Antibodies and chimeric antigen receptors specific for B-cell maturation antigen
11623961 · 2023-04-11
Assignee
Inventors
- Blythe D. Sather (Seattle, WA)
- Steven M. Shamah (Seattle, WA)
- Yan Chen (Seattle, WA)
- Rebecca Wu (Seattle, WA)
- Collin Hauskins (Seattle, WA)
- Csaba Pazmany (Seattle, WA)
- Jui Dutta-Simmons (Seattle, WA)
- Kimberly Harrington (Seattle, WA)
Cpc classification
C07K16/2875
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K14/535
CHEMISTRY; METALLURGY
A61P37/06
HUMAN NECESSITIES
C07K16/2878
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K14/535
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
Abstract
Provided herein are BCMA-binding molecules, including anti-BCMA antibodies and antigen-binding fragments thereof such as heavy chain variable (VH) regions and single-chain antibody fragments, and chimeric receptors comprising the anti-BCMA binding molecules such as chimeric antigen receptors (CARs). In some embodiments, the anti-BCMA antibodies or antigen-binding fragments thereof specifically bind to BCMA-1. Among the anti-BCMA antibodies are human antibodies, including those that compete for binding to BCMA with reference antibodies, such as a non-human reference antibody. Also provided are genetically engineered cells expressing the CARs or BCMA-binding molecules and uses thereof such as in adoptive cell therapy.
Claims
1. An anti-B cell maturation antigen (BCMA) antibody or an antigen-binding fragment thereof, comprising a heavy chain variable (V.sub.H) region and a light chain variable (V.sub.L) region, wherein: the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:2, 5, and 8, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:27, 38, and 48, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:2, 5, and 9, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:33, 43, and 55, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:3, 6, and 11, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:35, 45, and 57, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:140, 145, and 149, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:174, 179, and 184, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:141, 145, and 149, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:174, 179, and 185, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:141, 145, and 150, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:174, 179, and 186, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:142, 146, and 151, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:174, 179, and 187, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:2, 5, and 152, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:175, 180, and 188, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:143, 147, and 153, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:174, 179, and 189, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:144, 148, and 154, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:176, 181, and 190, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:3, 6, and 155, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:177, 182, and 191, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:2, 5, and 156, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:174, 179, and 192, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:2, 6, and 376, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:30, 399, and 415, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:3, 6, and 155, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:177, 182, and 191, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:3, 372, and 376, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:381, 401, and 417, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:3, 6, and 376, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:382, 402, and 418, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:3, 6, and 377, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:383, 403, and 419, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:2, 373, and 152, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:175, 180, and 188, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:3, 6, and 11, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:386, 404, and 420, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:2, 5, and 9, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:387, 405, and 422, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:2, 5, and 9, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:388, 406, and 423, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:2, 5, and 9, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:388, 407, and 424, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:3, 6, and 376, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:389, 408, and 425, respectively; the V.sub.H region comprises a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOS:2, 374, and 9, respectively, and the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOS:391, 409, and 426, respectively.
2. An anti-B cell maturation antigen (BCMA) antibody or an antigen-binding fragment thereof, comprising a heavy chain variable (V.sub.H) region and a light chain variable (V.sub.L) region, wherein: the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:111, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:117; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:112, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:124; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:114, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:126; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:247, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:257; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:248, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:258; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:249, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:259; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:250, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:260; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:251, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:261; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:252, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:262; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:253, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:263; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:254, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:264; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:255, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:265; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:518, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:534; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:520, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:264; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:521, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:537; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:522, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:538; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:523, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:539; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:525, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:261; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:526, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:542; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:528, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:544; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:529, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:545; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:528, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:546; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:522, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:547; the V.sub.H region comprises a CDR-H1, CDR-H2 and CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:530, and the V.sub.L region comprises a CDR-L1, CDR-L2 and CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:549.
3. The anti-BCMA antibody or antigen-binding fragment thereof of claim 1, wherein: the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:111 and 117, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:112 and 124, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:114 and 126, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:247 and 257, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:248 and 258, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:249 and 259, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:250 and 260, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:251 and 261, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:252 and 262, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:253 and 263, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:254 and 264, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:255 and 265, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:518 and 534, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:520 and 264, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:521 and 537, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:522 and 538, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:523 and 539, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:525 and 261, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:526 and 542, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:528 and 544, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:529 and 545, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:528 and 546, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:522 and 547, respectively; the V.sub.H region and the V.sub.L region comprise amino acid sequences having at least 90% sequence identity to SEQ ID NOS:530 and 549, respectively.
4. The anti-BCMA antibody or antigen-binding fragment thereof of claim 1, wherein: the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:111 and 117, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:112 and 124, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:114 and 126, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:115 and 127, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:247 and 257, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:248 and 258, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:249 and 259, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:250 and 260, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:251 and 261, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:252 and 262, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:253 and 263, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:254 and 264, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:255 and 265, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:518 and 534, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:520 and 264, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:521 and 537, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:522 and 538, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:523 and 539, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:525 and 261, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:526 and 542, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:528 and 544, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:529 and 545, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:528 and 546, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:522 and 547, respectively; the V.sub.H and V.sub.L regions comprise the amino acid sequences set forth in SEQ ID NOS:530 and 549, respectively.
5. The anti-BCMA antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment is recombinant.
6. The anti-BCMA antibody or antigen-binding fragment thereof of claim 1, that is an antigen-binding fragment.
7. The anti-BCMA antibody or antigen-binding fragment thereof of claim 6, wherein the fragment comprises an scFv.
8. The anti-BCMA antibody or antigen-binding fragment thereof of claim 7, wherein the scFv comprises an amino acid sequence selected from any one of SEQ ID NOS:129, 136, 138, 268-276, 558, 561-564, 567-568, 570-573 and 575, or an amino acid sequence having at least 90% sequence identity to an amino acid sequence selected from any one of SEQ ID NOS:129, 136, 138, 268-276, 558, 561-564, 567-568, 570-573 and 575.
9. The scFv of claim 7, wherein the V.sub.H region is amino-terminal to the V.sub.L region or the V.sub.H region is carboxy-terminal to the V.sub.L region.
10. The anti-BCMA antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof specifically binds to a B cell maturation antigen (BCMA) protein.
11. The anti-BCMA antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof is human.
12. A single chain cell surface protein comprising the anti-BCMA antibody or antigen-binding fragment thereof of claim 1.
13. A conjugate comprising the anti-BCMA antibody or antigen-binding fragment thereof of claim 1 and a heterologous molecule or moiety.
14. A chimeric antigen receptor (CAR) comprising an extracellular domain comprising the anti-BCMA antibody or antigen-binding fragment thereof of claim 1 and an intracellular signaling region.
15. The CAR of claim 14, wherein the antibody or antigen-binding fragment thereof comprises an scFv, and the intracellular signaling region comprises an intracellular signaling domain.
16. The CAR of claim 15, wherein the intracellular signaling domain comprises a primary signaling domain, a signaling domain that is capable of inducing a primary activation signal in a T cell, a signaling domain of a T cell receptor (TCR) component, and/or a signaling domain comprising an immunoreceptor tyrosine-based activation motif (ITAM).
17. The CAR of claim 15, wherein the intracellular signaling domain comprises an intracellular signaling domain of a CD3-zeta (CD3ζ) chain.
18. The CAR of claim 15, further comprising a transmembrane domain between the extracellular domain and the intracellular signaling region.
19. The CAR of claim 18, wherein the transmembrane domain comprises a transmembrane portion of CD28.
20. The CAR of claim 19, wherein the intracellular signaling region further comprises a costimulatory signaling domain.
21. The CAR of claim 20, wherein the costimulatory signaling domain comprises an intracellular signaling domain of a CD28, a 4-1BB or an ICOS.
22. The CAR of claim 20, wherein the costimulatory signaling domain comprises an intracellular signaling domain of a 4-1BB.
23. A polynucleotide encoding the anti-BCMA antibody or antigen-binding fragment thereof of claim 1.
24. A polynucleotide encoding the CAR of claim 14.
25. A polynucleotide encoding the single chain cell surface protein of claim 12.
26. A polynucleotide encoding the conjugate of claim 13.
27. A vector comprising the polynucleotide of 23.
28. A vector comprising the polynucleotide of 24.
29. An engineered cell comprising the CAR of claim 14.
30. An engineered cell comprising the polynucleotide of claim 24.
31. The engineered cell of claim 29, wherein the engineered cell is a T cell.
32. The engineered cell of claim 30, wherein the engineered cell is a T cell.
33. A composition comprising the engineered cell of claim 29.
34. A composition comprising the engineered cell of claim 31.
35. A composition comprising the engineered cell of claim 32.
Description
DETAILED DESCRIPTION
(1) Provided are BCMA-binding molecules, including antibodies (including antigen-binding antibody fragments, such as heavy chain variable (V.sub.H) regions and single chain fragments, including scFvs) and recombinant receptors, including chimeric receptors and single chain cell surface proteins containing such antibodies and antigen-binding fragments, nucleic acids encoding such antibodies and antigen-binding fragments and receptors, and cells, such as recombinant or engineered cells for expressing and production of these antibodies and antigen-binding fragments or receptors. Also provided are methods of making and using the antibodies and antigen-binding fragments as well as cells (e.g., engineered cells) expressing or containing the antibodies and antigen-binding fragments or receptors. Also provided are compositions, including pharmaceutical compositions, containing such antibodies, antigen-binding fragments, receptors or cells. In some aspects, the provided compositions, antibodies, antigen-binding fragments, receptors or cells can be used in connection with a therapy or a method of treatment.
(2) All publications, including patent documents, scientific articles and databases, referred to in this application are incorporated by reference in their entirety for all purposes to the same extent as if each individual publication were individually incorporated by reference. If a definition set forth herein is contrary to or otherwise inconsistent with a definition set forth in the patents, applications, published applications and other publications that are herein incorporated by reference, the definition set forth herein prevails over the definition that is incorporated herein by reference.
(3) The section heading used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.
I. BCMA-Binding Molecules
(4) Provided in some aspects are BCMA-binding molecules, such as BCMA-binding polypeptides. Such binding molecules include antibodies (including antigen-binding fragments) that specifically bind to BCMA proteins, such as a human BCMA protein. Also among the binding molecules are polypeptides containing such antibodies, including single chain cell surface proteins, e.g., recombinant receptors such as chimeric antigen receptors (CARs), containing such antibodies.
(5) A. BCMA Antibodies
(6) Provided are anti-BCMA antibodies, including functional antigen-binding fragments. In some embodiments, the antibodies or antigen-binding fragments include those that are single domain antibodies, containing a heavy chain variable (V.sub.H) region that, without pairing with a light chain antigen-binding site (e.g., light chain variable (V.sub.L) region) and/or without any additional antibody domain or binding site, are capable of specifically binding to BCMA. Also among the antibodies or antigen-binding fragments are multi-domain antibodies, such as those containing V.sub.H and V.sub.L domains, comprised of the V.sub.H domain or antigen-binding site thereof of the single-domain antibody. In some embodiments, the antibodies or antigen-binding fragments include a heavy chain variable region and a light chain variable region, such as scFvs. The antibodies include antibodies that specifically bind to BCMA, e.g., human BCMA. Among the provided anti-BCMA antibodies are human antibodies. The antibodies include isolated antibodies. Also provided are BCMA-binding molecules containing such antibodies, e.g., single-chain proteins, fusion proteins, and/or recombinant receptors such as chimeric receptors, including antigen receptors. The BCMA-binding molecules include isolated molecules.
(7) The term “antibody” herein is used in the broadest sense and includes polyclonal and monoclonal antibodies, including intact antibodies and functional (antigen-binding) antibody fragments, including fragment antigen binding (Fab) fragments, F(ab′).sub.2 fragments, Fab′ fragments, Fv fragments, recombinant IgG (rIgG) fragments, heavy chain variable (V.sub.H) regions capable of specifically binding the antigen, single chain antibody fragments, including single chain variable fragments (scFv), and single domain antibodies (e.g., sdAb, sdFv, nanobody) fragments. The term encompasses genetically engineered and/or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies, multispecific, e.g., bispecific or trispecific, antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFv, tandem tri-scFv. Unless otherwise stated, the term “antibody” should be understood to encompass functional antibody fragments thereof also referred to herein as “antigen-binding fragments.” The term also encompasses intact or full-length antibodies, including antibodies of any class or sub-class, including IgG and sub-classes thereof, IgM, IgE, IgA, and IgD.
(8) The terms “complementarity determining region,” and “CDR,” synonymous with “hypervariable region” or “HVR,” are known in the art to refer to non-contiguous sequences of amino acids within antibody variable regions, which confer antigen specificity and/or binding affinity. In general, there are three CDRs in each heavy chain variable region (CDR-H1, CDR-H2, CDR-H3) and three CDRs in each light chain variable region (CDR-L1, CDR-L2, CDR-L3). “Framework regions” and “FR” are known in the art to refer to the non-CDR portions of the variable regions of the heavy and light chains. In general, there are four FRs in each full-length heavy chain variable region (FR-H1, FR-H2, FR-H3, and FR-H4), and four FRs in each full-length light chain variable region (FR-L1, FR-L2, FR-L3, and FR-L4).
(9) The precise amino acid sequence boundaries of a given CDR or FR can be readily determined using any of a number of well-known schemes, including those described by Kabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (“Kabat” numbering scheme); Al-Lazikani et al., (1997) JMB 273, 927-948 (“Chothia” numbering scheme); MacCallum et al., J. Mol. Biol. 262:732-745 (1996), “Antibody-antigen interactions: Contact analysis and binding site topography,” J. Mol. Biol. 262, 732-745.” (“Contact” numbering scheme); Lefranc M P et al., “IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains,” Dev Comp Immunol, 2003 January; 27(1):55-77 (“IMGT” numbering scheme); Honegger A and Plückthun A, “Yet another numbering scheme for immunoglobulin variable domains: an automatic modeling and analysis tool,” J Mol Biol, 2001 Jun. 8; 309(3):657-70, (“Aho” numbering scheme); and Martin et al., “Modeling antibody hypervariable loops: a combined algorithm,” PNAS, 1989, 86(23):9268-9272, (“AbM” numbering scheme).
(10) The boundaries of a given CDR or FR may vary depending on the scheme used for identification. For example, the Kabat scheme is based on structural alignments, while the Chothia scheme is based on structural information. Numbering for both the Kabat and Chothia schemes is based upon the most common antibody region sequence lengths, with insertions accommodated by insertion letters, for example, “30a,” and deletions appearing in some antibodies. The two schemes place certain insertions and deletions (“indels”) at different positions, resulting in differential numbering. The Contact scheme is based on analysis of complex crystal structures and is similar in many respects to the Chothia numbering scheme. The AbM scheme is a compromise between Kabat and Chothia definitions based on that used by Oxford Molecular's AbM antibody modeling software.
(11) Table 1, below, lists exemplary position boundaries of CDR-L1, CDR-L2, CDR-L3 and CDR-H1, CDR-H2, CDR-H3 as identified by Kabat, Chothia, AbM, and Contact schemes, respectively. For CDR-H1, residue numbering is listed using both the Kabat and Chothia numbering schemes. FRs are located between CDRs, for example, with FR-L1 located before CDR-L1, FR-L2 located between CDR-L1 and CDR-L2, FR-L3 located between CDR-L2 and CDR-L3 and so forth. It is noted that because the shown Kabat numbering scheme places insertions at H35A and H35B, the end of the Chothia CDR-H1 loop when numbered using the shown Kabat numbering convention varies between H32 and H34, depending on the length of the loop.
(12) TABLE-US-00001 TABLE 1 Boundaries of CDRs according to various numbering schemes. CDR Kabat Chothia AbM Contact CDR-L1 L24--L34 L24--L34 L24--L34 L30--L36 CDR-L2 L50--L56 L50--L56 L50--L56 L46--L55 CDR-L3 L89--L97 L89-L97 L89--L97 L89--L96 CDR-H1 H31--H35B H26--H32 . . . 34 H26--H35B H30--H35B (Kabat Numbering.sup.1) CDR-H1 H31--H35 H26--H32 H26--H35 H30--H35 (Chothia Numbering.sup.2) CDR-H2 H50--H65 H52--H56 H50--H58 H47--H58 CDR-H3 H95--H102 H95--H102 H95--H102 H93--H101 .sup.1Kabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD .sup.2Al-Lazikani et al., (1997) JMB 273, 927-948
(13) Thus, unless otherwise specified, a “CDR” or “complementary determining region,” or individual specified CDRs (e.g., CDR-H1, CDR-H2, CDR-H3), of a given antibody or region thereof, such as a variable region thereof, should be understood to encompass a (or the specific) complementary determining region as defined by any of the aforementioned schemes, or other known schemes. For example, where it is stated that a particular CDR (e.g., a CDR-H3) contains the amino acid sequence of a corresponding CDR in a given V.sub.H or V.sub.L region amino acid sequence, it is understood that such a CDR has a sequence of the corresponding CDR (e.g., CDR-H3) within the variable region, as defined by any of the aforementioned schemes, or other known schemes. In some embodiments, specific CDR sequences are specified. Exemplary CDR sequences of provided antibodies are described using various numbering schemes (see e.g. Table 2, Table 3 and Table 4), although it is understood that a provided antibody can include CDRs as described according to any of the other aforementioned numbering schemes or other numbering schemes known to a skilled artisan.
(14) Likewise, unless otherwise specified, a FR or individual specified FR(s) (e.g., FR-H1, FR-H2, FR-H3, FR-H4), of a given antibody or region thereof, such as a variable region thereof, should be understood to encompass a (or the specific) framework region as defined by any of the known schemes. In some instances, the scheme for identification of a particular CDR, FR, or FRs or CDRs is specified, such as the CDR as defined by the Kabat, Chothia, AbM or Contact method, or other known schemes. In other cases, the particular amino acid sequence of a CDR or FR is given.
(15) The term “variable region” or “variable domain” refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen. The variable regions of the heavy chain and light chain (V.sub.H and V.sub.L, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three CDRs. (See, e.g., Kindt et al. Kuby Immunology, 6th ed., W. H. Freeman and Co., page 91 (2007). A single V.sub.H or V.sub.L domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind a particular antigen may be isolated using a V.sub.H or V.sub.L domain from an antibody that binds the antigen to screen a library of complementary V.sub.L or V.sub.H domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
(16) Among the provided antibodies are antibody fragments. An “antibody fragment” or “antigen-binding fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab′, Fab′-SH, F(ab′).sub.2; diabodies; linear antibodies; heavy chain variable (V.sub.H) regions, single-chain antibody molecules such as scFvs and single-domain antibodies comprising only the V.sub.H region; and multispecific antibodies formed from antibody fragments. In some embodiments, the antibody is or comprises an antibody fragment comprising a variable heavy chain (V.sub.H) and a variable light chain (V.sub.L) region. In particular embodiments, the antibodies are single-chain antibody fragments comprising a heavy chain variable (V.sub.H) region and/or a light chain variable (V.sub.L) region, such as scFvs.
(17) Single-domain antibodies (sdAbs) are antibody fragments comprising all or a portion of the heavy chain variable region or all or a portion of the light chain variable region of an antibody. In certain embodiments, a single-domain antibody is a human single-domain antibody.
(18) Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells. In some embodiments, the antibodies are recombinantly-produced fragments, such as fragments comprising arrangements that do not occur naturally, such as those with two or more antibody regions or chains joined by synthetic linkers, e.g., peptide linkers, and/or that are may not be produced by enzyme digestion of a naturally-occurring intact antibody. In some aspects, the antibody fragments are scFvs.
(19) A “humanized” antibody is an antibody in which all or substantially all CDR amino acid residues are derived from non-human CDRs and all or substantially all FR amino acid residues are derived from human FRs. A humanized antibody optionally may include at least a portion of an antibody constant region derived from a human antibody. A “humanized form” of a non-human antibody, refers to a variant of the non-human antibody that has undergone humanization, typically to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the CDR residues are derived), e.g., to restore or improve antibody specificity or affinity.
(20) Among the provided anti-BCMA antibodies are human antibodies. A “human antibody” is an antibody with an amino acid sequence corresponding to that of an antibody produced by a human or a human cell, or non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences, including human antibody libraries. The term excludes humanized forms of non-human antibodies comprising non-human antigen-binding regions, such as those in which all or substantially all CDRs are non-human. The term includes antigen-binding fragments of human antibodies.
(21) Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic animals, the endogenous immunoglobulin loci have generally been inactivated. Human antibodies also may be derived from human antibody libraries, including phage display and cell-free libraries, containing antibody-encoding sequences derived from a human repertoire.
(22) Among the provided antibodies are monoclonal antibodies, including monoclonal antibody fragments. The term “monoclonal antibody” as used herein refers to an antibody obtained from or within a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical, except for possible variants containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different epitopes, each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen. The term is not to be construed as requiring production of the antibody by any particular method. A monoclonal antibody may be made by a variety of techniques, including but not limited to generation from a hybridoma, recombinant DNA methods, phage-display and other antibody display methods.
(23) The terms “polypeptide” and “protein” are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length. Polypeptides, including the provided antibodies and antibody chains and other peptides, e.g., linkers and BCMA-binding peptides, may include amino acid residues including natural and/or non-natural amino acid residues. The terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, phosphorylation, and the like. In some aspects, the polypeptides may contain modifications with respect to a native or natural sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification.
