR

    [0050] One CAR comprising a HER2 scFv described herein is referred to as Her2scFv-IgG4(L235E, N297Q)-CD28tm-CD28gg-Zeta-T2A-CD19t. This CAR includes a variety of important features including: a scFv targeted to HER2; an IgG4 Fe region that is mutated at two sites within the CH2 region (L235E; N297Q) in a manner that reduces binding by Fe receptors (FcRs); a CD28 transmembrane domain, a CD28 co-stimulatory domain, and CD3 activation domain. FIG. 1 presents the amino acid sequence of this CAR, including the sequence of the truncated CDI9 sequence used for monitoring CAR expression and the T2A ribosomal skip sequence that allows the CAR to be produced without fusion of the truncated CDI9 sequence. As shown in FIG. 2, the immature CAR includes: GMCSFR signal peptide, HER2 scFv, IgG4 that acts as a spacer, a CD8 transmembrane domain, a 4-IBB co-stimulatory domain that includes a LL to GG sequence alteration, a three Gly sequence, CD3 Zeta stimulatory domain. The transcript also encodes a T2A ribosomal sequence and a truncated CDI9 sequence that are not part of the CAR protein sequence. The mature CAR is identical to the immature CAR, but lacks the GMCSF signal peptide.

    Example 2: Construction and Structure of epHIV7 Used for Expression of HER2-Specific CAR T Cells

    [0051] The epHIV7 vector is a vector that can used for expression of the HER2-specific CAR. Is was produced from pHIV7 vector. Importantly, this vector uses the human EFI promoter to drive expression of the CAR. Both the 5 and 3 sequences of the vector were derived from pv653RSN as previously derived from the HXBc2 provirus. The polypurine tract DNA flap sequences (cPPT) were derived from HIV-I strain pNL4-3 from the NIH AIDS Reagent Repository. The woodchuck post-transcriptional regulatory element (WPRE) sequence was previously described.

    [0052] Construction of pHIV7 was carried out as follows. Briefly, pv653RSN, containing 653 bp from gag-pol plus 5 and 3 long-terminal repeats (LTRs) with an intervening SL3-neomycin phosphotransferase gene (Neo), was subcloned into pBluescript, as follows: In Step I, the sequences from 5 LTR to rev-responsive element (RRE) made p5 HIV-I 5I, and then the 5 LTR was modified by removing sequences upstream of the TATA box, and ligated first to a CMV enhancer and then to the SV40 origin of replication (p5HIV-2). In Step 2, after cloning the 3 LTR into pBluescript to make p3HIV-1, a 400-bp deletion in the 3 LTR enhancer/promoter was made to remove cis-regulatory elements in HIV U3 and form p3HIV-2. In Step 3, fragments isolated from the p5HIV-3 and p3HIV-2 were ligated to make pHIV-3. In Step 4, the p3HIV-2 was further modified by removing extra upstream HIV sequences to generate p3HIV-3 and a 600-bp BamHI-SalI fragment containing WPRE was added to p3HIV-3 to make the p3HIV-4. In Step 5, the pHIV-3 RRE was reduced in size by PCR and ligated to a 5 fragment from pHIV-3 (not shown) and to the p3HIV-4, to make pHIV-6. In Step 6, a 190-bp BglII-BamHI fragment containing the cPPT DNA flap sequence from HIV-I pNL4-3 (55) was amplified from pNL4-3 and placed between the RRE and the WPRE sequences in pHIV 6 to make pHIV-7. This parent plasmid pHIV7-GFP (GFP, green fluorescent protein) was used to package the parent vector using a four-plasmid system.

    [0053] A packaging signal, psi (), is required for efficient packaging of viral genome into the vector. The RRE and WPRE enhance the RNA transcript transport and expression of the transgene. The flap sequence, in combination with WPRE, has been demonstrated to enhance the transduction efficiency of lentiviral vector in mammalian cells.

    [0054] The helper functions, required for production of the viral vector), are divided into three separate plasmids to reduce the probability of generation of replication competent lentivirus via recombination: 1) pCgp encodes the gag/pol protein required for viral vector assembly; 2) pCMV-Rev2 encodes the Rev protein, which acts on the RRE sequence to assist in the transportation of the viral genome for efficient packaging; and 3) pCMV-G encodes the glycoprotein of the vesiculo-stomatitis virus (VSV), which is required for infectivity of the viral vector.

    [0055] There is minimal DNA sequence homology between the pHIV7 encoded vector genome and the helper plasmids. The regions of homology include a packaging signal region of approximately 600 nucleotides, located in the gag/pol sequence of the pCgp helper plasmid; a CMV promoter sequence in all three helper plasmids; and a RRE sequence in the helper plasmid pCgp. Itis highly improbable that replication competent recombinant virus could be generated due to the homology in these regions, as it would require multiple recombination events. Additionally, any resulting recombinants would be missing the functional LTR and tat sequences required for lentiviral replication.

    [0056] The CMV promoter was replaced by the EFl-HTLV promoter (EFIp), and the new plasmid was named epHIV7. The EFlp has 563 bp and was introduced into epHIV7 using NruI and NheI, after the CMV promoter was excised.

    [0057] The lentiviral genome, excluding gag/pol and rev that are necessary for the pathogenicity of the wild-type virus and are required for productive infection of target cells, has been removed from this system. In addition, the vector construct does not contain an intact 3LTR promoter, so the resulting expressed and reverse transcribed DNA proviral genome in targeted cells will have inactive LTRs. As a result of this design, no HIV-I derived sequences will be transcribed from the provirus and only the therapeutic sequences will be expressed from their respective promoters. The removal of the LTR promoter activity in the SIN vector is expected to significantly reduce the possibility of unintentional activation of host genes.

    Example 3: Production of Vectors for Transduction of Patient T Cells

    [0058] Vectors for transduction of patient T cells can be prepared as follows. For each plasmid the plasmid expressing the CAR and, optionally, a marker such as truncated CD19; 2) pCgp; 3) pCMV-G; and 4) pCMV-Rev2), a seed bank is generated, which is used to inoculate the fermenter to produce sufficient quantities of plasmid DNA. The plasmid DNA is tested for identity, sterility and endotoxin prior to its use in producing lentiviral vector.

    [0059] Briefly, cells are expanded from the 293T working cell (WCB), which has been tested to confirm sterility and the absence of viral contamination. A vial of 293T cells from the 293T WCB is thawed. Cells are grown and expanded until sufficient numbers of cells exists to plate an appropriate number of 10 layer cell factories (CFs) for vector production and cell train maintenance. A single train of cells can be used for production.

    [0060] The lentiviral vector is produced in sub-batches of up to 10 CFs. Two sub-batches can be produced in the same week leading to the production of approximately 20 L of lentiviral supernatant/week. The material produced from all sub-batches is pooled during the downstream processing phase, in order to produce one lot of product. 293T cells are plated in CFs in 293T medium (DMEM with 10% FBS). Factories are placed in a 37 C. incubator and horizontally leveled in order to get an even distribution of the cells on all the layers of the CF. Two days later, cells are transfected with the four lentiviral plasmids described above using the CaPQ4 method, which involves a mixture of Tris:EDTA, 2M CaCh, 2HBS, and the four DNA plasmids. Day 3 after transfection, the supernatant containing secreted lentiviral vectors is collected, purified and concentrated. After the supernatant is removed from the CFs, End-of-Production Cells are collected from each CF. Cells are trypsinized from each factory and collected by centrifugation. Cells are resuspended in freezing medium and cryopreserved. These cells are later used for replication-competent lentivirus (RCL) testing.