(24) a. Exemplary Antibodies
(25) In some embodiments, the antibody, e.g., the anti-BCMA antibody or antigen-binding fragment thereof, contains a heavy and/or light chain variable (V.sub.H and/or V.sub.L) region sequence as described, or a sufficient antigen-binding portion thereof. In some embodiments, the anti-BCMA antibody or antigen-binding fragment thereof, contains a V.sub.H region sequence or sufficient antigen-binding portion thereof that contains a CDR-H1, CDR-H2 and/or CDR-H3 as described. In some embodiments, the anti-BCMA antibody or antigen-binding fragment thereof, contains a V.sub.L region sequence or sufficient antigen-binding portion that contains a CDR-L1, CDR-L2 and/or CDR-L3 as described. In some embodiments, the anti-BCMA antibody or antigen-binding fragment thereof, contains a V.sub.H region sequence that contains a CDR-H1, CDR-H2 and/or CDR-H3 as described and contains a V.sub.L region sequence that contains a CDR-L1, CDR-L2 and/or CDR-L3 as described. Also among the provided antibodies are those having sequences at least at or about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% identical to such a sequence.
(26) In some embodiments, the antibody, e.g., antigen-binding fragment thereof, has a heavy chain variable (V.sub.H) region having the amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533, or an amino acid sequence that has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the V.sub.H region amino acid selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533, or contains a CDR-H1, +CDR-H2, and/or CDR-H3 present in such a V.sub.H sequence.
(27) In some embodiments, the V.sub.H region of the anti-BCMA antibody is one that includes a heavy chain complementarity determining region 3 (CDR-H3) comprising the amino acid sequence X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13X.sub.14 (SEQ ID NO:355), wherein X.sub.1 is A, D, E, G, L, V or W; X.sub.2 is A, D, G, L, P, Q or S; X.sub.3 is A, D, G, L or Y; X.sub.4 is D, G, P, R, S, V, Y or null; X.sub.5 is D, I, P, S, T, Y or null; X.sub.6 is A, G, I, S, T, V, Y or null; X.sub.7 is A, D, E, F, L, P, S, Y or null; X.sub.8 is P, Q, T, Y or null; X.sub.9 is D, G, R, Y or null; X.sub.10 is A, F, Y or null; X.sub.11 is D, F or null; X.sub.12 is F or null; X.sub.13 is D, T or Y; and X.sub.14 is I, L, N, V or Y. In some such embodiments, in said CDR-H3, X.sub.1 is V; X.sub.2 is D; X.sub.3 is G; X.sub.4 is D; X.sub.5 is Y; X.sub.6 is V; X.sub.7 is D; X.sub.8 is null; X.sub.9 is null; X.sub.10 is null; X.sub.11 is null; X.sub.12 is null; X.sub.13 is D; and X.sub.14 is Y.
(28) In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a CDR-H3 comprising the amino acid sequence selected from any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378 according to Kabat numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H3 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378 according to Chothia numbering or AbM numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-H3 having the amino acid sequence of SEQ ID NO:9 according to Kabat numbering, Chothia numbering or AbM numbering. In any of such examples, the provided antibody or antigen-binding fragment thereof can contain a V.sub.H region sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533 in which the corresponding CDR-H3 sequence contained therein (e.g. corresponding to amino acid residues H95 to H102 by Kabat numbering) is replaced by the CDR-H3 sequence selected from any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378 according to Kabat numbering or any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378 according to Chothia numbering or AbM numbering.
(29) In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a CDR-H3 comprising the amino acid sequence selected from any one of SEQ ID NOs:7-10, 149, 153-157 and 376, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a CDR-H3 comprising the amino acid sequence selected from any one of SEQ ID NOs: 7, 9, 10 and 157, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a CDR-H3 comprising the amino acid sequence selected from any one of SEQ ID NOs: 10 and 157, according to Kabat numbering, Chothia numbering or AbM numbering.
(30) In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:112. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110, 112, 115, 256 and 519. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:115 and 256.
(31) In some embodiments, the V.sub.H region of the antibody or antigen-binding fragment thereof is one that includes a heavy chain complementarity determining region 1 (CDR-H1) comprising the amino acid sequence of X.sub.1X.sub.2X.sub.3MX.sub.4 (SEQ ID NO:353) X.sub.1 is D or S; X.sub.2 is Y or S; X.sub.3 is A, G, W, or Y; and X.sub.4 is H, Q, or S. In some embodiments, in said CDR-H1, X.sub.1 is D; X.sub.2 is Y; X.sub.3 is Y; and X.sub.4 is S.
(32) In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H1 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs:1-3 and 140-144 according to Kabat numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H1 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs:12-15 and 158-160 according to Chothia numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H1 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs:19-22, 165-169 and 509 according to AbM numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H1 having the amino acid sequence of SEQ ID NO:2, 13 or 20. In any of such examples, the provided antibody or antigen-binding fragment thereof can contain a V.sub.H region sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533 in which the corresponding CDR-H1 sequence contained therein (e.g. corresponding to amino acid residues H31 to H35 by Kabat numbering) is replaced by the CDR-H1 sequence selected from any one of SEQ ID NOs:1-3 and 140-144 according to Kabat numbering, any one of SEQ ID NOs:12-15 and 158-160 according to Chothia numbering, or any one of SEQ ID NOs:19-22, 165-169 and 509 according to AbM numbering.
(33) In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H1 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs:1-3, 141, 143 and 144 according to Kabat numbering, any one of SEQ ID NOs:12-15, 158 and 160 according to Chothia numbering, or any one of SEQ ID NOs:19-22, 166, 168 or 169 according to AbM numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H1 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs: 1 and 2 according to Kabat numbering, any one of SEQ ID NOs: 12 and 13 according to Chothia numbering, or any one of SEQ ID NOs: 19 and 20 according to AbM numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H1 having the amino acid sequence comprising the amino acid sequence of SEQ ID NO:2 according to Kabat numbering, SEQ ID NO:13 according to Chothia numbering, or SEQ ID NO:20 according to AbM numbering.
(34) In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H1 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H1 contained within the V.sub.H region amino acid sequence of SEQ ID NO:112. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H1 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H1 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110, 112, 115, 256 and 519. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H1 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:115 and 256.
(35) In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof is one that includes a heavy chain complementarity determining region 2 (CDR-H2) comprising the amino acid sequence of X.sub.1IX.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11YX.sub.12 X.sub.13 X.sub.14 X.sub.15 X.sub.16 X.sub.17 (SEQ ID NO:354), wherein X.sub.1 is F, G, H, V, W or Y; X.sub.2 is N, R, S or V; X.sub.3 is P, Q, S, V, W or Y; X.sub.4 is K or null; X.sub.5 is A or null; X.sub.6 is D, G, N, S, or Y; X.sub.7 is G or S; X.sub.8 is G or S; X.sub.9 is E, G, N, T or S; X.sub.10 is I, K, or T; X.sub.11 is E, G, N or Y; X.sub.12 is A or V; X.sub.13 is A, D or Q; X.sub.14 is K or S; X.sub.15 is F or V; X.sub.16 is K or Q; and X.sub.17 is E or G. In some embodiments in said CDR-H2, X.sub.1 is Y; X.sub.2 is 5, X.sub.3 is 5; X.sub.4 is null; X.sub.5 is null; X.sub.6 is 5; X.sub.7 is G; X.sub.8 is 5; X.sub.9 is T; X.sub.10 is I; X.sub.11 is Y; X.sub.12 is A; X.sub.13 is D; X.sub.14 is 5; X.sub.15 is V; X.sub.16 is K; and X.sub.17 is G.
(36) In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 comprising the amino acid sequence selected from any one of SEQ ID NOs:4-6, 145-148 and 372-374 according to Kabat numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 comprising the amino acid sequence selected from any one of SEQ ID NOs:16-18, 161-164 and 514-516 according to Chothia numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 comprising the amino acid sequence selected from any one of SEQ ID NOs:23-25, 170-173 and 510-512 according to AbM numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 having the amino acid sequence of SEQ ID NO:5 according to Kabat numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 having the amino acid sequence of SEQ ID NO:17 according to Chothia numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 having the amino acid sequence of SEQ ID NO:24 according to AbM numbering. In any of such examples, the provided antibody or antigen-binding fragment thereof can contain a V.sub.H region sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533 in which the corresponding CDR-H2 sequence contained therein (e.g. corresponding to amino acid residues H50 to H65 by Kabat numbering) is replaced by the CDR-H2 sequence selected from any one of SEQ ID NOs:4-6, 145-148 and 372-374, any one of SEQ ID NOs:16-18, 161-164 and 514-516 according to Chothia numbering, or any one of SEQ ID NOs:23-25, 170-173 and 510-512 according to AbM numbering.
(37) In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs:4-6, 145, 147, 148 and 372 according to Kabat numbering, any one of SEQ ID NOs:16-18, 161, 163, 164 and 514 according to Chothia numbering, or any one of SEQ ID NOs:23-25, 170, 172, 173 and 510 according to AbM numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs: 4 and 5 according to Kabat numbering, any one of SEQ ID NOs: 16 and 17 according to Chothia numbering, or any one of SEQ ID NOs: 23 and 24 according to AbM numbering. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 having the amino acid sequence comprising the amino acid sequence of SEQ ID NO:5 according to Kabat numbering, SEQ ID NO:17 according to Chothia numbering, or SEQ ID NO:24 according to AbM numbering.
(38) In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof contains a CDR-H2 contained within the V.sub.H region amino acid sequence of SEQ ID NO:112. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H2 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H2 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110, 112, 115, 256 and 519. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H2 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:115 and 256.
(39) In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-H1 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:1-3 and 140-144 according to Kabat numbering; a CDR-H2 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:4-6, 145-148 and 372-374 according to Kabat numbering; and a CDR-H3 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378 according to Kabat numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-H1 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:12-15 and 158-160 according to Chothia numbering; a CDR-H2 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:16-18, 161-164 and 514-516 according to Chothia numbering; and a CDR-H3 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378 according to Chothia numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-H1 that is or comprises the amino acid sequence selected from any one of SEQ ID NO:19-22, 165-169 and 509 according to AbM numbering; a CDR-H2 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:23-25, 170-173 and 510-512 according to AbM numbering; and a CDR-H3 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378 according to AbM numbering.
(40) In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H1, CDR-H2, and/or CDR-H3 according to Kabat numbering as shown in Table 2 and Table 4. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H1, CDR-H2, and/or CDR-H3 according to Chothia numbering as shown in Table 4. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H1, CDR-H2, and/or CDR-H3 according to AbM numbering as shown in Table 4.
(41) In some embodiments, the provided antibody or antigen-binding fragment thereof comprises an V.sub.H region comprising a CDR-H1, CDR-H2, and CDR-H3 selected from the group consisting of: a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:1, 4, and 7, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 8, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 9, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 10, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 6, and 11, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:140, 145, and 149, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:141, 145, and 149, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:141, 145, and 150, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:142, 146, and 151, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 152, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:143, 147, and 153, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:144, 148, and 154, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 6, and 155, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 156, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 157, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 6, and 376, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 372, and 376, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 6, and 376, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 6, and 377, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 373, and 152, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 378, respectively; a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 374, and 9, respectively, according to Kabat numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises an V.sub.H region comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 9, respectively, according to Kabat numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises an V.sub.H region comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:13, 17, and 9, respectively, according to Chothia numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises an V.sub.H region comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:20, 24, and 9, respectively, according to AbM numbering.
(42) For example, the antibody or antigen-binding fragment thereof provided herein comprises an V.sub.H region comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence selected from among: SEQ ID NOs:1, 4, and 7; SEQ ID NOs:2, 5, and 8; SEQ ID NOs:2, 5, and 9; SEQ ID NOs:2, 5, and 10; SEQ ID NOs:3, 6, and 11; SEQ ID NOs:140, 145, and 149; SEQ ID NOs:141, 145, and 149; SEQ ID NOs:141, 145, and 150; SEQ ID NOs:142, 146, and 151; SEQ ID NOs:2, 5, and 152; SEQ ID NOs:143, 147, and 153; SEQ ID NOs:144, 148, and 154; SEQ ID NOs:3, 6, and 155; SEQ ID NOs:2, 5, and 156; SEQ ID NOs:2, 5, and 157; SEQ ID NOs:2, 6, and 376; SEQ ID NOs:3, 372, and 376; SEQ ID NOs:3, 6, and 376; SEQ ID NOs:3, 6, and 377; SEQ ID NOs:2, 373, and 152; SEQ ID NOs:2, 5, and 378; SEQ ID NOs:2, 374, and 9, respectively, according to Kabat numbering.
(43) In some embodiments, the antibody or antigen-binding fragment thereof provided herein comprises an V.sub.H region comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence selected from among: SEQ ID NOs:1, 4, and 7; SEQ ID NOs:2, 5, and 8; SEQ ID NOs:2, 5, and 9; SEQ ID NOs:2, 5, and 10; SEQ ID NOs:141, 145, and 149; SEQ ID NOs:143, 147, and 153; SEQ ID NOs:144, 148, and 154; SEQ ID NOs:3, 6, and 155; SEQ ID NOs:2, 5, and 156; SEQ ID NOs:2, 5, and 157; SEQ ID NOs:2, 6, and 376; SEQ ID NOs:3, 372, and 376; and SEQ ID NOs:3, 6, and 376, respectively, according to Kabat numbering. In some embodiments, the antibody or antigen-binding fragment thereof provided herein comprises an V.sub.H region comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence selected from among: SEQ ID NOs:1, 4, and 7; SEQ ID NOs:2, 5, and 9; SEQ ID NOs:2, 5, and 10; and SEQ ID NOs:2, 5, and 157, respectively, according to Kabat numbering. In some embodiments, the antibody or antigen-binding fragment thereof provided herein comprises an V.sub.H region comprising a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence selected from among: SEQ ID NOs:2, 5, and 10; and SEQ ID NOs:2, 5, and 157, respectively, according to Kabat numbering.
(44) In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a CDR-H1, CDR-H2 and CDR-H3, respectively, comprising the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a CDR-H1, CDR-H2 and CDR-H3, respectively, comprising the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:112. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H1, CDR-H2 and CDR-H3, respectively, comprising the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H1, CDR-H2 and CDR-H3, respectively, comprising the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110, 112, 115, 256 and 519. In some embodiments, the V.sub.H region of a provided antibody or antigen-binding fragment thereof comprises a CDR-H1, CDR-H2 and CDR-H3, respectively, comprising the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:115 and 256.
(45) In some embodiments of the antibody or antigen-binding fragment thereof provided herein, the V.sub.H region comprises any of the CDR-H1, CDR-H2 and CDR-H3 as described and comprises a framework region 1 (FR1), a FR2, a FR3 and/or a FR4 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity, respectively, to a FR1, a FR2, a FR3 and/or a FR4 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533. For example, the anti-BCMA antibody or antigen-binding fragment thereof can comprise a CDR-H1, CDR-H2 and CDR-H3, respectively, contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533, and a framework region (e.g., a FR1, a FR2, a FR3 and/or a FR4) that contains at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to a framework region (e.g., a FR1, a FR2, a FR3 and/or a FR4) contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533. In some embodiments, the V.sub.H region comprises a FR1, a FR2, a FR3 and/or a FR4 selected from a FR1 comprising the amino acid sequence selected from any one of SEQ ID NOs:59-63, 195-203 and 434-439; a FR2 comprising the amino acid sequence selected from any one of SEQ ID NOs:64-66 and 204-209; a FR3 comprising the amino acid sequence selected from any one of SEQ ID NOs:67-69, 210-216, 441 and 443; and/or a FR4 comprising the amino acid sequence selected from any one of SEQ ID NOs:70-71, 217-220, 444 and 445. In some embodiments, the V.sub.H region comprises a FR1 comprising the amino acid sequence of SEQ ID NO:61, a FR2 comprising the amino acid sequence of SEQ ID NO:65, a FR3 comprising the amino acid sequence of SEQ ID NO:69, and/or a FR4 comprising the amino acid of SEQ ID NO:70.
(46) In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a V.sub.H region comprising the amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533. In some embodiments, provided antibody or antigen-binding fragment thereof comprises a V.sub.H region comprising the amino acid sequence selected from any one of SEQ ID NOs: 110-113, 115, 248, 252-256 and 518-522. In some embodiments, provided antibody or antigen-binding fragment thereof comprises a V.sub.H region comprising the amino acid sequence selected from any one of SEQ ID NOs: 110, 112, 115, 256 and 519. In some embodiments, provided antibody or antigen-binding fragment thereof comprises a V.sub.H region comprising the amino acid sequence selected from any one of SEQ ID NOs:115 and 256.
(47) Also provided are antibodies and antigen-binding fragments thereof having sequences at least at or about at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to such sequences. For example, provided herein is an antibody or antigen-binding fragment comprising a V.sub.H region comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to a V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(48) In some embodiments, the antibody is a single domain antibody (sdAb) comprising only a V.sub.H region sequence or a sufficient antigen-binding portion thereof, such as any of the above described V.sub.H sequences (e.g., a CDR-H1, a CDR-H2, a CDR-H3 and/or a CDR-H4).
(49) In some embodiments, an antibody provided herein (e.g., an anti-BCMA antibody) or antigen-binding fragment thereof comprising a V.sub.H region further comprises a light chain or a sufficient antigen binding portion thereof. For example, in some embodiments, the antibody or antigen-binding fragment thereof contains a V.sub.H region and a V.sub.L region, or a sufficient antigen-binding portion of a V.sub.H and V.sub.L region. In such embodiments, a V.sub.H region sequence can be any of the above described V.sub.H sequence. In some such embodiments, the antibody is an antigen-binding fragment, such as a Fab or an scFv. In some such embodiments, the antibody is a full-length antibody that also contains a constant region.
(50) In some embodiments, the antibody, e.g., antigen-binding fragment thereof, has a light chain variable (V.sub.L) region having the amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557, or an amino acid sequence that has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to a V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(51) In some embodiments, the V.sub.L region of the antibody described herein (e.g., an anti-BCMA antibody) or antigen-binding fragment thereof is one that includes a light chain complementarity determining region 3 (CDR-L3) comprising the amino acid sequence X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12, (SEQ ID NO:358), wherein X.sub.1 is A, C, G, H, I, Q or S; X.sub.2 is A, Q, S or V; X.sub.3 is 5, W or Y; X.sub.4 is D, F, G, H or Y; X.sub.5 is D, G, M, R, S or T; X.sub.6 is A, G, H, L, R, S, T or Y; X.sub.7 is L, P, R, S or null; X.sub.8 is D, G, N, R, S, T or null; X.sub.9 is A, G, H, L, P or null; X.sub.10 is F, S or null; X.sub.11 is L, P, W or Y; and X.sub.12 is S, T or V. In some embodiments, in said CDR-L3, X.sub.1 is H; X.sub.2 is V; X.sub.3 is W; X.sub.4 is D; X.sub.5 is R; X.sub.6 is 5; X.sub.7 is R; X.sub.8 is D; X.sub.9 is H; X.sub.10 is null; X.sub.11 is Y; and X.sub.12 is V.
(52) In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-L3 comprising the amino acid sequence selected from any one of SEQ ID NOs:47-58, 184-194, 415-427 and 429-433 according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-L3 having the amino acid sequence of SEQ ID NO:55 according to Kabat numbering, Chothia numbering or AbM numbering. In any of such examples, the provided antibody or antigen-binding fragment thereof can contain a V.sub.L region sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557 in which the corresponding CDR-L3 sequence contained therein (e.g. corresponding to amino acid residues L89 to L97 by Kabat numbering) is replaced by the CDR-L3 sequence selected from any one of SEQ ID NOs:47-58, 184-194, 415-427 and 429-433 according to Kabat numbering, Chothia numbering or AbM numbering.
(53) In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a CDR-L3 comprising the amino acid sequence selected from any one of SEQ ID NOs:47-49, 51, 52, 55, 56, 185, 189-194, 415-418 and 421, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a CDR-L3 comprising the amino acid sequence selected from any one of SEQ ID NOs: 47, 51, 55, 194, 416 and 421, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a CDR-L3 comprising the amino acid sequence selected from any one of SEQ ID NOs: 194 and 421, according to Kabat numbering, Chothia numbering or AbM numbering.
(54) In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:124. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-118, 120, 121, 124, 125, 258, 262-267 and 534-538. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116, 120, 124, 267, 535 and 536. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:267 and 536.
(55) In some embodiments, the V.sub.L region of the antibody described herein (e.g., an anti-BCMA antibody) or antigen-binding fragment thereof is one that includes a light chain complementarity determining region 1 (CDR-L1) that contains the amino acid sequence: X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13X.sub.14X.sub.15X.sub.16X.sub.17 (SEQ ID NO:356), wherein X.sub.1 is G, K, R, S or T; X.sub.2 is A, G or S; X.sub.3 is G, N, S or T; X.sub.4 is G, K, N, Q, R or S; X.sub.5 is S or null; X.sub.6 is D, N, V or null; X.sub.7 is L, V or null; X.sub.8 is H, S, Y or null; X.sub.9 is S, T or null; X.sub.10 is S or null; X.sub.11 is D, G, I, N, S or null; X.sub.12 is D, E, G, K, I, N or null; X.sub.13 is F, G, K, N, R, S, Y or null; X.sub.14 is D, K, N, T or null; X.sub.15 is A, D, G, L, N, S, T or Y; X.sub.16 is L or V; X.sub.17 is A, H, N, Q or S. In some embodiments, X.sub.1 is G; X.sub.2 is A; X.sub.3 is N; X.sub.4 is N; X.sub.5 is null; X.sub.6 is null; X.sub.7 is null; X.sub.8 is null; X.sub.9 is null; X.sub.10 is null; X.sub.11 is I; X.sub.12 is G; X.sub.13 is 5; X.sub.14 is K; X.sub.15 is 5; X.sub.16 is V; X.sub.17 is H.