    [0061] To purify and formulate vectors crude, supernatant is clarified by membrane filtration to remove the cell debris. The host cell DNA and residual plasmid DNA are degraded by endonuclease digestion (Benzonase). The viral supernatant is clarified of cellular debris using a 0.45 m filter. The clarified supernatant is collected into a pre-weighed container into which the Benzonase is added (final concentration 50 U/mL). The endonuclease digestion for residual plasmid DNA and host genomic DNA is performed at 37 C. for 6 h. The initial tangential flow ultrafiltration (TFF) concentration of the endonuclease-treated supernatant is used to remove residual low molecular weight components from the crude supernatant, while concentrating the virus 20 fold. The clarified endonuclease-treated viral supernatant is circulated through a hollow fiber cartridge with a NMWCO of 500 kD at a flow rate designed to maintain the shear rate at 4,000 sec.sup.1 or less, while maximizing the flux rate. Diafiltration of the nuclease-treated supernatant is initiated during the concentration process to sustain the cartridge performance. An 80% permeate replacement rate is established, using 4% lactose in PBS as the diafiltration buffer. The viral supernatant is brought to the target volume, representing a 20-fold concentration of the crude supernatant, and the diafiltration is continued for 4 additional exchange volumes, with the permeate replacement rate at 100%.

    [0062] Further concentration of the viral product is accomplished by using a high speed centrifugation technique. Each sub-batch of the lentivirus is pelleted using a Sorvall RC-26 plus centrifuge at 6000 RPM (6,088 RCF) at 6 C. for 16-20 h. The viral pellet from each sub-batch is then reconstituted in a 50 mL volume with 4% lactose in PBS. The reconstituted pellet in this buffer represents the final formulation for the virus preparation. The entire vector concentration process results in a 200-fold volume reduction, approximately. Following the completion of all of the sub-batches, the material is then placed at 80 C., while samples from each sub-batch are tested for sterility. Following confirmation of sample sterility, the sub-batches are rapidly thawed at 37 C. with frequent agitation. The material is then pooled and manually aliquoted in the Class II Type A/B3 biosafety cabinet. A fill configuration of 1 mL of the concentrated lentivirus in sterile USP class 6, externally threaded 0-ring cryovials is used.

    [0063] To ensure the purity of the lentiviral vector preparation, it is tested for residual host DNA contaminants, and the transfer of residual host and plasmid DNA. Among other tests, vector identity is evaluated by RT-PCR to ensure that the correct vector is present.

    Example 4: Preparation of T Cells Suitable for Use in ACT

    [0064] If T.sub.CM are to be used to express the CAR, suitable patient cells can be prepared as follows. First, T lymphocytes are obtained from a patient by leukopheresis, and the appropriate allogenic or autologous T cell subset, for example, Central Memory T cells (T.sub.CM), are genetically altered to express the CAR, then administered back to the patient by any clinically acceptable means, to achieve anti-cancer therapy.

    [0065] Suitable TcM can be generated as follow. Apheresis products obtained from consented research participants are ficolled, washed and incubated overnight. Cells are then depleted of monocyte, regulatory T cell and nave T cell populations using GMP grade anti-CD14, anti-CD25 and anti-CD45RA reagents (Miltenyi Biotec) and the CliniMACS separation device. Following depletion, negative fraction cells are enriched for CD62L+ T.sub.CM cells using DREG56-biotin (COH clinical grade) and anti-biotin microbeads (Miltenyi Biotec) on the CliniMACS separation device.

    [0066] Following enrichment, TCM cells are formulated in complete X-Vivo15 plus 50 IU/mL IL-2 and 0.5 ng/ml IL-15 and transferred to a Teflon cell culture bag, where they are stimulated with Dynal ClinEx Vivo CD3/CD28 beads. Up to five days after stimulation, cells are transduced with lentiviral vector expressing the desired CAR at a multiplicity of infection (MOI) of 1.0 to 0.3. Cultures are maintained for up to 42 days with addition of complete X-Vivo15 and IL-2 and IL-15 cytokine as required for cell expansion (keeping cell density between 310.sup.5 and 210.sup.6 viable cells/mL, and cytokine supplementation every Monday, Wednesday and Friday of culture). Cells typically expand to approximately 10.sup.9 cells under these conditions within 21 days. At the end of the culture period cells are harvested, washed twice and formulated in clinical grade cryopreservation medium (Cryostore CS5, BioLife Solutions).

    [0067] On the day(s) of T cell infusion, the cryopreserved and released product is thawed, washed and formulated for re-infusion. The cryopreserved vials containing the released cell product are removed from liquid nitrogen storage, thawed, cooled and washed with a PBS/2% human serum albumin (HSA) Wash Buffer. After centrifugation, the supernatant is removed and the cells resuspended in a Preservative-Free Normal Saline (PFNS)/2% HSA infusion diluent. Samples are removed for quality control testing.

    Example 5: Expression of CAR Targeted to HER2

    [0068] FIG. 3A is a schematic diagram of two the HER2-specific CAR constructs depicted in FIG. 1 and FIG. 2. In HER2(EQ)28 the scFv is tethered to the membrane by a modified IgG4 Fc linker (double mutant, L235E; N297Q), containing a CD28 transmembrane domain, an intracellular CD28 co-stimulatory domain and a cytolytic CD3 domain. The T2A skip sequence separates the CAR from a truncated CD19 (CD19t) protein employed for cell tracking. HER2(EQ)BB is similar except that the costimulatory domain is 4-1BB rather than CD28 and the transmembrane domain is a CD8 transmembrane domain rather than a CD28 transmembrane domain. Human central memory (TCM) cells were transfected with a lentiviral vector expressing either HER2(EQ)28 or HER2(EQ)BB. FIG. 3B depicts representative FACS data of human TCM surface phenotype. FIG. 3C depicts the results of assays for CD 19 and Protein L expression in TCM transfected with a lentiviral vector expressing either HER2(EQ)28 or HER2(EQ)BB. As can be seen from these results, transfection efficiency as assessed by CD19 expression was similar for both CAR. However, Protein L expression was lower for HER2(EQ)BB than for HER2(EQ)28 suggesting that the HER2(EQ)BB CAR is less stable that the HER2(EQ)BB. Analysis of cell expansion (FIG. 3D) shows that neither CAR interferes with T cell expansion.

    Example 6: In Vitro Characterization of HER2-CAR T Cells Against Various Breast Cancer Cell Lines

    [0069] A variety of breast cancer cell lines, including, HER2-negative lines (LCL lymphoma, MDA-MB-468, U87 glioma), low-HER2 expressing lines (MDA-MB-361, 231BR) and high-HER2 expressing lines (SKBR3, BT474, BBM1) were used to characterize HER2(EQ)28 and HER2(EQ)BB. FIG. 4A depicts the HER2 expression level of each of these lines. Flow cytometry (gated on CAR+ T cells) was used to characterize CD107a degranulation and IFNy production in Mock (untransduced), HER2(EQ)28 or HER2(EQ)BB CAR T cells following a 5 hr co-culture with either MDA-MB-361 tumor cells (low HER2 expressing) or BBM1 tumor cells (high HER2 expressing). The results of this analysis are presented in FIG. 4B. Similar studies were conducted with the other breast cancer cells lines, and the results are summarized in FIG. 4C. Production of IFN production by HER2-CAR T cells following a 24 hr culture with recombinant HER2 protein or tumor targets was measured by ELISA and the results of this analysis are shown in FIG. 4D.

    Example 7: In Vitro Anti-Tumor Activity

    [0070] Flow cytometry was used to assess tumor cell killing following a 72 h co-culture of Mock (untransduced), HER2(EQ)28 or HER2(EQ)BB CAR T cells with tumor targets. The results of this analysis are presented in FIG. 5A. PD-1 and LAG-3 induction in total CAR T cells after a 72 h co-culture with HER2-negative MDA-MB-468 or HER2-positive BBM1 cells was measured, and the results of this analysis are presented in FIG. 5B. PD-1 induction in CD8+ CAR T cells following a 72 h co-culture with tumor targets that are HER2-negative (LCL lymphoma, MDA-MB-468, U87 glioma), low-HER2 expressing (MDA-MB-361, 231BR) or high-HER2 expressing (SKBR3, BT474, BBM 1) was measured, and the results of this analysis are presented in FIG. 5C. These studies suggest that HER2(EQ)BB causes lower PD-1 induction that does HER2(EQ)28. Tumor cell killing with Effector:Tumor (E:T) ratio ranging from 0.25:1 to 2:1 was measured for both HER2(EQ)28 or HER2(EQ)BB CAR T cells. The results of this analysis are presented in FIG. 5D, which shows that both HER2(EQ)28 and HER2(EQ)BB are effective in tumor cell killing in vitro. CFSE proliferation of HER2-CAR T cells following a 72 h co-culture with MDA-MB-468 or BBMI cells was measured by flow cytometry. The results of this analysis are presented in FIG. 5E, which shows that HER2(EQ)BB CAR T cells proliferate more than HER2(EQ)28 CAR T cells.