(56) In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-L1 comprising the amino acid sequence selected from any one of SEQ ID NOs:26-36, 174-178, 380-392 and 394-398 according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-L1 having the amino acid sequence of SEQ ID NO:33 according to Kabat numbering, Chothia numbering or AbM numbering. In any of such examples, the provided antibody or antigen-binding fragment thereof can contain a V.sub.L region sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557 in which the corresponding CDR-L1 sequence contained therein (e.g. corresponding to amino acid residues L24 to L34 by Kabat numbering) is replaced by the CDR-L1 sequence selected from any one of SEQ ID NOs:26-36, 174-178, 380-392 and 394-398 according to Kabat numbering, Chothia numbering or AbM numbering.
(57) In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof contains a CDR-L1 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs:26-28, 30, 31, 33, 34, 174, 176-178 and 380-382, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof contains a CDR-L1 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs:26, 30, 33, 178 and 380, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof contains a CDR-L1 having the amino acid sequence comprising the amino acid sequence selected from any one of SEQ ID NOs:33 and 178, according to Kabat numbering, Chothia numbering or AbM numbering.
(58) In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1 contained within the V.sub.L region amino acid sequence of SEQ ID NO:124. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-118, 120, 121, 124, 125, 258, 262-267 and 534-538, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116, 120, 124, 267, 535 and 536, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:267 and 536, according to Kabat numbering, Chothia numbering or AbM numbering.
(59) In some embodiments, the V.sub.L region of the antibody provided herein (e.g., an anti-BCMA antibody) or antigen-binding fragment thereof is one that includes a light chain complementarity determining region 2 (CDR-L2) that contains the amino acid sequence of X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7 (SEQ ID NO:357), wherein X.sub.1 is A, D, E, N, S, V or W; X.sub.2 is A, D, N, S or V; X.sub.3 is A, D, H, I, N or S; X.sub.4 is D, K, N, Q, R or T; X.sub.5 is L, R or V; X.sub.6 is A, E, P or Q; and X.sub.7 is A, D, S or T. In some embodiments, X.sub.1 is D; X.sub.2 is D; X.sub.3 is D; X.sub.4 is D; X.sub.5 is R; X.sub.6 is P; and X.sub.7 is S.
(60) In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-L2 comprising the amino acid sequence selected from any one of SEQ ID NOs:37-46, 179-183, 399-409 and 411-414 according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-L2 having the amino acid sequence of SEQ ID NO:43 according to Kabat numbering, Chothia numbering or AbM numbering. In any of such examples, the provided antibody or antigen-binding fragment thereof can contain a V.sub.L region sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557 in which the corresponding CDR-L2 sequence contained therein (e.g. corresponding to amino acid residues L50 to L56 by Kabat numbering) is replaced by the CDR-L2 sequence selected from any one of SEQ ID NOs:37-46, 179-183, 399-409 and 411-414 according to Kabat numbering, Chothia numbering or AbM numbering.
(61) In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L2 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:37-39, 41, 43, 44, 179, 181-183 and 399-401, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L2 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:37, 39, 43, 183 and 400, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L2 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:43 and 183, according to Kabat numbering, Chothia numbering or AbM numbering.
(62) In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L2 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L2 contained within the V.sub.L region amino acid sequence of SEQ ID NO:124. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L2 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-118, 120, 121, 124, 125, 258, 262-267 and 534-538. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L2 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116, 120, 124, 267, 535 and 536. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L2 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:267 and 536.
(63) In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-L1 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:26-36, 174-178, 380-392 and 394-398 according to Kabat numbering, Chothia numbering or AbM numbering; a CDR-L2 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:37-46, 179-183, 399-409 and 411-414 according to Kabat numbering, Chothia numbering or AbM numbering; and a CDR-L3 that is or comprises the amino acid sequence selected from any one of SEQ ID NOs:47-58, 184-194, 415-427 and 429-433 according to Kabat numbering, Chothia numbering or AbM numbering.
(64) In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1, CDR-L2, and/or CDR-L3 according to Kabat numbering as shown in Table 2 and Table 4. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1, CDR-L2, and/or CDR-L3 according to Chothia numbering as shown in Table 4. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1, CDR-L2, and/or CDR-L3 according to AbM numbering as shown in Table 4.
(65) In some embodiments of the antibody or antigen-binding fragment thereof provided herein, the V.sub.L region comprises a CDR-L1, a CDR-L2, and a CDR-L3 selected from among: a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:26, 37, and 47, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:27, 38, and 48, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:28, 39, and 49, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:29, 40, and 50, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:30, 39, and 51, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:31, 41, and 52, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:32, 42, and 53, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:30, 39, and 54, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:33, 43, and 55, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:34, 44, and 56, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:35, 45, and 57, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:36, 46, and 58, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 184, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 185, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 186, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 187, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:175, 180, and 188, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 189, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:176, 181, and 190, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:177, 182, and 191, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 192, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:178, 183, and 193, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:178, 183, and 194, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:30, 399, and 415, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:380, 400, and 416, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:33, 43, and 421, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:381, 401, and 417, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:382, 402, and 418, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:383, 403, and 419, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:384, 39, and 54, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:385, 180, and 58, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:175, 180, and 188, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:386, 404, and 420, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:387, 405, and 422, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:388, 406, and 423, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:388, 407, and 424, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:389, 408, and 425, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:390, 183, and 193, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:391, 409, and 426, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:392, 40, and 427, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:394, 39, and 429, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:395, 411, and 430, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:396, 412, and 431, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:396, 412, and 58, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:397, 413, and 432, respectively; a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:398, 414, and 433, respectively. In some embodiments of the antibody or antigen-binding fragment thereof provided herein, the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:33, 43, and 55.
(66) For example, the antibody or antigen-binding fragment thereof provided herein comprises an V.sub.L region comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence selected from among: SEQ ID NOs:26, 37, and 47; SEQ ID NOs:27, 38, and 48; SEQ ID NOs:28, 39, and 49; SEQ ID NOs:29, 40, and 50; SEQ ID NOs:30, 39, and 51; SEQ ID NOs:31, 41, and 52; SEQ ID NOs:32, 42, and 53; SEQ ID NOs:30, 39, and 54; SEQ ID NOs:33, 43, and 55; SEQ ID NOs:34, 44, and 56; SEQ ID NOs:35, 45, and 57; SEQ ID NOs:36, 46, and 58; SEQ ID NOs:174, 179, and 184; SEQ ID NOs:174, 179, and 185; SEQ ID NOs:174, 179, and 186; SEQ ID NOs:174, 179, and 187; SEQ ID NOs:175, 180, and 188; SEQ ID NOs:174, 179, and 189; SEQ ID NOs:176, 181, and 190; SEQ ID NOs:177, 182, and 191; SEQ ID NOs:174, 179, and 192; SEQ ID NOs:178, 183, and 193; SEQ ID NOs:178, 183, and 194; SEQ ID NOs:30, 399, and 415; SEQ ID NOs:380, 400, and 416; SEQ ID NOs:33, 43, and 421; SEQ ID NOs:381, 401, and 417; SEQ ID NOs:382, 402, and 418; SEQ ID NOs:383, 403, and 419; SEQ ID NOs:384, 39, and 54; SEQ ID NOs:385, 180, and 58; SEQ ID NOs:175, 180, and 188; SEQ ID NOs:386, 404, and 420; SEQ ID NOs:387, 405, and 422; SEQ ID NOs:388, 406, and 423; SEQ ID NOs:388, 407, and 424; SEQ ID NOs:389, 408, and 425; SEQ ID NOs:390, 183, and 193; SEQ ID NOs:391, 409, and 426; SEQ ID NOs:392, 40, and 427; SEQ ID NOs:394, 39, and 429; SEQ ID NOs:395, 411, and 430; SEQ ID NOs:396, 412, and 431; SEQ ID NOs:396, 412, and 58; SEQ ID NOs:397, 413, and 432; SEQ ID NOs:398, 414, and 433, respectively.
(67) In some embodiments, the antibody or antigen-binding fragment thereof provided herein comprises an V.sub.L region comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence selected from among: SEQ ID NOs:26, 37, and 47; SEQ ID NOs:27, 38, and 48; SEQ ID NOs:28, 39, and 49; SEQ ID NOs:30, 39, and 51; SEQ ID NOs:31, 41, and 52; SEQ ID NOs:33, 43, and 55; SEQ ID NOs:34, 44, and 56; SEQ ID NOs:174, 179, and 185; SEQ ID NOs:174, 179, and 189; SEQ ID NOs:176, 181, and 190; SEQ ID NOs:177, 182, and 191; SEQ ID NOs:174, 179, and 192; SEQ ID NOs:178, 183, and 193; SEQ ID NOs:178, 183, and 194; SEQ ID NOs:30, 399, and 415; SEQ ID NOs:380, 400, and 416; SEQ ID NOs:33, 43, and 421; SEQ ID NOs:381, 401, and 417; and SEQ ID NOs:382, 402, and 418, respectively, according to Kabat numbering, Chothia numbering or AbM numbering.
(68) In some embodiments, the antibody or antigen-binding fragment thereof provided herein comprises an V.sub.L region comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence selected from among: SEQ ID NOs:26, 37, and 47; SEQ ID NOs:30, 39, and 51; SEQ ID NOs:33, 43, and 55; SEQ ID NOs:178, 183, and 194; SEQ ID NOs:380, 400, and 416; and SEQ ID NOs:33, 43, and 421, respectively, according to Kabat numbering, Chothia numbering or AbM numbering. In some embodiments, the antibody or antigen-binding fragment thereof provided herein comprises an V.sub.L region comprising a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence selected from among: SEQ ID NOs:178, 183, and 194; and SEQ ID NOs:33, 43, and 421, respectively, according to Kabat numbering, Chothia numbering or AbM numbering.
(69) In some embodiments, the provided antibody or antigen-binding fragment thereof contains a CDR-L1, CDR-L2, and CDR-L3, respectively, contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557. In some embodiments, the provided antibody contains a CDR-L1, CDR-L2, and CDR-L3, respectively, contained within the V.sub.L region amino acid sequence selected of SEQ ID NO:124. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1, CDR-L2, and CDR-L3, respectively, contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-118, 120, 121, 124, 125, 258, 262-267 and 534-538. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1, CDR-L2, and CDR-L3, respectively, contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116, 120, 124, 267, 535 and 536. In some embodiments, the V.sub.L region of a provided antibody or antigen-binding fragment thereof comprises a CDR-L1, CDR-L2, and CDR-L3, respectively, contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:267 and 536.
(70) In some embodiments of the antibody or antigen-binding fragment thereof provided herein, the V.sub.L region comprises any of the CDR-L1, CDR-L2 and CDR-L3 as described and comprises a framework region 1 (FR1), a FR2, a FR3 and/or a FR4 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity, respectively, to a FR1, a FR2, a FR3 and/or a FR4 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557. For example, the anti-BCMA antibody or antigen-binding fragment thereof can comprise a CDR-L1, CDR-L2 and CDR-L3, respectively, contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557, and a framework region (e.g., a FR1, a FR2, a FR3 and/or a FR4) that contains at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to a framework region (e.g., a FR1, a FR2, a FR3 and/or a FR4) contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557. In some embodiments, the V.sub.L region comprises a FR1, a FR2, a FR3 and/or a FR4 selected from a FR1 comprising the amino acid sequence selected from any one of SEQ ID NOs:72-82, 221-227, 446-459 and 461-466; a FR2 comprising the amino acid sequence selected from any one of SEQ ID NOs:83-92, 228-232, 467-477 and 479-482; a FR3 comprising the amino acid sequence selected from any one of SEQ ID NOs:93-101, 233-242, 483-495 and 497-501; and/or a FR4 comprising the amino acid sequence selected from any one of SEQ ID NOs:102-109, 243-246, 502-506 and 508. In some embodiments, the V.sub.L region comprises a FR1 comprising the amino acid sequence of SEQ ID NO:79, a FR2 comprising the amino acid sequence of SEQ ID NO:89, a FR3 comprising the amino acid sequence of SEQ ID NO:98, and/or a FR4 comprising the amino acid sequence of SEQ ID NO:108.
(71) In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a V.sub.L region comprising an amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557. In some embodiments, the provided antibody or antigen-binding fragment thereof contains a V.sub.L region comprises the amino acid sequence of SEQ ID NO:124. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a V.sub.L region comprising an amino acid sequence selected from any one of SEQ ID NOs:116-118, 120, 121, 124, 125, 258, 262-267 and 534-538. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a V.sub.L region comprising an amino acid sequence selected from any one of SEQ ID NOs:116, 120, 124, 267, 535 and 536. In some embodiments, the provided antibody or antigen-binding fragment thereof comprises a V.sub.L region comprising an amino acid sequence selected from any one of SEQ ID NOs:267 and 536.
(72) Also provided are antibodies having sequences at least at or about at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to such sequences.
(73) In some embodiments, the V.sub.H region of the antibody or fragment comprises the amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533 and the V.sub.L region of the antibody or fragment comprises the amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557. In some embodiments, the V.sub.H region of the antibody or fragment comprises the amino acid sequence selected from any one of SEQ ID NOs: 110-113, 115, 248, 252-256 and 518-522 and the V.sub.L region of the antibody or fragment comprises the amino acid sequence selected from any one of SEQ ID NOs: 116-118, 120, 121, 124, 125, 258, 262-267 and 534-538. In some embodiments, the V.sub.H region of the antibody or fragment comprises the amino acid sequence selected from any one of SEQ ID NOs: 110, 112, 115, 256 and 519 and the V.sub.L region of the antibody or fragment comprises the amino acid sequence selected from any one of SEQ ID NOs: 116, 120, 124, 267, 535 and 536. In some embodiments, the V.sub.H region of the antibody or fragment comprises the amino acid sequence selected from any one of SEQ ID NOs: 115 and 256 and the V.sub.L region of the antibody or fragment comprises the amino acid sequence selected from any one of SEQ ID NOs: 267 and 536.
(74) Also provided are antibodies and antigen-binding fragments thereof having sequences at least at or about at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to such sequences. For example, provided herein is an antibody or antigen-binding fragment containing a V.sub.L region comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to a V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557 and/or comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to a V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533. In some embodiments, the antibody or antigen-binding fragment contains a V.sub.L region comprising the amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557 and a V.sub.H region the amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(75) In some embodiments, the V.sub.H region of the antibody or antigen-binding fragment thereof comprises a CDR-H1, a CDR-H2, a CDR-H3, respectively, comprising the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533; and the V.sub.L region of the antibody or antigen-binding fragment thereof comprises a CDR-L1, a CDR-L2, a CDR-L3, respectively, comprising the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3, respectively contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(76) In some embodiments, the V.sub.H region of the antibody or fragment comprises a CDR-H1, a CDR-H2, a CDR-H3, respectively, comprising the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533 and the V.sub.L region of the antibody or fragment comprises a CDR-L1, a CDR-L2, a CDR-L3, respectively, comprising the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3, respectively contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557. In some embodiments, the V.sub.H region of the antibody or fragment comprises a CDR-H1, a CDR-H2, a CDR-H3, respectively, comprising the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522 and the V.sub.L region of the antibody or fragment comprises a CDR-L1, a CDR-L2, a CDR-L3, respectively, comprising the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3, respectively contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-118, 120, 121, 124, 125, 258, 262-267 and 534-538. In some embodiments, the V.sub.H region of the antibody or fragment comprises a CDR-H1, a CDR-H2, a CDR-H3, respectively, comprising the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110, 112, 115, 256 and 519 and the V.sub.L region of the antibody or fragment comprises a CDR-L1, a CDR-L2, a CDR-L3, respectively, comprising the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3, respectively contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs: 116, 120, 124, 267, 535 and 536. In some embodiments, the V.sub.H region of the antibody or fragment comprises a CDR-H1, a CDR-H2, a CDR-H3, respectively, comprising the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 115 and 256 and the V.sub.L region of the antibody or fragment comprises a CDR-L1, a CDR-L2, a CDR-L3, respectively, comprising the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3, respectively contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:267 and 536.
(77) In some embodiments, the antibody or antigen-binding fragment comprises a V.sub.H having at least 90% sequence identity to the V.sub.H sequence selected from any of SEQ ID NOs:110-115, 247-256, 518-531 and 533; and a V.sub.L having at least 90% sequence identity to the V.sub.L sequence selected from any of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(78) In some embodiments, the antibody or antigen-binding fragment comprises a V.sub.H having at least 90% sequence identity to the V.sub.H sequence selected from any of SEQ ID NOs:110, 256 and 519; and a V.sub.L having at least 90% sequence identity to the V.sub.L sequence selected from any of SEQ ID NOs:47, 51, 194 and 416. In some embodiments, said antibody or antigen-binding fragment comprises a V.sub.H having at least 90% sequence identity to the V.sub.H sequence of SEQ ID NO:115; and a V.sub.L having at least 90% sequence identity to the V.sub.L sequence of SEQ ID NO:536.
(79) In some embodiments, the antibody or antigen-binding fragment thereof comprises a V.sub.H comprising a CDR-H1, CDR-H2, and CDR-H3, wherein: the CDR-H1 comprises the sequence selected from any of SEQ ID NOs:1-3 and 140-144; the CDR-H2 comprises the sequence selected from any of SEQ ID NOs:4-6, 145-148 and 372-374; and the CDR-H3 comprises the sequence selected from any of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378; and a V.sub.L comprising a CDR-L1, CDR-L2, and CDR-L3, wherein: the CDR-L1 comprises the sequence selected from any of SEQ ID NOs:26-36, 174-178, 380-392 and 394-398; the CDR-L2 comprises the sequence selected from any of SEQ ID NOs:37-46, 179-183, 399-409 and 411-414; and the CDR-L3 comprises the sequence selected from any of SEQ ID NOs:47-58, 184-194, 415-427 and 429-433.
(80) In some embodiments, the CDR-H1 comprises the sequence selected from any of SEQ ID NOs:1 and 2; the CDR-H2 comprises the sequence selected from any of SEQ ID NOs:4 and 5; and the CDR-H3 comprises the sequence selected from any of SEQ ID NOs:7 and 157; and the CDR-L1 comprises the sequence selected from any of SEQ ID NOs:26, 30, 178 and 380; the CDR-L2 comprises the sequence selected from any of SEQ ID NOs:37, 39, 183 or 400; and the CDR-L3 comprises the sequence selected from any of SEQ ID NOs:47, 51, 194 and 416. In some embodiments, the CDR-H1 comprises the sequence of SEQ ID NO:2; the CDR-H2 comprises the sequence of SEQ ID NO:5; and the CDR-H3 comprises the sequence of SEQ ID NO:10; and the CDR-L1 comprises the sequence of SEQ ID NO:33; the CDR-L2 comprises the sequence of SEQ ID NO:43; and the CDR-L3 comprises the sequence of SEQ ID NO:421.
(81) In some embodiments, the antibody or antigen-binding fragment thereof comprises a V.sub.H and a V.sub.L, wherein: the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:26, 37, and 47, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 8, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:27, 38, and 48, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:28, 39, and 49, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:29, 40, and 50, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:30, 39, and 51, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:31, 41, and 52, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:32, 42, and 53, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:30, 39, and 54, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 9, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:33, 43, and 55, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 10, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:34, 44, and 56, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:3, 6, and 11, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:35, 45, and 57, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 10, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:36, 46, and 58, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:140, 145, and 149, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:174, 179, and 184, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:141, 145, and 149, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:174, 179, and 185, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:141, 145, and 150, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:174, 179, and 186, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:142, 146, and 151, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:174, 179, and 187, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 152, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:175, 180, and 188, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:143, 147, and 153, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:174, 179, and 189, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:144, 148, and 154, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:176, 181, and 190, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:3, 6, and 155, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:177, 182, and 191, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 156, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:174, 179, and 192, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 157, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:178, 183, and 193, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 157, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:178, 183, and 194, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 6, and 376, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:30, 399, and 415, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:380, 400, and 416, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 10, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:33, 43, and 421, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:3, 6, and 155, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:177, 182, and 191, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:3, 372, and 376, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:381, 401, and 417, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:3, 6, and 376, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:382, 402, and 418, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:3, 6, and 377, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:383, 403, and 419, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:384, 39, and 54, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 10, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:385, 180, and 58, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 373, and 152, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:175, 180, and 188, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:3, 6, and 11, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:386, 404, and 420, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 378, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:33, 43, and 421, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 9, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:387, 405, and 422, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 9, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:388, 406, and 423, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 9, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:388, 407, and 424, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:3, 6, and 376, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:389, 408, and 425, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 157, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:390, 183, and 193, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 374, and 9, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:391, 409, and 426, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:392, 40, and 427, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:394, 39, and 429, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:395, 411, and 430, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:28, 39, and 49, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 10, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:396, 412, and 431, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 10, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:396, 412, and 58, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 10, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:397, 413, and 432, respectively; or the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:398, 414, and 433, respectively.
(82) In some embodiments, the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:26, 37, and 47, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:30, 39, and 51, respectively; the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 157, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:178, 183, and 194, respectively; or the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:1, 4, and 7, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:380, 400, and 416, respectively. In some embodiments, the V.sub.H comprises a CDR-H1, CDR-H2, and CDR-H3 comprising SEQ ID NOS:2, 5, and 10, respectively, and the V.sub.L comprises a CDR-L1, CDR-L2, and CDR-L3 comprising SEQ ID NOS:33, 43, and 421, respectively.
(83) In some embodiments, the antibody or antigen-binding fragment thereof comprises a CDR-H1, CDR-H2, and CDR-H3, respectively, comprising the sequences of CDR-H1, CDR-H2, and CDR-H3 within the V.sub.H sequence selected from any of SEQ ID NOs:110-115, 247-256, 518-531 and 533; and/or a CDR-L1, CDR-L2, and CDR-L3, respectively, comprising the sequences of CDR-L1, CDR-L2, and CDR-L3 within the V.sub.L sequence selected from any of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(84) In some embodiments, the CDR-H1, CDR-H2, and CDR-H3, respectively, comprise the sequences of CDR-H1, CDR-H2, and CDR-H3 within the V.sub.H sequence selected from any of SEQ ID NOs:110, 256 and 519; and a CDR-L1, CDR-L2, and CDR-L3, respectively, comprising the sequences of CDR-L1, CDR-L2, and CDR-L3 within the V.sub.L sequence selected from any of SEQ ID NOs:116, 120, 267 and 535.