    Example 8: In Vivo Anti-Tumor Activity

    [0071] The activity of intratumorally delivered HER2 CAR T cells was assessed in a patient-derived breast-to-brain metastasis model. FIGS. 6A-6C are H&E staining of tumors. Mice were treating by injection directly into the tumor with Mock (untransduced) or HER2(EQ)BB CAR T cells. FIGS. 6D-6F depict the results of optical imaging of the tumors and FIGS. 6G-6I are Kaplan-Meier survival curves for mice treated locally with either at day 3, 8 or 14 post tumor injection. These studies show that HER2(EQ)BB CAR T cells have potent anti-tumor efficacy in vivo when injected directly into the tumor.

    [0072] To assess anti-tumor efficacy in human xenograft models of breast-to-brain metastasis, BBM1 cells (0.2M) or BT474 (0.15M) were intracranially injected in NSG mice. At day 8 post tumor injection, HER2(EQ)28 or HER2(EQ)BB, or Mock (untransduced) T cells (IM) were injected intratumorally. BBMI (FIG. 7A) and BT474 (FIG. 7B) tumors were monitored by luciferase-based optical imaging. Kaplan Meier curves are presented in FIG. 7C and FIG. 7D.

    [0073] A human patient-derived orthotopic xenograft model of breast-to-brain metastasis was also used to assess HER2(EQ)28 and HER2(EQ)BB CAR T cells. FIG. 8A illustrates the region of tumor implantation by stereotactic injection of BBM1 cells (0.2M), and intraventricular T cell delivery. Staining of tumors is depicted in FIG. 8B. At day 14 post tumor injection, HER2(EQ)28, HER2(EQ)BB, or Mock (untransduced) T cells (0.5M) were injected intratumorally. Tumor growth was monitored by luciferase-based optical imaging. FIG. 8C presents the flux averages for each treatment group, and FIG. 8D presents the Kaplan Meier survival curve for each treatment group.

    Example 9: Additional CAR Targeted to HER2

    [0074] FIGS. 9-14 depict the amino acid sequences of a various CAR having different linkers. Specifically, the CAR differ in the sequence and length of the portion between the HER2 targeted scFv and the transmembrane domain. The transmembrane domain is CD8, CD28 or CD28gg. The co-stimulatory domain is 4-1BB or CD28. All have a CD3 stimulatory domain. In each case a T2A skip sequence separates the CAR from a truncated CD19 (CD19t) protein employed for cell tracking.

    [0075] FIG. 15A schematically depicts various HER2 CAR that are identical except for the sequence and length of the portion between the HER2 scFv and the CD8 transmembrane domain. All include a 4-1BB co-stimulatory domain followed by a CD35 stimulatory domain. FIG. 15B depicts the results of assays for CD19 and Protein L expression in T.sub.CM transfected with a lentiviral vector expressing the indicated CAR. As can be seen from these results, transfection efficiency as assessed by CD19 expression was similar for both CAR. However, Protein L expression was lower for HER2(EQ)BB than for HER2(EQ)28 suggesting that the HER2(EQ)BB CAR is less stable that the HER2(EQ)BB. Analysis of cell expansion (FIG. 15C) shows that none of the CAR interfere with T cell expansion. FIGS. 16-18 show the results of additional studies showing that a CAR with a very short spacer (FIG. 14) is relatively selective for CAR expressing high levels of HER2. Such CAR may be useful in treating HER2 expressing cancers where it is desirable to spare cells expressing a lower level of HER2 than the cancerous cells.