(85) In some embodiments, the CDR-H1, CDR-H2, and CDR-H3, respectively, comprise the sequences of CDR-H1, CDR-H2, and CDR-H3 within SEQ ID NO:115; and a CDR-L1, CDR-L2, and CDR-L3, respectively, comprising the sequences of CDR-L1, CDR-L2, and CDR-L3 within SEQ ID NO:536.
(86) In some embodiments, the antibody or antigen-binding fragment thereof comprises a V.sub.H and a V.sub.L, wherein: the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:116; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:111, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:117; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:118; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:119; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:120; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:121; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:122; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:123; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:112, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:124; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:113, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:125; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:114, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:126; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:115, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:127; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:247, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:257; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:248, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:258; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:249, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:259; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:250, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:260; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:251, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:261; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:252, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:262; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:253, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:263; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:254, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:264; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:255, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:265; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:256, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:266; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:256, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:267; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:518, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:534; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:519, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:535; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:115, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:536; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:520, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:264; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:521, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:537; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:522, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:538; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:523, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:539; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:519, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:540; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:524, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:541; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:525, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:261; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:526, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:542; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:527, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:543; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:528, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:544; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:529, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:545; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:528, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:546; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:522, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:547; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:256, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:548; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:530, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:549; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:531, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:550; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:519, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:552; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:553; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:118; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:533, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:554; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:115, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:555; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:524, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:556; or the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:519, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:557, respectively.
(87) In some embodiments, the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:116; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:110, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:120; the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:256, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:267; or the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:519, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:535. In some embodiments, the V.sub.H is or comprises a CDR-H1, CDR-H2 and CDR-H3 within SEQ ID NO:115, and the V.sub.L is or comprises a CDR-L1, CDR-L2 and CDR-L3 within SEQ ID NO:536, respectively.
(88) In some embodiments, the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 116, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:111 and 117, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 118, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 119, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 120, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 121, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 122, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 123, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:112 and 124, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:113 and 125, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:114 and 126, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:115 and 127, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:247 and 257, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:248 and 258, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:249 and 259, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:250 and 260, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:251 and 261, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:252 and 262, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:253 and 263, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:254 and 264, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:255 and 265, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:256 and 266, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:256 and 267, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:518 and 534, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 535, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:115 and 536, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:520 and 264, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:521 and 537, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:522 and 538, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:523 and 539, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 540, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:524 and 541, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:525 and 261, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:526 and 542, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:527 and 543, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:528 and 544, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:529 and 545, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:528 and 546, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:522 and 547, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:256 and 548, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:530 and 549, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:531 and 550, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 552, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 553, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 118, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:533 and 554, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:115 and 555, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:524 and 556, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 557, respectively, or any antibody or antigen-binding fragment thereof that has at least 90% sequence identity to any of the above V.sub.H and V.sub.L, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, the antibody or antigen-binding fragment comprises a V.sub.H and a V.sub.L regions comprising the sequence having at least 90% identity to SEQ ID NOs:110 and 116, respectively; a V.sub.H and a V.sub.L regions comprising the sequence having at least 90% identity to SEQ ID NOs:110 and 120, respectively; a V.sub.H and a V.sub.L regions comprising the sequence having at least 90% identity to SEQ ID NOS:256 and 267, respectively; or a V.sub.H and a V.sub.L regions comprising the sequence having at least 90% identity to SEQ ID NOS:519 and 535, respectively. In some embodiments, the antibody or antigen-binding fragment comprises a V.sub.H and a V.sub.L regions comprising the sequence having at least 90% identity to SEQ ID NOs:115 and 536, respectively.
(89) For example, the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof provided therein comprise the amino acid sequences selected from: SEQ ID NOs:110 and 116; SEQ ID NOs:111 and 117; SEQ ID NOs:110 and 118; SEQ ID NOs:110 and 119; SEQ ID NOs:110 and 120; SEQ ID NOs:110 and 121; SEQ ID NOs:110 and 122; SEQ ID NOs:110 and 123; SEQ ID NOs:112 and 124; SEQ ID NOs:113 and 125; SEQ ID NOs:114 and 126; SEQ ID NOs:115 and 127; SEQ ID NOs:247 and 257; SEQ ID NOs:248 and 258; SEQ ID NOs:249 and 259; SEQ ID NOs:250 and 260; SEQ ID NOs:251 and 261; SEQ ID NOs:252 and 262; SEQ ID NOs:253 and 263; SEQ ID NOs:254 and 264; SEQ ID NOs:255 and 265; SEQ ID NOs:256 and 266; SEQ ID NOs:256 and 267; SEQ ID NOs:518 and 534; SEQ ID NOs:519 and 535; SEQ ID NOs:115 and 536; SEQ ID NOs:520 and 264; SEQ ID NOs:521 and 537; SEQ ID NOs:522 and 538; SEQ ID NOs:523 and 539; SEQ ID NOs:519 and 540; SEQ ID NOs:524 and 541; SEQ ID NOs:525 and 261; SEQ ID NOs:526 and 542; SEQ ID NOs:527 and 543; SEQ ID NOs:528 and 544; SEQ ID NOs:529 and 545; SEQ ID NOs:528 and 546; SEQ ID NOs:522 and 547; SEQ ID NOs:256 and 548; SEQ ID NOs:530 and 549; SEQ ID NOs:531 and 550; SEQ ID NOs:519 and 552; SEQ ID NOs:110 and 553; SEQ ID NOs:110 and 118; SEQ ID NOs:533 and 554; SEQ ID NOs:115 and 555; SEQ ID NOs:524 and 556; SEQ ID NOs:519 and 557, respectively.
(90) In some embodiments, the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof provided therein comprise the amino acid sequences selected from: SEQ ID NOs:110 and 116; SEQ ID NOs:111 and 117; SEQ ID NOs:110 and 118; SEQ ID NOs:110 and 120; SEQ ID NOs:110 and 121; SEQ ID NOs:112 and 124; SEQ ID NOs:113 and 125; SEQ ID NOs:248 and 258; SEQ ID NOs:252 and 262; SEQ ID NOs:253 and 263; SEQ ID NOs:254 and 264; SEQ ID NOs:255 and 265; SEQ ID NOs:256 and 266; SEQ ID NOs:256 and 267; SEQ ID NOs:518 and 534; SEQ ID NOs:519 and 535; SEQ ID NOs:115 and 536; SEQ ID NOs:520 and 264; SEQ ID NOs:521 and 537; and SEQ ID NOs:522 and 538, respectively. In some embodiments, the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof provided therein comprise the amino acid sequences selected from: SEQ ID NOs:110 and 116; SEQ ID NOs:110 and 120; SEQ ID NOs:112 and 124; SEQ ID NOs:256 and 267; SEQ ID NOs:519 and 535; and SEQ ID NOs:115 and 536, respectively. In some embodiments, the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof provided therein comprise the amino acid sequences selected from: SEQ ID NOs:256 and 267; and SEQ ID NOs:115 and 536, respectively.
(91) In some embodiments, the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the sequences of SEQ ID NOs:110 and 116, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the sequences of SEQ ID NOs:110 and 120, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the sequences of SEQ ID NOS:256 and 267, respectively; or the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the sequences of SEQ ID NOS:519 and 535, respectively. In some embodiments, the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the sequences of SEQ ID NOs:115 and 536, respectively.
(92) In some embodiments, the antibody or antigen binding fragment comprises one or more heavy chain variable (V.sub.H) region and one or more light chain variable (V.sub.L) region, in any order or orientation. In some embodiments, the antibody or antigen-binding fragment comprises a V.sub.H region and a V.sub.L region, and the V.sub.H region is amino-terminal to the V.sub.L region. In some embodiments, the antibody or antigen-binding fragment comprises a V.sub.H region and a V.sub.L region, and the V.sub.H region is carboxy-terminal to the V.sub.L region. In some embodiments, the V.sub.H region(s) and the V.sub.L region(s) are linked directly or indirectly, optionally via a linker.
(93) In some embodiments, the antibody or antigen-binding fragment, e.g., scFv, may include a V.sub.H region or portion thereof, followed by the linker, followed by a V.sub.L region or portion thereof. In some embodiments, the antibody or antigen-binding fragment, e.g., the scFv, may include the V.sub.L region or portion thereof, followed by the linker, followed by the V.sub.H region or portion thereof.
(94) In some embodiments, the antibody or antigen-binding fragment thereof is a single-chain antibody fragment, such as a single chain variable fragment (scFv) or a diabody or a single domain antibody (sdAb). In some embodiments, the antibody or antigen-binding fragment is a single domain antibody comprising only the V.sub.H region. In some embodiments, the antibody or antigen binding fragment is an scFv comprising a heavy chain variable (V.sub.H) region and a light chain variable (V.sub.L) region. In some embodiments, the single-chain antibody fragment (e.g. scFv) includes one or more linkers joining two antibody domains or regions, such as a heavy chain variable (V.sub.H) region and a light chain variable (V.sub.L) region. The linker typically is a peptide linker, e.g., a flexible and/or soluble peptide linker. Among the linkers are those rich in glycine and serine and/or in some cases threonine. In some embodiments, the linkers further include charged residues such as lysine and/or glutamate, which can improve solubility. In some embodiments, the linkers further include one or more proline.
(95) Accordingly, the provided anti-BCMA antibodies include single-chain antibody fragments, such as scFvs and diabodies, particularly human single-chain antibody fragments, typically comprising linker(s) joining two antibody domains or regions, such V.sub.H and V.sub.L regions. The linker typically is a peptide linker, e.g., a flexible and/or soluble peptide linker, such as one rich in glycine and serine.
(96) In some aspects, the linkers rich in glycine and serine (and/or threonine) include at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% such amino acid(s). In some embodiments, they include at least at or about 50%, 55%, 60%, 70%, or 75%, glycine, serine, and/or threonine. In some embodiments, the linker is comprised substantially entirely of glycine, serine, and/or threonine. The linkers generally are between about 5 and about 50 amino acids in length, typically between at or about 10 and at or about 30, e.g., 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30, and in some examples between 10 and 25 amino acids in length. Exemplary linkers include linkers having various numbers of repeats of the sequence GGGGS (4GS; SEQ ID NO:359) or GGGS (3GS; SEQ ID NO:360), such as between 2, 3, 4, and 5 repeats of such a sequence. Exemplary linkers include those having or consisting of an sequence set forth in SEQ ID NO:361 (GGGGSGGGGSGGGGS). Exemplary linkers further include those having or consisting of the sequence set forth in SEQ ID NO:362 (GSTSGSGKPGSGEGSTKG).
(97) Accordingly, in some embodiments, the provided embodiments include single-chain antibody fragments, e.g., scFvs, comprising one or more of the aforementioned linkers, such as glycine/serine rich linkers, including linkers having repeats of GGGS or GGGGS, such as the linker set forth in SEQ ID NO:361. In some embodiments, the linker has an amino acid sequence containing the sequence set forth in SEQ ID NO:361.
(98) In some aspects, an scFv provided herein comprises the amino acid sequence selected from any one of SEQ ID NOs:128-139, 268-278, 558-576 and 578-583, or has an amino acid sequence having at least at or about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence selected from any one of SEQ ID NOs:128-139, 268-278, 558-576 and 578-583.
(99) For example, the scFv provided herein comprises the amino acid sequence selected from any of SEQ ID NOS: 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 578, 579, 580, 581, 582 and 583, or has an amino acid sequence having at least at or about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence selected from any one of SEQ ID NOS: 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 578, 579, 580, 581, 582 and 583.
(100) In some embodiments, the scFv provided herein comprises the amino acid sequence selected from any of SEQ ID NOS: 128, 129, 130, 132, 133, 136, 137, 269, 273, 274, 275, 276, 277, 278, 558, 559, 560, 561, 562 and 563, or has an amino acid sequence having at least at or about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence selected from any one of SEQ ID NOS: 128, 129, 130, 132, 133, 136, 137, 269, 273, 274, 275, 276, 277, 278, 558, 559, 560, 561, 562 and 563. In some embodiments, the scFv provided herein comprises the amino acid sequence selected from any of SEQ ID NOS: 128, 132, 136, 278, 559 and 560, or has an amino acid sequence having at least at or about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence selected from any one of SEQ ID NOS: 128, 132, 136, 278, 559 and 560. In some embodiments, the scFv provided herein comprises the amino acid sequence selected from any of SEQ ID NOS: 278 and 560 or has an amino acid sequence having at least at or about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence selected from any one of SEQ ID NOS: 278 and 560. In some embodiments, the scFv comprises the sequence selected from any of SEQ ID NOs:128, 132, 278 and 502, or an sequence having at least 90% sequence identity to the sequence selected from any of SEQ ID NOs:128, 132, 278 and 502. In some embodiments, the scFv comprises the sequence of SEQ ID NO:560, or an sequence having at least 90% sequence identity to the sequence of SEQ ID NO:560.
(101) Table 2 provides the SEQ ID NOS: of exemplary antibodies or antigen-binding fragments and regions or domains thereof that are provided herein. In some embodiments, the BCMA-binding antibody or fragment thereof comprises a V.sub.H region that comprises the CDR-H1, CDR-H2, and CDR-H3 sequence and a V.sub.L region that comprises the CDR-L1, CDR-L2 and CDR-L3 sequence set forth in the SEQ ID NOS: listed in each row of Table 2 below (by Kabat numbering). In some embodiments, the BCMA-binding antibody or fragment thereof comprises a V.sub.H region sequence and a V.sub.L region sequence set forth in the SEQ ID NOS: listed in each row of Table 2 below, or an antibody comprising a V.sub.H and V.sub.L region amino acid sequence that has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the V.sub.H region sequence and the V.sub.L region sequence set forth in the SEQ ID NOS: listed in each row of Table 2 below. In some embodiments, the BCMA-binding antibody or fragment thereof comprises a V.sub.H region sequence and a V.sub.L region sequence set forth in the SEQ ID NOS: listed in each row of Table 2 below. In some embodiments, the BCMA-binding antibody or fragment thereof comprises an scFv sequence set forth in the SEQ ID NOS: listed in each row of Table 2 below, or an antibody comprising an scFv amino acid sequence that has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the scFv sequence set forth in the SEQ ID NOS: listed in each row of Table 2 below.
(102) TABLE-US-00002 TABLE 2 Sequence identifier (SEQ ID NO) for Exemplary Antibodies and Domains Antigen-binding CDR- CDR- CDR- CDR- CDR- CDR- domain H1 H2 H3 L1 L2 L3 V.sub.H V.sub.L scFv BCMA-1 1 4 7 26 37 47 110 116 128 BCMA-2 2 5 8 27 38 48 111 117 129 BCMA-3 1 4 7 28 39 49 110 118 130 BCMA-4 1 4 7 29 40 50 110 119 131 BCMA-5 1 4 7 30 39 51 110 120 132 BCMA-6 1 4 7 31 41 52 110 121 133 BCMA-7 1 4 7 32 42 53 110 122 134 BCMA-8 1 4 7 30 39 54 110 123 135 BCMA-9 2 5 9 33 43 55 112 124 136 BCMA-10 2 5 10 34 44 56 113 125 137 BCMA-11 3 6 11 35 45 57 114 126 138 BCMA-12 2 5 10 36 46 58 115 127 139 BCMA-13 140 145 149 174 179 184 247 257 268 BCMA-14 141 145 149 174 179 185 248 258 269 BCMA-15 141 145 150 174 179 186 249 259 270 BCMA-16 142 146 151 174 179 187 250 260 271 BCMA-17 2 5 152 175 180 188 251 261 272 BCMA-18 143 147 153 174 179 189 252 262 273 BCMA-19 144 148 154 176 181 190 253 263 274 BCMA-20 3 6 155 177 182 191 254 264 275 BCMA-21 2 5 156 174 179 192 255 265 276 BCMA-22 2 5 157 178 183 193 256 266 277 BCMA-23 2 5 157 178 183 194 256 267 278 BCMA-24 2 6 376 30 399 415 518 534 558 BCMA-25 1 4 7 380 400 416 519 535 559 BCMA-26 2 5 10 33 43 421 115 536 560 BCMA-27 3 6 155 177 182 191 520 264 561 BCMA-28 3 372 376 381 401 417 521 537 562 BCMA-29 3 6 376 382 402 418 522 538 563 BCMA-30 3 6 377 383 403 419 523 539 564 BCMA-31 1 4 7 384 39 54 519 540 565 BCMA-32 2 5 10 385 180 58 524 541 566 BCMA-33 2 373 152 175 180 188 525 261 567 BCMA-34 3 6 11 386 404 420 526 542 568 BCMA-35 2 5 378 33 43 421 527 543 569 BCMA-36 2 5 9 387 405 422 528 544 570 BCMA-37 2 5 9 388 406 423 529 545 571 BCMA-38 2 5 9 388 407 424 528 546 572 BCMA-39 3 6 376 389 408 425 522 547 573 BCMA-40 2 5 157 390 183 193 256 548 574 BCMA-41 2 374 9 391 409 426 530 549 575 BCMA-42 1 4 7 392 40 427 531 550 576 BCMA-44 1 4 7 394 39 429 519 552 578 BCMA-45 1 4 7 395 411 430 110 553 579 BCMA-46 1 4 7 28 39 49 110 118 130 BCMA-47 2 5 10 396 412 431 533 554 580 BCMA-48 2 5 10 396 412 58 115 555 581 BCMA-49 2 5 10 397 413 432 524 556 582 BCMA-51 1 4 7 398 414 433 519 557 583 BCMA-52 496 507 513 517 532 551 577 587 442 BCMA-55 588 589 590 591 592 593 594 595 478 BCMA-C1, 288 290 292 302 304 306 324 326 585 VH-VL BCMA-C1, 288 290 292 302 304 306 324 326 328 VL-VH BCMA-C2, 289 291 293 303 305 307 325 327 329 VH-VL BCMA-C2, 289 291 293 303 305 307 325 327 586 VL-VH
(103) Among the provided antibodies, e.g. antigen-binding fragments, are human antibodies. In some embodiments of a provided human anti-BCMA antibody, e.g., antigen-binding fragments, the human antibody contains a V.sub.H region that comprises a portion having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a germline nucleotide human heavy chain V segment, a portion having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a germline nucleotide human heavy chain D segment, and/or a portion having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a germline nucleotide human heavy chain J segment; and/or contains a V.sub.L region that comprises a portion having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a germline nucleotide human kappa or lambda chain V segment, and/or a portion having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a germline nucleotide human kappa or lambda chain J segment. In some embodiments, the portion of the V.sub.H region corresponds to the CDR-H1, CDR-H2 and/or CDR-H3. In some embodiments, the portion of the V.sub.H region corresponds to the framework region 1 (FR1), FR2, FR2 and/or FR4. In some embodiments, the portion of the V.sub.L region corresponds to the CDR-L1, CDR-L2 and/or CDR-L3. In some embodiments, the portion of the V.sub.L region corresponds to the FR1, FR2, FR2 and/or FR4.
(104) In some embodiments, the human antibody or antigen-binding fragment thereof, contains a CDR-H1 having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence of the corresponding CDR-H1 region within a sequence encoded by a germline nucleotide human heavy chain V segment. For example, the human antibody in some embodiments contains a CDR-H1 having a sequence that is 100% identical or with no more than one, two or three amino acid differences as compared to the corresponding CDR-H1 region within a sequence encoded by a germline nucleotide human heavy chain V segment.
(105) In some embodiments, the human antibody or antigen-binding fragment thereof, contains a CDR-H2 having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence of the corresponding CDR-H2 region within a sequence encoded by a germline nucleotide human heavy chain V segment. For example, the human antibody in some embodiments contains a CDR-H2 having a sequence that is 100% identical or with no more than one, two or three amino acid difference as compared to the corresponding CDR-H2 region within a sequence encoded by a germline nucleotide human heavy chain V segment.
(106) In some embodiments, the human antibody or antigen-binding fragment thereof, contains a CDR-H3 having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence of the corresponding CDR-H3 region within a sequence encoded by a germline nucleotide human heavy chain V segment, D segment and J segment. For example, the human antibody in some embodiments contains a CDR-H3 having a sequence that is 100% identical or with no more than one, two or three amino acid differences as compared to the corresponding CDR-H3 region within a sequence encoded by a germline nucleotide human heavy chain V segment, D segment and J segment.
(107) In some embodiments, the human antibody or antigen-binding fragment thereof, contains a CDR-L1 having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence of the corresponding CDR-L1 region within a sequence encoded by a germline nucleotide human light chain V segment. For example, the human antibody in some embodiments contains a CDR-L1 having a sequence that is 100% identical or with no more than one, two or three amino acid differences as compared to the corresponding CDR-L1 region within a sequence encoded by a germline nucleotide human light chain V segment.
(108) In some embodiments, the human antibody or antigen-binding fragment thereof, contains a CDR-L2 having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence of the corresponding CDR-L2 region within a sequence encoded by a germline nucleotide human light chain V segment. For example, the human antibody in some embodiments contains a CDR-L2 having a sequence that is 100% identical or with no more than one, two or three amino acid difference as compared to the corresponding CDR-L2 region within a sequence encoded by a germline nucleotide human light chain V segment.
(109) In some embodiments, the human antibody or antigen-binding fragment thereof, contains a CDR-L3 having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence of the corresponding CDR-L3 region within a sequence encoded by a germline nucleotide human light chain V segment and J segment. For example, the human antibody in some embodiments contains a CDR-L3 having a sequence that is 100% identical or with no more than one, two or three amino acid differences as compared to the corresponding CDR-L3 region within a sequence encoded by a germline nucleotide human light chain V segment and J segment.
(110) In some embodiments, the human antibody or antigen-binding fragment thereof, contains a framework region that contains human germline gene segment sequences. For example, in some embodiments, the human antibody contains a V.sub.H region in which the framework region, e.g. FR1, FR2, FR3 and FR4, has at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a framework region encoded by a human germline antibody segment, such as a V segment and/or J segment. In some embodiments, the human antibody contains a V.sub.L region in which the framework region e.g. FR1, FR2, FR3 and FR4, has at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a framework region encoded by a human germline antibody segment, such as a V segment and/or J segment. For example, in some such embodiments, the framework region sequence contained within the V.sub.H region and/or V.sub.L region differs by no more than 10 amino acids, such as no more than 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid, compared to the framework region sequence encoded by a human germline antibody segment.
(111) The antibody or antigen-binding fragment thereof, may contain at least a portion of an immunoglobulin constant region, such as one or more constant region domain. In some embodiments, the constant regions include a light chain constant region and/or a heavy chain constant region 1 (CH1). In some embodiments, the antibody includes a CH2 and/or CH3 domain, such as an Fc region. In some embodiments, the Fc region is an Fc region of a human IgG, such as an IgG1 or IgG4.
(112) Also provided are nucleic acids, e.g., polynucleotides, encoding the antibodies and/or portions, e.g., chains, thereof. Among the provided nucleic acids are those encoding the anti-BCMA antibodies (e.g., antigen-binding fragment) described herein. Also provided are nucleic acids, e.g., polynucleotides, encoding one or more antibodies and/or portions thereof, e.g., those encoding one or more of the anti-BCMA antibodies (e.g., antigen-binding fragment) described herein and/or other antibodies and/or portions thereof, e.g., antibodies and/or portions thereof that binds other target antigens. The nucleic acids may include those encompassing natural and/or non-naturally occurring nucleotides and bases, e.g., including those with backbone modifications. The terms “nucleic acid molecule”, “nucleic acid” and “polynucleotide” may be used interchangeably, and refer to a polymer of nucleotides. Such polymers of nucleotides may contain natural and/or non-natural nucleotides, and include, but are not limited to, DNA, RNA, and PNA. “Nucleic acid sequence” refers to the linear sequence of nucleotides that comprise the nucleic acid molecule or polynucleotide.
(113) Also provided are vectors containing the nucleic acids, e.g., polynucleotides, and host cells containing the vectors, e.g., for producing the antibodies or antigen-binding fragments thereof. Also provided are methods for producing the antibodies or antigen-binding fragments thereof. The nucleic acid may encode an amino acid sequence comprising the V.sub.L region and/or an amino acid sequence comprising the V.sub.H region of the antibody (e.g., the light and/or heavy chains of the antibody). The nucleic acid may encode one or more amino acid sequence comprising the V.sub.L region and/or an amino acid sequence comprising the V.sub.H region of the antibody (e.g., the light and/or heavy chains of the antibody). In some embodiments, the nucleic acid, e.g., polynucleotide encodes one or more V.sub.H region and/or one or more V.sub.L region of the antibody, in any order or orientation. In some embodiments, the nucleic acid, e.g., polynucleotide encodes a V.sub.H region and a V.sub.L region, and the coding sequence for the V.sub.H region is upstream of the coding sequence for the V.sub.L region. In some embodiments, the nucleic acid, e.g., polynucleotide encodes a V.sub.H region and a V.sub.L region, and the coding sequence for the V.sub.L region is upstream of the coding sequence for the V.sub.H region.
(114) In a further embodiment, one or more vectors (e.g., expression vectors) comprising such nucleic acids are provided. In a further embodiment, a host cell comprising such nucleic acids is provided. In one such embodiment, a host cell comprises (e.g., has been transformed with) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the V.sub.H region of the antibody. In another such embodiment, a host cell comprises (e.g., has been transformed with) (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the V.sub.L region of the antibody and an amino acid sequence comprising the V.sub.H region of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the V.sub.L region of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the V.sub.H region of the antibody. In some embodiments, a host cell comprises (e.g., has been transformed with) one or more vectors comprising one or more nucleic acid that encodes one or more an amino acid sequence comprising one or more antibodies and/or portions thereof, e.g., antigen-binding fragments thereof. In some embodiments, one or more such host cells are provided. In some embodiments, a composition containing one or more such host cells are provided. In some embodiments, the one or more host cells can express different antibodies, or the same antibody. In some embodiments, each of the host cells can express more than one antibody.
(115) Also provided are methods of making the anti-BCMA antibodies (including antigen-binding fragments). For recombinant production of the anti-BCMA antibody, a nucleic acid sequence or a polynucleotide encoding an antibody, e.g., as described above, may be isolated and inserted into one or more vectors for further cloning and/or expression in a host cell. Such nucleic acid sequences may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody). In some embodiments, a method of making the anti-BCMA antibody is provided, wherein the method comprises culturing a host cell comprising a nucleic acid sequence encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
(116) In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been modified to mimic or approximate those in human cells, resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross, Nat. Biotech. 22:1409-1414 (2004), and Li et al., Nat. Biotech. 24:210-215 (2006).
(117) Exemplary eukaryotic cells that may be used to express polypeptides include, but are not limited to, COS cells, including COS 7 cells; 293 cells, including 293-6E cells; CHO cells, including CHO—S, DG44. Lec13 CHO cells, and FUT8 CHO cells; PER.C6® cells; and NSO cells. In some embodiments, the antibody heavy chains and/or light chains (e.g., V.sub.H region and/or V.sub.L region) may be expressed in yeast. See, e.g., U.S. Publication No. US 2006/0270045 A1. In some embodiments, a particular eukaryotic host cell is selected based on its ability to make desired post-translational modifications to the heavy chains and/or light chains (e.g., V.sub.H region and/or V.sub.L region). For example, in some embodiments, CHO cells produce polypeptides that have a higher level of sialylation than the same polypeptide produced in 293 cells.
(118) In some embodiments, the antibody or antigen-binding fragment provided herein is produced in a cell-free system. Exemplary cell-free systems are described, e.g., in Sitaraman et al., Methods Mol. Biol. 498: 229-44 (2009); Spirin, Trends Biotechnol. 22: 538-45 (2004); Endo et al., Biotechnol. Adv. 21: 695-713 (2003).
(119) The provided embodiments further include vectors and host cells and other expression systems for expressing and producing the antibodies and other antigen-binding proteins, including eukaryotic and prokaryotic host cells, including bacteria, filamentous fungi, and yeast, as well as mammalian cells such as human cells, as well as cell-free expression systems.
(120) b. Exemplary Features
(121) In some aspects, the provided antibodies or antigen-binding fragments thereof have one or more specified functional features, such as binding properties, including binding to particular epitopes.
(122) In some embodiments, the antibodies or antigen-binding fragments thereof specifically bind to BCMA protein. In some embodiments provided herein, BCMA protein refers to human BCMA, a mouse BCMA protein, or a non-human primate (e.g., cynomolgus monkey) BCMA protein. In some embodiments of any of the embodiments herein, BCMA protein refers to human BCMA protein. The observation that an antibody or other binding molecule binds to BCMA protein or specifically binds to BCMA protein does not necessarily mean that it binds to a BCMA protein of every species. For example, in some embodiments, features of binding to BCMA protein, such as the ability to specifically bind thereto and/or to bind with a particular affinity to a particular degree, in some embodiments, refers to the ability with respect to a human BCMA protein and the antibody may not have this feature with respect to a BCMA protein of another species, such as mouse.
(123) In some embodiments, the antibody or antigen-binding fragment binds to a mammalian BCMA protein, including to naturally occurring variants of BCMA, such as certain splice variants or allelic variants.
(124) In some embodiments, the antibodies specifically bind to human BCMA protein, such as to an epitope or region of human BCMA protein, such as the human BCMA protein comprising the amino acid sequence of SEQ ID NO:367 (GenBank No. BAB60895.1), or SEQ ID NO:368 (NCBI No. NP_001183.2) or an allelic variant or splice variant thereof. In one embodiment, the human BCMA protein is encoded by a transcript variant or is an isoform that has the sequence of amino acids forth in SEQ ID NO:369. In some embodiments, the antibodies bind to cynomolgus monkey BCMA protein, such as the cynomolgus monkey BCMA protein set forth in SEQ ID NO:371 (GenBank No. EHH60172.1). In some embodiments, the antibodies bind to human BCMA but do not bind to or bind in a lower level or degree or affinity to cynomolgus monkey BCMA protein, such as the cynomolgus monkey BCMA protein set forth in SEQ ID NO:371 (GenBank No. EHH60172.1). In some embodiments, the antibodies do not bind to or bind in a lower level or degree or affinity to mouse BCMA protein, such as the mouse BCMA protein set forth in SEQ ID NO:370 (NCBI No. NP_035738.1). In some embodiments, the antibodies bind to mouse BCMA protein, such as the mouse BCMA protein set forth in SEQ ID NO:370 (NCBI No. NP_035738.1). In some embodiments, the antibodies bind to mouse BCMA protein, with lower affinity than its binding to a human BCM protein and/or a cynomolgus monkey BCMA protein. In some embodiments, the antibodies bind to mouse BCMA protein and/or a cynomolgus monkey BCMA protein with lower affinity than its binding to a human BCM protein. In some embodiments, the antibodies bind to mouse BCMA protein and/or a cynomolgus monkey BCMA protein with similar binding affinity compared to its binding to a human BCMA protein.
(125) In one embodiment, the extent of binding of an anti-BCMA antibody to an unrelated, non-BCMA protein, such as a non-human BCMA protein or other non-BCMA protein, is less than at or about 10% of the binding of the antibody to human BCMA protein as measured, e.g., by a radioimmunoassay (RIA). In some embodiments, among provided antibodies are antibodies in which binding to mouse BCMA protein is less than or at or about 10% of the binding of the antibody to human BCMA protein. In some embodiments, among provided antibodies are antibodies in which binding to cynomolgus monkey BCMA protein is less than or at or about 10% of the binding of the antibody to human BCMA protein. In some embodiments, among provided antibodies are antibodies in which binding to cynomolgus monkey BCMA protein and/or a mouse BCMA protein is similar to or about the same as the binding of the antibody to human BCMA protein.
(126) In some embodiments, the antibody specifically binds to and/or to bind with a particular affinity to a particular degree, to a BCMA protein, e.g., human BCMA, a mouse BCMA protein, or a non-human primate (e.g., cynomolgus monkey) BCMA protein.
(127) In some embodiments, the provided antibodies are capable of binding BCMA protein, such as human BCMA protein, with at least a certain affinity, as measured by any of a number of known methods. In some embodiments, the affinity is represented by an equilibrium dissociation constant (K.sub.D); in some embodiments, the affinity is represented by EC.sub.50.
(128) A variety of assays are known for assessing binding affinity and/or determining whether a binding molecule (e.g., an antibody or fragment thereof) specifically binds to a particular ligand (e.g., an antigen, such as a BCMA protein). It is within the level of a skilled artisan to determine the binding affinity of a binding molecule, e.g., an antibody, for an antigen, e.g., BCMA, such as human BCMA or cynomolgus BCMA or mouse BCMA, such as by using any of a number of binding assays that are well known in the art. For example, in some embodiments, a BIAcore® instrument can be used to determine the binding kinetics and constants of a complex between two proteins (e.g., an antibody or fragment thereof, and an antigen, such as a BCMA protein), using surface plasmon resonance (SPR) analysis (see, e.g., Scatchard et al., Ann. N.Y. Acad. Sci. 51:660, 1949; Wilson, Science 295:2103, 2002; Wolff et al., Cancer Res. 53:2560, 1993; and U.S. Pat. Nos. 5,283,173, 5,468,614, or the equivalent).
(129) SPR measures changes in the concentration of molecules at a sensor surface as molecules bind to or dissociate from the surface. The change in the SPR signal is directly proportional to the change in mass concentration close to the surface, thereby allowing measurement of binding kinetics between two molecules. The dissociation constant for the complex can be determined by monitoring changes in the refractive index with respect to time as buffer is passed over the chip. Other suitable assays for measuring the binding of one protein to another include, for example, immunoassays such as enzyme linked immunosorbent assays (ELISA) and radioimmunoassays (RIA), or determination of binding by monitoring the change in the spectroscopic or optical properties of the proteins through fluorescence, UV absorption, circular dichroism, or nuclear magnetic resonance (NMR). Other exemplary assays include, but are not limited to, Western blot, ELISA, analytical ultracentrifugation, spectroscopy, flow cytometry, sequencing and other methods for detection of expressed nucleic acids or binding of proteins.
(130) In some embodiments, the binding molecule, e.g., antibody or fragment thereof, binds, such as specifically binds, to an antigen, e.g., a BCMA protein or an epitope therein, with an affinity or K.sub.A (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M; equal to the ratio of the on-rate [k.sub.on or k.sub.a] to the off-rate [k.sub.off or k.sub.d] for this association reaction, assuming bimolecular interaction) equal to or greater than 10.sup.5 M.sup.−1. In some embodiments, the antibody or fragment thereof exhibits a binding affinity for the peptide epitope with a K.sub.D (i.e., an equilibrium dissociation constant of a particular binding interaction with units of M; equal to the ratio of the off-rate [k.sub.off or k.sub.d] to the on-rate [k.sub.on or k.sub.a] for this association reaction, assuming bimolecular interaction) of equal to or less than 10.sup.−5 M. For example, the equilibrium dissociation constant K.sub.D ranges from 10.sup.−5 M to 10.sup.−13 M, such as 10.sup.−7 M to 10.sup.−11 M, 10.sup.−8 M to 10.sup.−10 M, or 10.sup.−9 M to 10.sup.−10 M. The on-rate (association rate constant; k.sub.on or k.sub.a; units of 1/Ms) and the off-rate (dissociation rate constant; k.sub.off or k.sub.d; units of 1/s) can be determined using any of the assay methods known in the art, for example, surface plasmon resonance (SPR).
(131) In some embodiments, the binding affinity (EC.sub.50) and/or the dissociation constant of the antibody (e.g. antigen-binding fragment) to about BCMA protein, such as human BCMA protein, is from or from about 0.01 nM to about 500 nM, from or from about 0.01 nM to about 400 nM, from or from about 0.01 nM to about 100 nM, from or from about 0.01 nM to about 50 nM, from or from about 0.01 nM to about 10 nM, from or from about 0.01 nM to about 1 nM, from or from about 0.01 nM to about 0.1 nM, is from or from about 0.1 nM to about 500 nM, from or from about 0.1 nM to about 400 nM, from or from about 0.1 nM to about 100 nM, from or from about 0.1 nM to about 50 nM, from or from about 0.1 nM to about 10 nM, from or from about 0.1 nM to about 1 nM, from or from about 0.5 nM to about 200 nM, from or from about 1 nM to about 500 nM, from or from about 1 nM to about 100 nM, from or from about 1 nM to about 50 nM, from or from about 1 nM to about 10 nM, from or from about 2 nM to about 50 nM, from or from about 10 nM to about 500 nM, from or from about 10 nM to about 100 nM, from or from about 10 nM to about 50 nM, from or from about 50 nM to about 500 nM, from or from about 50 nM to about 100 nM or from or from about 100 nM to about 500 nM. In certain embodiments, the binding affinity (EC.sub.50) and/or the equilibrium dissociation constant, K.sub.D, of the antibody to a BCMA protein, such as human BCMA protein, is at or less than or about 400 nM, 300 nM, 200 nM, 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 19 nM, 18 nM, 17 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM or less. In some embodiments, the antibodies bind to a BCMA protein, such as human BCMA protein, with a sub-nanomolar binding affinity, for example, with a binding affinity less than about 1 nM, such as less than about 0.9 nM, about 0.8 nM, about 0.7 nM, about 0.6 nM, about 0.5 nM, about 0.4 nM, about 0.3 nM, about 0.2 nM or about 0.1 nM or less.
(132) In some embodiments, the binding affinity may be classified as high affinity or as low affinity. In some cases, the binding molecule (e.g. antibody or fragment thereof) that exhibits low to moderate affinity binding exhibits a K.sub.A of up to 10.sup.7 M.sup.−1, up to 10.sup.6 M.sup.−1, up to 10.sup.5 M. In some cases, a binding molecule (e.g. antibody or fragment thereof) that exhibits high affinity binding to a particular epitope interacts with such epitope with a K.sub.A of at least 10.sup.7 M.sup.−1, at least 10.sup.8 M.sup.−1, at least 10.sup.9 M.sup.−1, at least 10.sup.10 M.sup.−1, at least 10.sup.11 M.sup.−1, at least 10.sup.12 M.sup.−1, or at least 10.sup.13 M. In some embodiments, the binding affinity (EC.sub.50) and/or the equilibrium dissociation constant, K.sub.D, of the binding molecule, e.g., anti-BCMA antibody or fragment thereof, to a BCMA protein, is from or from about 0.01 nM to about 1 μM, 0.1 nM to 1 μM, 1 nM to 1 μM, 1 nM to 500 nM, 1 nM to 100 nM, 1 nM to 50 nM, 1 nM to 10 nM, 10 nM to 500 nM, 10 nM to 100 nM, 10 nM to 50 nM, 50 nM to 500 nM, 50 nM to 100 nM or 100 nM to 500 nM. In certain embodiments, the binding affinity (EC.sub.50) and/or the dissociation constant of the equilibrium dissociation constant, K.sub.D, of the binding molecule, e.g., anti-BCMA antibody or fragment thereof, to a BCMA protein, is at or about or less than at or about 1 μM, 500 nM, 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 19 nM, 18 nM, 17 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM or less.
(133) In some embodiments, the binding affinity of a binding molecule, such as an anti-BCMA antibody, for different antigens, e.g., BCMA proteins from different species can be compared to determine the species cross-reactivity. For example, species cross-reactivity can be classified as high cross reactivity or low cross reactivity. In some embodiments, the equilibrium dissociation constant, K.sub.D, for different antigens, e.g., BCMA proteins from different species such as human, cynomolgus monkey or mouse, can be compared to determine species cross-reactivity. In some embodiments, the species cross-reactivity of an anti-BCMA antibody can be high, e.g., the anti-BCMA antibody binds to human BCMA and a species variant BCMA to a similar degree, e.g., the ratio of K.sub.D for human BCMA and K.sub.D for the species variant BCMA is or is about 1. In some embodiments, the species cross-reactivity of an anti-BCMA antibody can be low, e.g., the anti-BCMA antibody has a high affinity for human BCMA but a low affinity for a species variant BCMA, or vice versa. For example, the ratio of K.sub.D for the species variant BCMA and K.sub.D for the human BCMA is more than 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 200, 500, 1000, 2000 or more, and the anti-BCMA antibody has low species cross-reactivity. The degree of species cross-reactivity can be compared with the species cross-reactivity of a known antibody.
(134) In some embodiments, the provided antibodies or antigen binding fragments thereof bind to a similar degree to a human BCMA protein and a non-human BCMA protein or other non-BCMA proteins. For example, in some embodiments, the provided antibodies or antigen binding fragments thereof bind to a human BCMA protein, such as the human BCMA protein comprising the amino acid sequence of SEQ ID NO:367 (GenBank No. BAB60895.1), or SEQ ID NO:368 (NCBI No. NP_001183.2) or an allelic variant or splice variant thereof, with an equilibrium dissociation constant (K.sub.D), and to a non-human BCMA, such as a cynomolgus monkey BCMA, such as the cynomolgus monkey BCMA protein set forth in SEQ ID NO:371 (GenBank No. EHH60172.1), with a K.sub.D that is similar, or about the same, or less than 2-fold different, or less than 5-fold different.
(135) For example, in some embodiments, the provided antibodies or antigen binding fragments thereof bind to a human BCMA with a K.sub.D of about or less than at or about 1 μM, 500 nM, 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 19 nM, 18 nM, 17 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM or less, and binds to a cynomolgus monkey BCMA with a K.sub.D of about or less than at or about 1 μM, 500 nM, 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 19 nM, 18 nM, 17 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM or less. In some embodiments, the provided antibodies or antigen binding fragments thereof bind to a mouse BCMA protein with a K.sub.D of about or less than at or about 1 μM, 500 nM, 100 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 19 nM, 18 nM, 17 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, or 1 nM or less. In some embodiments, the provided antibodies or antigen binding fragments thereof bind to a human BCMA, a cynomolgus monkey BCMA and a mouse BCMA with high affinity. In some embodiments, the provided antibodies or antigen binding fragments thereof bind to a human BCMA and cynomolgus monkey BCMA with a high affinity, and to a mouse BCMA with low affinity. In some embodiments, the provided antibodies or antigen binding fragments thereof bind to a human BCMA and BCMA from other species, or other variants of the BCMA protein, with high affinity.
(136) In some embodiments, the total binding capacity (R.sub.max), as measured using particular surface plasmon resonance (SPR) conditions, is used to determine the ability or capacity of binding of the provided antibody or antigen binding fragment thereof, to the antigen, e.g., a BCMA protein, such as a human BCMA protein. For SPR analysis, the “ligand” is the immobilized target molecule on the surface of the sensor, for example, a BCMA protein, and the “analyte” is the tested molecule, e.g., antibody, for binding to the “ligand”. For example, the “analyte” can be any of the provided antibodies or antigen binding fragments thereof that binds to a BCMA protein. For a particular ligand and analyte pair in SPR, the R.sub.max can be determined assuming a 1:1 binding stoichiometry model, for a particular condition. In some embodiments, binding capacity (R.sub.max) can be determined using the following formula: R.sub.max (RU)=(analyte molecular weight)/(ligand molecular weight)×immobilized ligand level (RU). In particular aspects of SPR conditions, the R.sub.max of binding between any of the provided antibody or antigen binding fragment thereof and a BCMA protein, such as a human BCMA or a cynomolgus BCMA, is at least or at least about 50 resonance units (RU), such as about 25 RU, 20 RU, 15 RU, 10 RU, 5 RU or 1 RU.
(137) In some embodiments, the antibodies or antigen-binding fragment thereof, such as the human antibodies, specifically bind to a particular epitope or region of BCMA protein, such as generally an extracellular epitope or region. BCMA protein is a type III membrane 184 amino acid protein that contains an extracellular domain, a transmembrane domain, and a cytoplasmic domain. With reference to a human BCMA amino acid sequence set forth in SEQ ID NO:367, the extracellular domain corresponds to amino acids 1-54, amino acids 55-77 correspond to the transmembrane domain, and amino acids 78-184 correspond to the cytoplasmic domain.
(138) In some embodiments, the antibodies or antigen-binding fragment thereof, binds, e.g., specifically binds, and/or recognizes, one or more epitopes in BCMA, e.g., human BCMA. In some embodiments, the epitopes are epitopes present on the extracellular domain of BCMA, e.g., human BCMA. In some embodiments, the epitopes include peptide epitopes. In some embodiments, the epitope includes linear epitopes and/or conformational epitopes or combination thereof. In some embodiments, the epitope(s) on BCMA, that the antibody or antigen-binding fragment thereof, e.g., anti-BCMA antibody or antigen-binding fragment thereof provided herein, include conformational epitopes, e.g., epitopes that include several peptide stretches from BCMA. In some embodiments, the anti-BCMA antibodies or antigen-binding fragment thereof provided herein bind to or recognize one or a combination of .sub.21CIPCQLR.sub.27 (set forth in SEQ ID NO:375), .sub.30SNTPPLTCQR.sub.39 (set forth in SEQ ID NO:379) and .sub.44SVTNSVK.sub.50 (set forth in SEQ ID NO:393). In some embodiments, the epitope of comprises .sub.30SNTPPLTCQR.sub.39 (SEQ ID NO:379) and/or .sub.44SVTNSVK.sub.50 (SEQ ID NO:393). In some embodiments, the anti-BCMA antibodies or antigen-binding fragment thereof provided herein bind to or recognize .sub.30SNTPPLTCQR.sub.39 (set forth in SEQ ID NO:379). In some embodiments, the anti-BCMA antibodies or antigen-binding fragment thereof provided herein bind to or recognize one or a combination of .sub.8CSQNEYF.sub.14 (set forth in SEQ ID NO:410) and .sub.17LLHACIPCQLR.sub.27 (set forth in SEQ ID NO:428). In some embodiments, the epitope comprises .sub.17LLHACIPCQLR.sub.27 (SEQ ID NO:428).
(139) In some embodiments, the antibody or antigen-binding fragment binds to one or more epitope(s) of a human BCMA protein selected from among .sub.21CIPCQLR.sub.27 (SEQ ID NO:375), .sub.30SNTPPLTCQR.sub.39 (SEQ ID NO:379) and .sub.44SVTNSVK.sub.50 (SEQ ID NO:393), but does not include a V.sub.H region comprising a heavy chain complementarity determining region 1 (CDR-H1), CDR-H2, and/or CDR-H3, respectively, comprising the amino acid sequence of SEQ ID NOs:496, 507 and/or 513, respectively, and/or the antibody or antigen-binding fragment does not comprise a V.sub.L region comprising a light chain complementarity determining region 1 (CDR-L1), CDR-L2, and/or CDR-L3, respectively, comprising the amino acid sequence of SEQ ID NOs:517, 532 and/or 551; or does include an antibody or antigen-binding fragment thereof that comprises a V.sub.H region containing the amino acid sequence set forth in SEQ ID NO:577 or an amino acid sequence that has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology thereto, and/or a V.sub.L region containing the amino acid sequence set forth in SEQ ID NO:587 or an amino acid sequence that has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology thereto.
(140) In some embodiments, the antibody or antigen-binding fragment binds to one or more epitope(s) of a human BCMA protein selected from among .sub.8CSQNEYF.sub.14 (SEQ ID NO:410) and .sub.17LLHACIPCQLR.sub.27 (SEQ ID NO:428), but does not comprise a V.sub.H region comprising a heavy chain complementarity determining region 1 (CDR-H1), CDR-H2, and/or CDR-H3, respectively, comprising the amino acid sequence of SEQ ID NOs:496, 507 and/or 513, respectively, and/or the antibody or antigen-binding fragment does not comprise a V.sub.L region comprising a light chain complementarity determining region 1 (CDR-L1), CDR-L2, and/or CDR-L3, respectively, comprising the amino acid sequence of SEQ ID NOs:517, 532 and/or 551; or does include an antibody or antigen-binding fragment thereof that comprises a V.sub.H region containing the amino acid sequence set forth in SEQ ID NO:577 or an amino acid sequence that has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology thereto, and/or a V.sub.L region containing the amino acid sequence set forth in SEQ ID NO:587 or an amino acid sequence that has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology thereto.
(141) In some embodiments, the antibody or antigen-binding fragment does not comprise a V.sub.H region comprising a heavy chain complementarity determining region 1 (CDR-H1), CDR-H2, and/or CDR-H3, respectively, comprising the amino acid sequence of SEQ ID NOs:496, 507 and/or 513, respectively, and/or the antibody or antigen-binding fragment does not comprise a V.sub.L region comprising a light chain complementarity determining region 1 (CDR-L1), CDR-L2, and/or CDR-L3, respectively, comprising the amino acid sequence of SEQ ID NOs:517, 532 and/or 551; or does include an antibody or antigen-binding fragment thereof that comprises a V.sub.H region containing the amino acid sequence set forth in SEQ ID NO:577 or an amino acid sequence that has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology thereto, and/or a V.sub.L region containing the amino acid sequence set forth in SEQ ID NO:587 or an amino acid sequence that has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology thereto.
(142) In some embodiments, the antibody or antigen-binding fragment does not comprise a V.sub.H region comprising a heavy chain complementarity determining region 1 (CDR-H1), CDR-H2, and/or CDR-H3, respectively, comprising the amino acid sequence of SEQ ID NOs:588, 589 and/or 590, respectively, and/or the antibody or antigen-binding fragment does not comprise a V.sub.L region comprising a light chain complementarity determining region 1 (CDR-L1), CDR-L2, and/or CDR-L3, respectively, comprising the amino acid sequence of SEQ ID NOs:591, 592 and/or 593; or does include an antibody or antigen-binding fragment thereof that comprises a V.sub.H region containing the amino acid sequence set forth in SEQ ID NO:594 or an amino acid sequence that has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology thereto, and/or a V.sub.L region containing the amino acid sequence set forth in SEQ ID NO:595 or an amino acid sequence that has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology thereto.
(143) In some embodiments, the provided antibody or antigen-binding fragment thereof binds to the epitope of a human BCMA protein comprising .sub.30SNTPPLTCQR.sub.39 (SEQ ID NO:379) and/or .sub.44SVTNSVK.sub.50 (SEQ ID NO:393). For example, in some embodiments, the antibody or antigen-binding fragment thereof comprises a heavy chain complementarity determining region 3 (CDR-H3) comprising the amino acid sequence selected from any one of SEQ ID NOs: 7 and 157, or a CDR-H3 contained within the heavy chain variable (V.sub.H) region amino acid sequence selected from any one of SEQ ID NOs:110, 256 and 519, and/or a light chain complementarity determining region 3 (CDR-L3) comprising the amino acid sequence selected from any one of SEQ ID NOs: 47, 51, 194 and 416, or a CDR-L3 contained within the light chain variable (V.sub.L) region amino acid sequence selected from any one of SEQ ID NOs: 116, 120, 267 and 535. In some embodiments, the antibody or antigen-binding fragment thereof further comprises a heavy chain complementarity determining region 1 (CDR-H1) comprising the amino acid sequence selected from any one of SEQ ID NOs: 1 and 2, or a CDR-H1 contained within the heavy chain variable (V.sub.H) region amino acid sequence selected from any one of SEQ ID NOs:110, 256 and 519, and/or a light chain complementarity determining region 1 (CDR-L1) comprising the amino acid sequence selected from any one of SEQ ID NOs: 26, 30, 178 and 380, or a CDR-L1 contained within the light chain variable (V.sub.L) region amino acid sequence selected from any one of SEQ ID NOs: 116, 120, 267 and 535; a heavy chain complementarity determining region 2 (CDR-H2) comprising the amino acid sequence selected from any one of SEQ ID NOs: 4 or 5, or a CDR-H2 contained within the heavy chain variable (V.sub.H) region amino acid sequence selected from any one of SEQ ID NOs:110, 256 and 519, and/or a light chain complementarity determining region 2 (CDR-L2) comprising the amino acid sequence selected from any one of SEQ ID NOs: 37, 39, 183 or 400, or a CDR-L2 contained within the light chain variable (V.sub.L) region amino acid sequence selected from any one of SEQ ID NOs: 116, 120, 267 and 535. For example, in some embodiments, the antibody or antigen-binding fragment comprises a V.sub.H region comprising a CDR-H1, a CDR-H2, and a CDR-H3, respectively, comprising the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 110, 256 and 519; and/or a V.sub.L region comprising a CDR-L1, a CDR-L2, and a CDR-L3, respectively, comprising the amino acid sequence of a CDR-L1, a CDR-L2, and a CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs: 116, 120, 267 and 535.
(144) In some embodiments, the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 116, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 120, respectively; the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:256 and 267, respectively; or the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 535, respectively, or an amino acid sequence that has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto, respectively.
(145) In some embodiments, the antibody or antigen-binding fragment binds to the epitope of a human BCMA protein comprising .sub.17LLHACIPCQLR.sub.27 (SEQ ID NO:428). For example, in some embodiments, antibody or antigen-binding fragment comprises a heavy chain complementarity determining region 3 (CDR-H3) comprising the amino acid sequence of SEQ ID NO:10, or a CDR-H3 contained within the heavy chain variable (V.sub.H) region amino acid sequence of SEQ ID NO:115, and/or a light chain complementarity determining region 3 (CDR-L3) comprising the amino acid sequence of SEQ ID NO:421, or a CDR-L3 contained within the light chain variable (V.sub.L) region amino acid sequence of SEQ ID NO:536. In some embodiments, the antibody or antigen-binding fragment further comprises: a heavy chain complementarity determining region 1 (CDR-H1) comprising the amino acid sequence of SEQ ID NO:2, or a CDR-H1 contained within the heavy chain variable (V.sub.H) region amino acid sequence of SEQ ID NO:115 and/or a light chain complementarity determining region 1 (CDR-L1) comprising the amino acid sequence selected from any one of SEQ ID NOs: 33, or a CDR-L1 contained within the light chain variable (V.sub.L) region amino acid sequence selected from any one of SEQ ID NOs:536; and/or a heavy chain complementarity determining region 2 (CDR-H2) comprising the amino acid sequence of SEQ ID NO:5, or a CDR-H1 contained within the heavy chain variable (V.sub.H) region amino acid sequence of SEQ ID NO:115 and/or a light chain complementarity determining region 2 (CDR-L2) comprising the amino acid sequence selected from any one of SEQ ID NOs:43, or a CDR-L1 contained within the light chain variable (V.sub.L) region amino acid sequence selected from any one of SEQ ID NOs:536. In some embodiments, antibody or antigen-binding fragment comprises a V.sub.H region comprising a CDR-H1, a CDR-H2, and a CDR-H3, respectively, comprising the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:115; and/or a V.sub.L region comprising a CDR-L1, a CDR-L2, and a CDR-L3, respectively, comprising the amino acid sequence of a CDR-L1, a CDR-L2, and a CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:536.
(146) In some embodiments, the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:115 and 536, respectively, or an amino acid sequence that has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto, respectively.
(147) In some embodiments, properties or features of the provided antibodies (e.g., antigen-binding fragments) are described in relation to properties observed for another antibody, e.g., a reference antibody. In some embodiments, the reference antibody is a non-human anti-BCMA antibody, such as a murine or chimeric or humanized anti-BCMA antibody. In some aspects, the reference antibody is the murine antibody designated C11D5.3 or A7D12.2 (see, e.g., International PCT Pub. No. WO2010/104949), and/or a fragment derived therefrom such as an scFv fragment thereof, and/or an antibody containing the V.sub.H and V.sub.L regions of such an antibody and/or the heavy and light chain CDRs of such an antibody. A chimeric antigen receptor (CAR) containing an antigen-binding scFv fragment of C11D5.3 has been demonstrated to effectively promote antitumor reactivity in a CAR therapy (Carpenter et al., Clin Cancer Res., 2013, 19(8):2048-2060).
(148) For example, in some embodiments, the reference antibody has a V.sub.H region containing the amino acid sequence set forth in SEQ ID NO:324, or comprises CDR-H1, CDR-H2, and/or CDR-H3 within such a sequence, and/or has a V.sub.L region containing the amino acid sequence set forth in SEQ ID NO:326, or comprises CDR-L1, CDR-L2, and/or CDR-L3 within such a sequence. For example, the reference antibody can be an antibody that contains a CDR-H1 sequence of DYSIN (SEQ ID NO:288), a CDR-H2 sequence of WINTETREPAYAYDFRG (SEQ ID NO:290), a CDR-H3 sequence of DYSYAMDY (SEQ ID NO:292), a CDR-L1 sequence of RASESVTILGSHLIH (SEQ ID NO:302), a CDR-L2 sequence of LASNVQT (SEQ ID NO:304) and/or a CDR-L3 sequence of LQSRTIPRT (SEQ ID NO:306). In some embodiments, the reference antibody is an scFv that comprises the sequence of amino acids set forth in SEQ ID NO:328 or 585. In some embodiments, the reference antibody has a V.sub.H region containing the amino acid sequence set forth in SEQ ID NO:325, or comprises CDR-H1, CDR-H2, and/or CDR-H3 within such a sequence, and/or has a V.sub.L region containing the amino acid sequence set forth in SEQ ID NO:327, or comprises CDR-L1, CDR-L2, and/or CDR-L3 within such a sequence. For example, the reference antibody can be an antibody that contains a CDR-H1 sequence of NFGMN (SEQ ID NO:289), a CDR-H2 sequence of WINTYTGESYFADDFKG (SEQ ID NO:291), a CDR-H3 sequence of GEIYYGYDGGFAY (SEQ ID NO:293), a CDR-L1 sequence of RASQDVNTAVS (SEQ ID NO:303), a CDR-L2 sequence of SASYRYT (SEQ ID NO:305) and/or a CDR-L3 sequence of QQHYSTPWT (SEQ ID NO:307). In some embodiments, the reference antibody is an scFv that comprises the sequence of amino acids set forth in SEQ ID NO:329 or 586.
(149) In some embodiments, the provided antibody (e.g., antigen-binding fragment) contains heavy and light chain CDRs that are distinct from the CDRs present in the reference antibody or antibodies. In some embodiments, the provided antibody contains heavy and light chain CDRs that are distinct from the CDRs present in the V.sub.H region amino acid sequence set forth in SEQ ID NO:324 and/or the V.sub.L region amino acid sequence set forth in SEQ ID NO:326. In some embodiments, the provided antibody contains heavy and light chain CDRs that are distinct from the CDRs present in the V.sub.H region amino acid sequence set forth in SEQ ID NO:325 and/or the V.sub.L region amino acid sequence set forth in SEQ ID NO:327.
(150) In some embodiments, the provided the antibodies or antigen-binding fragment thereof, binds, e.g., specifically binds, and/or recognizes, one or more epitopes in BCMA, e.g., human BCMA but do not comprise a V.sub.H region comprising a heavy chain complementarity determining region 1 (CDR-H1), CDR-H2, or CDR-H3, respectively, comprising the amino acid sequence of SEQ ID NOs:496, 507 or 513, respectively, and/or the antibody or antigen-binding fragment do not comprise a V.sub.L region comprising a light chain complementarity determining region 1 (CDR-L1), CDR-L2, or CDR-L3, respectively, comprising the amino acid sequence of SEQ ID NOs:517, 532 or 551. In some embodiments, the provided the antibodies or antigen-binding fragment thereof, binds, e.g., specifically binds, and/or recognizes, one or more epitopes in BCMA, e.g., human BCMA but do not comprise a V.sub.H region comprising a heavy chain complementarity determining region 1 (CDR-H1), CDR-H2, or CDR-H3, respectively, comprising the amino acid sequence of SEQ ID NOs:588, 589 or 590, respectively, and/or the antibody or antigen-binding fragment do not comprise a V.sub.L region comprising a light chain complementarity determining region 1 (CDR-L1), CDR-L2, or CDR-L3, respectively, comprising the amino acid sequence of SEQ ID NOs:588, 589 or 590. In some embodiments, the antibody or antigen-binding fragment thereof contains a distinct V.sub.H region and/or V.sub.L region from an antibody or antigen-binding fragment thereof comprising a V.sub.H region and a V.sub.L region amino acid sequence set forth in SEQ ID NOS: 577 and 587, respectively, or SEQ ID NOS: 594 and 595, respectively.
(151) In some embodiments, the antibody or antigen-binding fragment does not comprise CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2 and/or CDR-L3 sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to the CDR-H1, CDR-H2, CDR-H3 and/or CDR-L1, CDR-L2, CDR-L3 sequences contained within an antibody comprising the amino acid sequence of SEQ ID NOs:328, 329, 585 and/or 586.
(152) Among the provided antibodies (e.g., antigen-binding fragments) are those that compete for binding with and/or bind to the same or overlapping epitopes of BCMA protein as those bound by a reference antibody described herein but nonetheless contain distinct CDRs, e.g., distinct heavy and/or light chain CDR1, CDR2, and CDR3.
(153) Among the provided antibodies (e.g., antigen-binding fragments) are those that do not compete for binding with and/or bind to a distinct epitope of BCMA protein as those bound by a reference antibody described herein.
(154) In some embodiments, the reference antibody has a sequence present in an antibody or portion thereof as described herein, such as any of the provided exemplary antibodies. For example, in some embodiments, the reference antibody contains a CDR-H1 comprising the amino acid sequence selected from any one of SEQ ID NOs:1-3 and 140-144; a CDR-H2 comprising the amino acid sequence selected from any one of SEQ ID NOs:4-6, 145-148 and 372-374; a CDR-H3 comprising the amino acid sequence selected from any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378; a CDR-L1 comprising the amino acid sequence selected from any one of SEQ ID NOs:26-36, 174-178, 380-392 and 394-398; CDR-L2 comprising the amino acid sequence selected from any one of SEQ ID NOs:37-46, 179-183, 399-409 and 411-414; and/or a CDR-L3 comprising the amino acid sequence selected from any one of SEQ ID NOs:47-58, 184-194, 415-427 and 429-433. For example, in some embodiments, the reference antibody has a V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557 and/or has a V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533. In some such embodiments, the antibody has heavy and/or light chain CDRs 1, 2, and/or 3 as present in such an antibody.
(155) In some embodiments, the antibodies (e.g., antigen-binding fragment) display a binding preference for BCMA-expressing cells as compared to BCMA-negative cells, such as particular cells known and/or described herein to express BCMA and known not to express BCMA. In some embodiments, the binding preference is observed where a significantly greater degree of binding is measured to the BCMA-expressing, as compared to the non-expressing cells. In some embodiments, the fold change in degree of binding detected, for example, as measured by mean fluorescence intensity in a flow cytometry-based assay and/or dissociation constant or EC.sub.50, to the BCMA-expressing cells as compared to the non-BCMA-expressing cells, is at least at or about 1.5, 2, 3, 4, 5, 6, or more, and/or is about as great, about the same, at least as great or at least about as great, or greater, than the fold change observed for the corresponding form of the reference antibody. In some cases, the total degree of observed binding to BCMA or to the BCMA-expressing cells is approximately the same, at least as great as, or greater than that observed for the corresponding form of the reference antibody.
(156) In some embodiments, the antibody (e.g., antigen-binding fragment) specifically binds to an epitope that overlaps with the epitope of BCMA protein bound by a reference antibody. In some aspects, among such antibodies are antibodies that bind to the same or a similar epitope as the reference antibody. In some embodiments, two antibodies specifically bind to the same epitope and/or an overlapping epitope if all or essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other antibody.
(157) In some embodiments, the antibody (e.g., antigen-binding fragment) specifically binds to an epitope that does not overlap with the epitope of BCMA protein bound by a reference antibody. In some aspects, among such antibodies are antibodies that bind to a different epitope as the reference antibody. In some embodiments, two antibodies specifically bind to the different epitope if all or essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody do not reduce or eliminate binding of the other antibody.
(158) An antibody “competes for binding” to BCMA protein with a reference antibody if it competitively inhibits binding of the reference antibody to BCMA protein, and/or if the reference antibody competitively inhibits binding of the antibody to BCMA protein. An antibody competitively inhibits binding of a reference antibody to an antigen if the presence of the antibody in excess detectably inhibits (blocks) binding of the other antibody to its antigen. A particular degree of inhibition may be specified.
(159) Competitive inhibition assays are known and include ELISA-based, flow cytometry-based assays, and RIA-based assays. In some aspects, competitive inhibition assays are carried out by incorporating an excess of an unlabeled form of one of the antibodies and assessing its ability to block binding of the other antibody, which is labeled with a detectable marker, such that degree of binding and reduction thereof can be assessed by detection of the label or marker. In some examples, competitive binding can be measured using assays for molecular interaction and binding kinetics, such as surface plasmon resonance analysis.
(160) Anti-BCMA antibodies (e.g., antigen-binding fragments) provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various known assays. In one aspect, the antibody is tested for its antigen binding activity, e.g., by known methods such as ELISA, Western blotting, and/or flow cytometric assays, including cell-based binding assays, for example, assessing binding of the antibody (e.g., conjugated to a fluorescent marker or tagged) to a cell expressing the target antigen, e.g., BCMA, in some cases compared to results using cells that do not express the target antigen, e.g., BCMA. Binding affinity may be measured as K.sub.D or EC.sub.50. In some examples, binding affinity, binding kinetics, and/or binding constants can be measured using assays to determine molecular interaction, such as surface plasmon resonance analysis.
(161) Competition assays may be used to identify an antibody that competes with any of the antibodies (e.g., antigen-binding fragments) described herein. Assays for mapping epitopes bound by the antibodies and reference antibodies also may be used and are known.
(162) c. Immunoconjugates
(163) In some embodiments, the antibody (e.g., antigen-binding fragment) is or is part of an immunoconjugate, in which the antibody is conjugated to one or more heterologous molecule(s) or moiety, such as, but not limited to, a cytotoxic or an imaging agent. Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At.sup.211, I.sup.131, I.sup.125, Y.sup.90, Re.sup.186, Re.sup.188, Sm.sup.153, Bi.sup.212, P.sup.32, Pb.sup.212 and radioactive isotopes of Lu); chemotherapeutic agents (e.g., methotrexate, adriamycin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins. In some embodiments, the antibody is conjugated to one or more cytotoxic agents, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments), or radioactive isotopes.
(164) Among the immunoconjugates are antibody-drug conjugates (ADCs), in which an antibody is conjugated to one or more drugs, including but not limited to a maytansinoid (see U.S. Pat. Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235 B1); an auristatin such as monomethyl auristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Pat. Nos. 5,635,483 and 5,780,588, and 7,498,298); a dolastatin; a calicheamicin or derivative thereof (see U.S. Pat. Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701, 5,770,710, 5,773,001, and 5,877,296; Hinman et al., Cancer Res. 53:3336-3342 (1993); and Lode et al., Cancer Res. 58:2925-2928 (1998)); an anthracycline such as daunomycin or doxorubicin (see Kratz et al., Current Med. Chem. 13:477-523 (2006); Jeffrey et al., Bioorganic & Med. Chem. Letters 16:358-362 (2006); Torgov et al., Bioconj. Chem. 16:717-721 (2005); Nagy et al., Proc. Natl. Acad. Sci. USA 97:829-834 (2000); Dubowchik et al., Bioorg. & Med. Chem. Letters 12:1529-1532 (2002); King et al., J. Med. Chem. 45:4336-4343 (2002); and U.S. Pat. No. 6,630,579); methotrexate; vindesine; a taxane such as docetaxel, paclitaxel, larotaxel, tesetaxel, and ortataxel; a trichothecene; and CC1065.
(165) Also among the immunoconjugates are those in which the antibody (e.g., antigen-binding fragment) is conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
(166) Also among the immunoconjugates are those in which the antibody (e.g., antigen-binding fragment) is conjugated to a radioactive atom to form a radioconjugate. Exemplary radioactive isotopes include At.sup.211, I.sup.131, I.sup.125, Y.sup.90, Re.sup.186, Re.sup.188, Sm.sup.153, Bi.sup.212, P.sup.32, Pb.sup.212 and radioactive isotopes of Lu.
(167) Conjugates of an antibody (e.g., antigen-binding fragment) and cytotoxic agent may be made using any of a number of known protein coupling agents, e.g., linkers, (see Vitetta et al., Science 238:1098 (1987), WO94/11026). In some embodiments, the linker is a peptide or a polypeptide or is a chemical linker. In some embodiments, the linker is a releasable linker or a cleavable linker. The linker may be a “cleavable linker” or a “releasable linker” facilitating release of a cytotoxic drug in the cell, such as acid-labile linkers, peptidase-sensitive linkers, photolabile linkers, dimethyl linkers, and disulfide-containing linkers (Chari et al., Cancer Res. 52:127-131 (1992); U.S. Pat. No. 5,208,020). In some embodiments, the releasable linker or the cleavable linker is released or cleaved in the presence of one or more conditions or factors present in the tumor microenvironment (TME), including includes matrix metalloproteinase (MMP), hypoxic conditions or acidic conditions.
(168) d. Multispecific Antibodies
(169) In certain embodiments, the BCMA-binding molecules, e.g., antibodies or polypeptides such as chimeric receptors containing the same, are multispecific. Among the multispecific binding molecules are multispecific antibodies, including, e.g. bispecific or trispecific antibodies. Multispecific binding partners, e.g., antibodies, have binding specificities for at least two different sites, which may be in the same or different antigens. In certain embodiments, one of the binding specificities is for BCMA and the other is for another antigen. In some embodiments, additional binding molecules bind to and/or recognize a third, or more antigens. In certain embodiments, bispecific antibodies may bind to two different epitopes of BCMA. Bispecific antibodies may also be used to localize cytotoxic agents to cells which express BCMA. Bispecific antibodies can be prepared as full length antibodies or antibody fragments. Among the multispecific antibodies are multispecific single-chain antibodies, e.g., diabodies, triabodies, and tetrabodies, tandem di-scFvs, and tandem tri-scFvs. Also provided are multispecific chimeric receptors, such as multispecific CARs, containing the antibodies (e.g., antigen-binding fragments). Also provided are multispecific cells containing the antibodies or polypeptides including the same, such as cells containing a cell surface protein including the anti-BCMA antibody and an additional cell surface protein, such as an additional chimeric receptor, which binds to a different antigen or a different epitope on BCMA.
(170) Exemplary antigens include B cell specific antigens, other tumor-specific antigens, such as antigens expressed specifically on or associated with a leukemia (e.g., B cell leukemia), lymphoma (e.g., Hodgkin's lymphoma, non-Hodgkin's lymphoma, etc.), or a myeloma, e.g., a multiple myeloma (MM), a plasma cell malignancy (e.g., plasmacytoma). For example, antigens include those expressed specifically on or associated with B cell chronic lymphocytic leukemia (CLL), a diffuse large B-cell lymphoma (DLBCL), acute myeloid leukemia (AML), acute lymphocytic leukemia (ALL), Burkitt's lymphoma (e.g., endemic Burkitt's lymphoma or sporadic Burkitt's lymphoma), mantle cell lymphoma (MCL), non-small cell lung cancer (NSCLC), chronic myeloid (or myelogenous) leukemia (CML), hairy cell leukemia (HCL), small lymphocytic lymphoma (SLL), Marginal zone lymphoma, Hodgkin lymphoma (HL), non-Hodgkin lymphoma (NHL), Anaplastic large cell lymphoma (ALCL), refractory follicular lymphoma, Waldenstrom macroglobulinemia, follicular lymphoma, small non-cleaved cell lymphoma, mucosa-associated lymphatic tissue lymphoma (MALT), marginal zone lymphoma, nodal monocytoid B cell lymphoma, immunoblastic lymphoma, large cell lymphoma, diffuse mixed cell lymphoma, pulmonary B cell angiocentric lymphoma, small lymphocytic lymphoma, primary mediastinal B cell lymphoma, lymphoplasmacytic lymphoma (LPL), neuroblastoma, renal cell carcinoma, colon cancer, colorectal cancer, breast cancer, epithelial squamous cell cancer, melanoma, myeloma such as multiple myeloma (e.g., non-secretory multiple myeloma, smoldering multiple myeloma), stomach cancer, esophageal cancer, brain cancer, lung cancer (e.g., small-cell lung cancer), pancreatic cancer, cervical cancer, ovarian cancer, liver cancer (e.g., hepatic carcinoma, hepatoma, etc.), bladder cancer, prostate cancer, testicular cancer, thyroid cancer, uterine cancer, spleen cancer (e.g., splenic lymphoma), adrenal cancer and/or head and neck cancer, and antigens expressed on T cells.
(171) In some embodiments, among the second or additional antigens for multi-targeting strategies includes those in which at least one of the antigens is a universal tumor antigen, or a family member thereof. In some embodiments, the second or additional antigen is an antigen expressed on a tumor. In some embodiments, the BCMA-binding molecules provided herein target an antigen on the same tumor type as the second or additional antigen. In some embodiments, the second or additional antigen may also be a universal tumor antigen or may be a tumor antigen specific to a tumor type.
(172) Exemplary second or additional antigens include CD4, CD5, CD8, CD14, CD15, CD19, CD20, CD21, CD22, CD23, CD25, CD33, CD37, CD38, CD40, CD40L, CD46, CD52, CD54, CD74, CD80, CD126, CD138, B7, MUC-1, Ia, HM1.24, HLA-DR, tenascin, an angiogenesis factor, VEGF, PIGF, ED-B fibronectin, an oncogene, an oncogene product, CD66a-d, necrosis antigens, Ii, IL-2, T101, TAC, IL-6, ROR1, TRAIL-R1 (DR4), TRAIL-R2 (DR5), tEGFR, Her2, L1-CAM, mesothelin, CEA, hepatitis B surface antigen, anti-folate receptor, CD24, CD30, CD44, EGFR, EGP-2, EGP-4, EPHa2, ErbB2, ErbB3, ErbB4, erbB dimers, EGFR vIII, FBP, FCRL5, FCRH5, fetal acetylcholine receptor, GD2, GD3, G protein-coupled receptor class C group 5 member D (GPRC5D), HMW-MAA, IL-22R-alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, L1-cell adhesion molecule (L1-CAM), Melanoma-associated antigen (MAGE)-A1, MAGE-A3, MAGE-A6, Preferentially expressed antigen of melanoma (PRAME), survivin, EGP2, EGP40, TAG72, B7-H6, IL-13 receptor a2 (IL-13Ra2), CA9, CD171, G250/CAIX, HLA-AI MAGE A1, HLA-A2 NY-ESO-1, PSCA, folate receptor-a, CD44v6, CD44v7/8, avb6 integrin, 8H9, NCAM, VEGF receptors, 5T4, Foetal AchR, NKG2D ligands, dual antigen, an antigen associated with a universal tag, a cancer-testes antigen, MUC1, MUC16, NY-ESO-1, MART-1, gp100, oncofetal antigen, VEGF-R2, carcinoembryonic antigen (CEA), prostate specific antigen, PSMA, Her2/neu, estrogen receptor, progesterone receptor, ephrinB2, CD123, c-Met, GD-2, O-acetylated GD2 (OGD2), CE7, Wilms Tumor 1 (WT-1), a cyclin, cyclin A2, CCL-1, hTERT, MDM2, CYP1B, WT1, livin, AFP, p53, cyclin (D1), CS-1, BAFF-R, TACI, CD56, TIM-3, CD123, L1-cell adhesion molecule, MAGE-A1, MAGE A3, a cyclin, such as cyclin A1 (CCNA1) and/or a pathogen-specific antigen, biotinylated molecules, molecules expressed by HIV, HCV, HBV and/or other pathogens, and/or in some aspects, neoepitopes or neoantigens thereof. In some embodiments, the antigen is associated with or is a universal tag.
(173) In some aspects, the antigen, e.g., the second or additional antigen, such as the disease-specific antigen and/or related antigen, is expressed on multiple myeloma, such as G protein-coupled receptor class C group 5 member D (GPRC5D), CD38 (cyclic ADP ribose hydrolase), CD138 (syndecan-1, syndecan, SYN-1), CS-1 (CS1, CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24), BAFF-R, TACI and/or FcRH5. Other exemplary multiple myeloma antigens include CD56, TIM-3, CD33, CD123, CD44, CD20, CD40, CD74, CD200, EGFR, β2-Microglobulin, HM1.24, IGF-1R, IL-6R, TRAIL-R1, and the activin receptor type IIA (ActRIIA). See Benson and Byrd, J. Clin. Oncol. (2012) 30(16): 2013-15; Tao and Anderson, Bone Marrow Research (2011):924058; Chu et al., Leukemia (2013) 28(4):917-27; Garfall et al., Discov Med. (2014) 17(91):37-46. In some embodiments, the antigens include those present on lymphoid tumors, myeloma, AIDS-associated lymphoma, and/or post-transplant lymphoproliferations, such as CD38. Antibodies or antigen-binding fragments directed against such antigens are known and include, for example, those described in U.S. Pat. Nos. 8,153,765; 8,603,477, 8,008,450; U.S. Pub. No. US20120189622 or US20100260748; and/or International PCT Publication Nos. WO2006099875, WO2009080829 or WO2012092612 or WO2014210064. In some embodiments, such antibodies or antigen-binding fragments thereof (e.g. scFv) are contained in multispecific antibodies, multispecific chimeric receptors, such as multispecific CARs, and/or multispecific cells.
(174) e. Variants
(175) In certain embodiments, the antibodies (e.g., antigen-binding fragment) include one or more amino acid variations, e.g., substitutions, deletions, insertions, and/or mutations, compared to the sequence of an antibody described herein. Exemplary variants include those designed to improve the binding affinity and/or other biological properties of the antibody. Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen-binding.
(176) In certain embodiments, the antibodies (e.g. antigen-binding fragment) include one or more amino acid substitutions, e.g., as compared to an antibody sequence described herein and/or compared to a sequence of a natural repertoire, e.g., human repertoire. Sites of interest for substitutional mutagenesis include the CDRs and FRs. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, improved half-life, and/or improved effector function, such as the ability to promote antibody-dependent cellular cytotoxicity (ADCC) or complement-dependent cytotoxicity (CDC).
(177) In some embodiments, one or more residues within a CDR of a parent antibody (e.g. a humanized or human antibody) is/are substituted. In some embodiments, the substitution is made to revert a sequence or position in the sequence to a germline sequence, such as an antibody sequence found in the germline (e.g., human germline), for example, to reduce the likelihood of immunogenicity, e.g., upon administration to a human subject.
(178) In some embodiments, alterations are made in CDR “hotspots,” residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207:179-196 (2008)), and/or residues that contact antigen, with the resulting variant V.sub.H or V.sub.L being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., (2001)). In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves CDR-directed approaches, in which several CDR residues (e.g., 4-6 residues at a time) are randomized. CDR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.
(179) In certain embodiments, substitutions, insertions, or deletions may occur within one or more CDRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in CDRs. Such alterations may, for example, be outside of antigen contacting residues in the CDRs. In certain embodiments of the variant V.sub.H region and V.sub.L region sequences provided above, each CDR either is unaltered, or contains no more than one, two or three amino acid substitutions.
(180) Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme or a polypeptide which increases the serum half-life of the antibody.
(181) f. Modifications
(182) In certain embodiments, the antibody is altered to increase or decrease the extent to which the antibody is glycosylated, for example, by removing or inserting one or more glycosylation sites by altering the amino acid sequence and/or by modifying the oligosaccharide(s) attached to the glycosylation sites, e.g., using certain cell lines. In some embodiments, an N-linked glycosylation, which is a glycosylation site that occurs at asparagines in the consensus sequence -Asn-Xaa-Ser/Thr is removed or inserted.
(183) Exemplary modifications, variants, and cell lines are described, e.g., in Patent Publication Nos. US 2003/0157108, US 2004/0093621, US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 A1, Presta, L; and WO 2004/056312 A1, Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107); WO 2003/011878 (Jean-Mairet et al.); U.S. Pat. No. 6,602,684 (Umana et al.); and US 2005/0123546 (Umana et al.); WO 1997/30087 (Patel et al.); WO 1998/58964 (Raju, S.); and WO 1999/22764 (Raju, S.).
(184) Among the modified antibodies are those having one or more amino acid modifications in the Fc region, such as those having a human Fc region sequence or other portion of a constant region (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
(185) Such modifications can be made, e.g., to improve half-life, alter binding to one or more types of Fc receptors, and/or alter effector functions.
(186) Also among the variants are cysteine engineered antibodies such as “thioMAbs” and other cysteine engineered variants, in which one or more residues of an antibody are substituted with cysteine residues, in order to generate reactive thiol groups at accessible sites, e.g., for use in conjugation of agents and linker-agents, to produce immunoconjugates. Cysteine engineered antibodies are described, e.g., in U.S. Pat. Nos. 7,855,275 and 7,521,541.
(187) In some embodiments, the antibodies (e.g., antigen-binding fragment) are modified to contain additional nonproteinaceous moieties, including water soluble polymers. Exemplary polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinylpyrrolidone, poly-1, 3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyamino acids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone) polyethylene glycol, polypropylene glycol homopolymers, polypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer is attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
(188) B. Recombinant Receptors
(189) Also among the binding molecules are polypeptides containing any such antibodies or antigen-binding fragments provided herein, including single chain cell surface proteins, e.g., recombinant receptors, such as chimeric antigen receptors containing such antibodies or antigen-binding fragments. Among the provided binding molecules (e.g., BCMA-binding molecules) are single chain cell surface proteins, such as recombinant receptors (e.g., antigen receptors), that include one of the provided antibodies (e.g., antigen-binding fragment). The recombinant receptors include antigen receptors that specifically bind to BCMA, such as antigen receptors containing the provided anti-BCMA antibodies, e.g., antigen-binding fragments. Among the antigen receptors are functional non-TCR antigen receptors, such as chimeric antigen receptors (CARs). Also provided are cells expressing the recombinant receptors and uses thereof in adoptive cell therapy, such as treatment of diseases and disorders associated with BCMA expression.
(190) Exemplary antigen receptors, including CARs, and methods for engineering and introducing such antigen receptors into cells, include those described, for example, in international patent application publication Nos. WO200014257, WO2013126726, WO2012/129514, WO2014031687, WO2013/166321, WO2013/071154, WO2013/123061 U.S. patent application publication Nos. US2002131960, US2013287748, US20130149337, U.S. Pat. Nos. 6,451,995, 7,446,190, 8,252,592, 8,339,645, 8,398,282, 7,446,179, 6,410,319, 7,070,995, 7,265,209, 7,354,762, 7,446,191, 8,324,353, and 8,479,118, and European patent application No. EP2537416, and/or those described by Sadelain et al., Cancer Discov. 2013 April; 3(4): 388-398; Davila et al. (2013) PLoS ONE 8(4): e61338; Turtle et al., Curr. Opin. Immunol., 2012 October; 24(5): 633-39; Wu et al., Cancer, 2012 Mar. 18(2): 160-75. In some aspects, the antigen receptors include a CAR as described in U.S. Pat. No. 7,446,190, and those described in International Patent Application Publication No. WO/2014055668 A1. Exemplary CARs include CARs as disclosed in any of the aforementioned publications, such as WO2014031687, U.S. Pat. Nos. 8,339,645, 7,446,179, US 2013/0149337, U.S. Pat. Nos. 7,446,190, 8,389,282, e.g., and in which the antigen-binding portion, e.g., scFv, is replaced by an antibody or an antigen-binding fragment thereof, e.g., as provided herein.
(191) Among the chimeric receptors are chimeric antigen receptors (CARs). The chimeric receptors, such as CARs, generally include an extracellular antigen binding domain that includes, is, or is comprised within, one of the provided anti-BCMA antibodies. Thus, the chimeric receptors, e.g., CARs, typically include in their extracellular portions one or more BCMA-binding molecules, such as one or more antigen-binding fragment, domain, or portion, or one or more antibody variable regions, and/or antibody molecules, such as those described herein. In some embodiments, the CAR includes a BCMA-binding portion or portions of the antibody molecule, such as a heavy chain variable (V.sub.H) region and/or light chain variable (V.sub.L) region of the antibody, e.g., an scFv antibody fragment.
(192) BCMA-targeting CARs are described, for example, by Carpenter et al., Clin Cancer Res., 2013, 19(8):2048-2060.
(193) In some embodiments, the recombinant receptor such as a CAR comprising an antibody (e.g., antigen-binding fragment) provided herein, further includes a spacer, which may be or include at least a portion of an immunoglobulin constant region or variant or modified version thereof, such as a hinge region, e.g., an IgG4 hinge region, and/or a CH1/CL and/or Fc region. In some embodiments, the constant region or portion is of a human IgG, such as IgG4 or IgG1. In some aspects, the portion of the constant region serves as a spacer region between the antigen-recognition component (e.g., scFv) and transmembrane domain. The spacer can be of a length that provides for increased responsiveness of the cell following antigen binding, as compared to in the absence of the spacer. In some examples, the spacer is at or about 12 amino acids in length or is no more than 12 amino acids in length. Exemplary spacers include those having at least about 10 to 229 amino acids, about 10 to 200 amino acids, about 10 to 175 amino acids, about 10 to 150 amino acids, about 10 to 125 amino acids, about 10 to 100 amino acids, about 10 to 75 amino acids, about 10 to 50 amino acids, about 10 to 40 amino acids, about 10 to 30 amino acids, about 10 to 20 amino acids, or about 10 to 15 amino acids, and including any integer between the endpoints of any of the listed ranges. In some embodiments, a spacer region has about 12 amino acids or less, about 119 amino acids or less, or about 229 amino acids or less. Exemplary spacers include IgG4 hinge alone, IgG4 hinge linked to CH2 and CH3 domains, or IgG4 hinge linked to the CH3 domain. Exemplary spacers include, but are not limited to, those described in Hudecek et al. (2013) Clin. Cancer Res., 19:3153 or international patent application publication number WO2014031687. In some embodiments, the spacer has the sequence set forth in SEQ ID NO:363, and is encoded by the sequence set forth in SEQ ID NO:364. In some embodiments, the spacer has the sequence set forth in SEQ ID NO:365. In some embodiments, the spacer has the sequence set forth in SEQ ID NO:366.
(194) The antigen-recognition component generally is linked to one or more intracellular signaling components, such as signaling components that mimic activation through an antigen receptor complex, such as a TCR complex, in the case of a CAR, and/or signal via another cell surface receptor. Thus, in some embodiments, the BCMA-binding molecule (e.g., antibody or antigen binding fragment thereof) is linked to one or more transmembrane domains such as those described herein and intracellular signaling domains comprising one or more intracellular components such as those described herein. In some embodiments, the transmembrane domain is fused to the extracellular domain. In one embodiment, a transmembrane domain that naturally is associated with one of the domains in the receptor, e.g., CAR, is used. In some instances, the transmembrane domain is selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
(195) The transmembrane domain in some embodiments is derived either from a natural or from a synthetic source. Where the source is natural, the domain in some aspects is derived from any membrane-bound or transmembrane protein. Transmembrane domains include those derived from (i.e. comprise at least the transmembrane domain(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD3 epsilon, CD4, CD5, CD8, CD9, CD16, CD22, CD28, CD33, CD37, CD45, CD64, CD80, CD86, CD134, CD137, and/or CD154. Alternatively the transmembrane domain in some embodiments is synthetic. In some aspects, the synthetic transmembrane domain comprises predominantly hydrophobic residues such as leucine and valine. In some aspects, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain. In some embodiments, the linkage is by linkers, spacers, and/or transmembrane domain(s).
(196) Among the intracellular signaling domains are those that mimic or approximate a signal through a natural antigen receptor, a signal through such a receptor in combination with a costimulatory receptor, and/or a signal through a costimulatory receptor alone. In some embodiments, a short oligo- or polypeptide linker, for example, a linker of between 2 and 10 amino acids in length, such as one containing glycines and serines, e.g., glycine-serine doublet, is present and forms a linkage between the transmembrane domain and the intracellular signaling domain of the CAR.
(197) The receptor, e.g., the CAR, generally includes an intracellular signaling domain comprising at least one intracellular signaling component or components. In some embodiments, the receptor includes an intracellular component of a TCR complex, such as a TCR CD3 chain that mediates T-cell activation and cytotoxicity, e.g., CD3 zeta chain. Thus, in some aspects, the BCMA-binding antibody is linked to one or more cell signaling modules. In some embodiments, cell signaling modules include CD3 transmembrane domain, CD3 intracellular signaling domains, and/or other CD transmembrane domains. In some embodiments, the receptor, e.g., CAR, further includes a portion of one or more additional molecules such as Fc receptor γ, CD8, CD4, CD25, or CD16. For example, in some aspects, the CAR includes a chimeric molecule between CD3-zeta (CD3-ζ) or Fc receptor γ and CD8, CD4, CD25 or CD16.
(198) In some embodiments, upon ligation of the CAR, the cytoplasmic domain or intracellular signaling domain of the CAR activates at least one of the normal effector functions or responses of the immune cell, e.g., T cell engineered to express the CAR. For example, in some contexts, the CAR induces a function of a T cell such as cytolytic activity or T-helper activity, such as secretion of cytokines or other factors. In some embodiments, a truncated portion of an intracellular signaling domain of an antigen receptor component or costimulatory molecule is used in place of an intact immunostimulatory chain, for example, if it transduces the effector function signal. In some embodiments, the intracellular signaling domain or domains include the cytoplasmic sequences of the T cell receptor (TCR), and in some aspects also those of co-receptors that in the natural context act in concert with such receptor to initiate signal transduction following antigen receptor engagement, and/or any derivative or variant of such molecules, and/or any synthetic sequence that has the same functional capability.
(199) In the context of a natural TCR, full activation generally requires not only signaling through the TCR, but also a costimulatory signal. Thus, in some embodiments, to promote full activation, a component for generating secondary or co-stimulatory signal is also included in the CAR. In other embodiments, the CAR does not include a component for generating a costimulatory signal. In some aspects, an additional CAR is expressed in the same cell and provides the component for generating the secondary or costimulatory signal.
(200) T cell activation is in some aspects described as being mediated by two classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences), and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences). In some aspects, the CAR includes one or both of such classes of cytoplasmic signaling sequences.
(201) In some aspects, the CAR includes a primary cytoplasmic signaling sequence that regulates primary activation of the TCR complex. Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs. Examples of ITAM containing primary cytoplasmic signaling sequences include those derived from TCR or CD3 zeta, FcR gamma, CD3 gamma, CD3 delta and CD3 epsilon. In some embodiments, the intracellular signaling domain in the CAR contain(s) a cytoplasmic signaling domain, portion thereof, or sequence derived from CD3 zeta.
(202) In some embodiments, the CAR includes a signaling domain (e.g., an intracellular signaling domain) and/or transmembrane portion of a costimulatory molecule, such as a T cell costimulatory molecule. Exemplary costimulatory molecules include CD28, 4-1BB, OX40, DAP10, and ICOS. In some aspects, the same CAR includes both the activating or stimulatory components (e.g., cytoplasmic signaling sequence) and costimulatory components.
(203) In some embodiments, the activating or stimulatory components are included within one CAR, whereas the costimulatory component is provided by another CAR recognizing another antigen. In some embodiments, the CARs include activating or stimulatory CARs, and costimulatory CARs, both expressed on the same cell (see WO2014/055668). In some aspects, the BCMA-targeting CAR is the stimulatory or activating CAR; in other aspects, it is the costimulatory CAR. In some embodiments, the cells further include inhibitory CARs (iCARs, see Fedorov et al., Sci. Transl. Medicine, 5(215) (December, 2013), such as a CAR recognizing an antigen other than BCMA, whereby an activating or stimulatory signal delivered through the BCMA-targeting CAR is diminished or inhibited by binding of the inhibitory CAR to its ligand, e.g., to reduce off-target effects.
(204) In certain embodiments, the intracellular signaling domain comprises a CD28 transmembrane and signaling domain linked to a CD3 (e.g., CD3-zeta) intracellular domain. In some embodiments, the intracellular signaling domain comprises a chimeric CD28 and CD137 (4-1BB, TNFRSF9) co-stimulatory domains, linked to a CD3 zeta intracellular domain.
(205) In some embodiments, the CAR encompasses one or more, e.g., two or more, costimulatory domains and an activation domain, e.g., primary activation domain, in the cytoplasmic portion. Exemplary CARs include intracellular components of CD3-zeta, CD28, and 4-1BB.
(206) In some embodiments, the nucleic acid sequences encoding a recombinant receptor, e.g., CAR, further includes a nucleic acid sequence encoding one or more marker(s). In some embodiments, the one or more marker(s) is a transduction marker, surrogate marker and/or a selection marker.
(207) In some embodiments, the marker is a transduction marker or a surrogate marker. A transduction marker or a surrogate marker can be used to detect cells that have been introduced with the polynucleotide, e.g., a polynucleotide encoding a recombinant receptor. In some embodiments, the transduction marker can indicate or confirm modification of a cell. In some embodiments, the surrogate marker is a protein that is made to be co-expressed on the cell surface with the recombinant receptor, e.g. CAR. In particular embodiments, such a surrogate marker is a surface protein that has been modified to have little or no activity. In certain embodiments, the surrogate marker is encoded on the same polynucleotide that encodes the recombinant receptor. In some embodiments, the nucleic acid sequence encoding the recombinant receptor is operably linked to a nucleic acid sequence encoding a marker, optionally separated by an internal ribosome entry site (IRES), or a nucleic acid encoding a self-cleaving peptide or a peptide that causes ribosome skipping, such as a 2A sequence, such as a T2A, a P2A, a E2A or a F2A. Extrinsic marker genes may in some cases be utilized in connection with engineered cell to permit detection or selection of cells and, in some cases, also to promote cell suicide.
(208) Exemplary surrogate markers can include truncated cell surface polypeptides, such as a truncated human epidermal growth factor receptor 2 (tHER2), a truncated epidermal growth factor receptor (EGFRt, exemplary EGFRt sequence set forth in SEQ ID NO:11 or 76) or a prostate-specific membrane antigen (PSMA) or modified form thereof. EGFRt may contain an epitope recognized by the antibody cetuximab (Erbitux®) or other therapeutic anti-EGFR antibody or binding molecule, which can be used to identify or select cells that have been engineered with the EGFRt construct and a recombinant receptor, such as a chimeric antigen receptor (CAR), and/or to eliminate or separate cells expressing the receptor. See U.S. Pat. No. 8,802,374 and Liu et al., Nature Biotech. 2016 April; 34(4): 430-434). In some aspects, the marker, e.g. surrogate marker, includes all or part (e.g., truncated form) of CD34, a NGFR, or epidermal growth factor receptor (e.g., tEGFR). In some embodiments, the nucleic acid encoding the marker is operably linked to a polynucleotide encoding for a linker sequence, such as a cleavable linker sequence, e.g., T2A. For example, a marker, and optionally a linker sequence, can be any as disclosed in PCT Pub. No. WO2014031687. For example, the marker can be a truncated EGFR (tEGFR) that is, optionally, linked to a linker sequence, such as a T2A cleavable linker sequence. An exemplary polypeptide for a truncated EGFR (e.g. tEGFR) comprises the sequence of amino acids set forth in SEQ ID NO: 602 or 603 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 602 or 603.
(209) In some embodiments, the marker is or comprises a fluorescent protein, such as green fluorescent protein (GFP), enhanced green fluorescent protein (EGFP), such as super-fold GFP, red fluorescent protein (RFP), such as tdTomato, mCherry, mStrawberry, AsRed2, DsRed or DsRed2, cyan fluorescent protein (CFP), blue green fluorescent protein (BFP), enhanced blue fluorescent protein (EBFP), and yellow fluorescent protein (YFP), and variants thereof, including species variants, monomeric variants, and codon-optimized and/or enhanced variants of the fluorescent proteins. In some embodiments, the marker is or comprises an enzyme, such as a luciferase, the lacZ gene from E. coli, alkaline phosphatase, secreted embryonic alkaline phosphatase (SEAP), chloramphenicol acetyl transferase (CAT). Exemplary light-emitting reporter genes include luciferase (luc), β-galactosidase, chloramphenicol acetyltransferase (CAT), β-glucuronidase (GUS) or variants thereof.
(210) In some embodiments, the marker is a selection marker. In some embodiments, the selection marker is or comprises a polypeptide that confers resistance to exogenous agents or drugs. In some embodiments, the selection marker is an antibiotic resistance gene. In some embodiments, the selection marker is an antibiotic resistance gene confers antibiotic resistance to a mammalian cell. In some embodiments, the selection marker is or comprises a Puromycin resistance gene, a Hygromycin resistance gene, a Blasticidin resistance gene, a Neomycin resistance gene, a Geneticin resistance gene or a Zeocin resistance gene or a modified form thereof.
(211) In some embodiments, the marker is a molecule, e.g., cell surface protein, not naturally found on T cells or not naturally found on the surface of T cells, or a portion thereof.
(212) In some embodiments, the molecule is a non-self molecule, e.g., non-self protein, i.e., one that is not recognized as “self” by the immune system of the host into which the cells will be adoptively transferred.
(213) In some embodiments, the marker serves no therapeutic function and/or produces no effect other than to be used as a marker for genetic engineering, e.g., for selecting cells successfully engineered. In other embodiments, the marker may be a therapeutic molecule or molecule otherwise exerting some desired effect, such as a ligand for a cell to be encountered in vivo, such as a costimulatory or immune checkpoint molecule to enhance and/or dampen responses of the cells upon adoptive transfer and encounter with ligand.
(214) In some cases, CARs are referred to as first, second, and/or third generation CARs. In some aspects, a first generation CAR is one that solely provides a CD3-chain induced signal upon antigen binding; in some aspects, a second-generation CARs is one that provides such a signal and costimulatory signal, such as one including an intracellular signaling domain from a costimulatory receptor such as CD28 or CD137; in some aspects, a third generation CAR in some aspects is one that includes multiple costimulatory domains of different costimulatory receptors.
(215) In some embodiments, the chimeric antigen receptor includes an extracellular portion containing the antibody or fragment described herein. In some aspects, the chimeric antigen receptor includes an extracellular portion containing the antibody or fragment described herein and an intracellular signaling domain. In some embodiments, the antibody or fragment includes an scFv or a single-domain antibody comprising only the V.sub.H region and the intracellular signaling domain contains an ITAM. In some aspects, the intracellular signaling domain includes a signaling domain of a zeta chain of a CD3-zeta (CD3ζ) chain. In some embodiments, the chimeric antigen receptor includes a transmembrane domain linking the extracellular domain and the intracellular signaling domain. In some aspects, the transmembrane domain contains a transmembrane portion of CD28. The extracellular domain and transmembrane can be linked directly or indirectly. In some embodiments, the extracellular domain and transmembrane are linked by a spacer, such as any described herein. In some embodiments, the chimeric antigen receptor contains an intracellular domain of a co-stimulatory molecule (e.g., T cell costimulatory molecule), such as between the transmembrane domain and intracellular signaling domain. In some aspects, the T cell costimulatory molecule is CD28 or 4-1BB.
(216) In some embodiments, the transmembrane domain of the receptor (e.g., CAR) is a transmembrane domain of human CD28 or variant thereof, e.g., a 27-amino acid transmembrane domain of a human CD28 (Accession No.: P10747.1). In some embodiments, the intracellular signaling domain comprises an intracellular costimulatory signaling domain of human CD28 or functional variant thereof, such as a 41 amino acid domain thereof and/or such a domain with an LL to GG substitution at positions 186-187 of a native CD28 protein. In some embodiments, the intracellular domain comprises an intracellular costimulatory signaling domain of 4-1BB or functional variant thereof, such as a 42-amino acid cytoplasmic domain of a human 4-1BB (Accession No. Q07011.1). In some embodiments, the intracellular signaling domain comprises a human CD3 zeta stimulatory signaling domain or functional variant thereof, such as an 112 AA cytoplasmic domain of isoform 3 of human CD3 (Accession No.: P20963.2) or a CD3 zeta signaling domain as described in U.S. Pat. No. 7,446,190.
(217) In some aspects, the spacer contains only a hinge region of an IgG, such as only a hinge of IgG4 or IgG1, such as the hinge only spacer set forth in SEQ ID NO:363. In other embodiments, the spacer is an Ig hinge, e.g., and IgG4 hinge, linked to a CH2 and/or CH3 domains. In some embodiments, the spacer is an Ig hinge, e.g., an IgG4 hinge, linked to CH2 and CH3 domains, such as set forth in SEQ ID NO:366. In some embodiments, the spacer is an Ig hinge, e.g., an IgG4 hinge, linked to a CH3 domain only, such as set forth in SEQ ID NO:365. In some embodiments, the spacer is or comprises a glycine-serine rich sequence or other flexible linker such as known flexible linkers.
(218) For example, in some embodiments, the CAR includes a BCMA antibody or fragment, such as any of the human BCMA antibodies, including sdAbs and scFvs, described herein, a spacer such as any of the Ig-hinge containing spacers, a CD28 transmembrane domain, a CD28 intracellular signaling domain, and a CD3 zeta signaling domain. In some embodiments, the CAR includes the BCMA antibody or fragment, such as any of the human BCMA antibodies, including sdAbs and scFvs described herein, a spacer such as any of the Ig-hinge containing spacers, a CD28 transmembrane domain, a 4-1BB intracellular signaling domain, and a CD3 zeta signaling domain. In some embodiments, such CAR constructs further includes a T2A ribosomal skip element and/or a tEGFR sequence, e.g., downstream of the CAR.
(219) In certain embodiments, multispecific binding molecules, e.g., multispecific chimeric receptors, such as multispecific CARs, can contain any of the multispecific antibodies, including, e.g. bispecific antibodies, multispecific single-chain antibodies, e.g., diabodies, triabodies, and tetrabodies, tandem di-scFvs, and tandem tri-scFvs, such as any described above in Section I.A.
(220) Also provided herein are single chain cell surface proteins comprising the scFv sequence selected from any of SEQ ID NOs:128-139, 268-278, 558-576 and 578-583. In some of any such embodiments, the scFv comprises the sequence selected from any of SEQ ID NOs:128, 132, 278 and 502. In some of any such embodiments, the scFv comprises the sequence of SEQ ID NO:560.
(221) C. Engineered Cells
(222) Also provided are cells such as engineered cells that contain a recombinant receptor (e.g., a chimeric antigen receptor) such as one that contains an extracellular domain including an anti-BCMA antibody or fragment as described herein. Also provided are populations of such cells, compositions containing such cells and/or enriched for such cells, such as in which cells expressing the BCMA-binding molecule make up at least 50, 60, 70, 80, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or more percent of the total cells in the composition or cells of a certain type such as T cells or CD8+ or CD4+ cells. Among the compositions are pharmaceutical compositions and formulations for administration, such as for adoptive cell therapy. Also provided are therapeutic methods for administering the cells and compositions to subjects, e.g., patients.
(223) Thus also provided are genetically engineered cells expressing the recombinant receptors containing the antibodies, e.g., cells containing the CARs. The cells generally are eukaryotic cells, such as mammalian cells, and typically are human cells. In some embodiments, the cells are derived from the blood, bone marrow, lymph, or lymphoid organs, are cells of the immune system, such as cells of the innate or adaptive immunity, e.g., myeloid or lymphoid cells, including lymphocytes, typically T cells and/or NK cells. Other exemplary cells include stem cells, such as multipotent and pluripotent stem cells, including induced pluripotent stem cells (iPSCs). The cells typically are primary cells, such as those isolated directly from a subject and/or isolated from a subject and frozen. In some embodiments, the cells include one or more subsets of T cells or other cell types, such as whole T cell populations, CD4+ cells, CD8+ cells, and subpopulations thereof, such as those defined by function, activation state, maturity, potential for differentiation, expansion, recirculation, localization, and/or persistence capacities, antigen-specificity, type of antigen receptor, presence in a particular organ or compartment, marker or cytokine secretion profile, and/or degree of differentiation. With reference to the subject to be treated, the cells may be allogeneic and/or autologous. Among the methods include off-the-shelf methods. In some aspects, such as for off-the-shelf technologies, the cells are pluripotent and/or multipotent, such as stem cells, such as induced pluripotent stem cells (iPSCs). In some embodiments, the methods include isolating cells from the subject, preparing, processing, culturing, and/or engineering them, as described herein, and re-introducing them into the same patient, before or after cryopreservation.
(224) Among the sub-types and subpopulations of T cells and/or of CD4+ and/or of CD8+ T cells are naïve T (T.sub.N) cells, effector T cells (T.sub.EFF), memory T cells and sub-types thereof, such as stem cell memory T (T.sub.SCM), central memory T (T.sub.CM), effector memory T (T.sub.EM), or terminally differentiated effector memory T cells, tumor-infiltrating lymphocytes (TIL), immature T cells, mature T cells, helper T cells, cytotoxic T cells, mucosa-associated invariant T (MAIT) cells, naturally occurring and adaptive regulatory T (Treg) cells, helper T cells, such as TH1 cells, TH2 cells, TH3 cells, TH17 cells, TH9 cells, TH22 cells, follicular helper T cells, alpha/beta T cells, and delta/gamma T cells.
(225) In some embodiments, the cells are natural killer (NK) cells. In some embodiments, the cells are monocytes or granulocytes, e.g., myeloid cells, macrophages, neutrophils, dendritic cells, mast cells, eosinophils, and/or basophils.
(226) In some embodiments, the cells include one or more nucleic acids introduced via genetic engineering, and thereby express recombinant or genetically engineered products of such nucleic acids. In some embodiments, the nucleic acids are heterologous, i.e., normally not present in a cell or sample obtained from the cell, such as one obtained from another organism or cell, which for example, is not ordinarily found in the cell being engineered and/or an organism from which such cell is derived. In some embodiments, the nucleic acids are not naturally occurring, such as a nucleic acid not found in nature, including one comprising chimeric combinations of nucleic acids encoding various domains from multiple different cell types. In some embodiments, the cells (e.g., engineered cells) comprise a vector (e.g., a viral vector, expression vector, etc.) as described herein such as a vector comprising a nucleic acid encoding a recombinant receptor described herein.
(227) a. Vectors and Methods for Genetic Engineering
(228) Also provided are methods, nucleic acids, compositions, and kits, for expressing the binding molecules (e.g., anti-BCMA binding molecules), including recombinant receptors (e.g., CARs) comprising the binding molecules, and for producing the genetically engineered cells expressing such binding molecules. In some embodiments, one or more binding molecules, including recombinant receptors (e.g., CARs) can be genetically engineered into cells or plurality of cells. The genetic engineering generally involves introduction of a nucleic acid encoding the recombinant or engineered component into the cell, such as by retroviral transduction, transfection, or transformation.
(229) In some embodiments, gene transfer is accomplished by first stimulating the cell, such as by combining it with a stimulus that induces a response such as proliferation, survival, and/or activation, e.g., as measured by expression of a cytokine or activation marker, followed by transduction of the activated cells, and expansion in culture to numbers sufficient for clinical applications.
(230) In some contexts, overexpression of a stimulatory factor (for example, a lymphokine or a cytokine) may be toxic to a subject. Thus, in some contexts, the engineered cells include gene segments that cause the cells to be susceptible to negative selection in vivo, such as upon administration in adoptive immunotherapy. For example in some aspects, the cells are engineered so that they can be eliminated as a result of a change in the in vivo condition of the patient to which they are administered. The negative selectable phenotype may result from the insertion of a gene that confers sensitivity to an administered agent, for example, a compound. Negative selectable genes include the Herpes simplex virus type I thymidine kinase (HSV-I TK) gene (Wigler et al., Cell 2:223, 1977) which confers ganciclovir sensitivity; the cellular hypoxanthine phosphoribosyltransferase (HPRT) gene, the cellular adenine phosphoribosyltransferase (APRT) gene, bacterial cytosine deaminase, (Mullen et al., Proc. Natl. Acad. Sci. USA. 89:33 (1992)).
(231) In some aspects, the cells further are engineered to promote expression of cytokines or other factors. Various methods for the introduction of genetically engineered components, e.g., antigen receptors, e.g., CARs, are well known and may be used with the provided methods and compositions. Exemplary methods include those for transfer of nucleic acids encoding the receptors, including via viral, e.g., retroviral or lentiviral, transduction, transposons, and electroporation.
(232) In some embodiments, recombinant nucleic acids are transferred into cells using recombinant infectious virus particles, such as, e.g., vectors derived from simian virus 40 (SV40), adenoviruses, adeno-associated virus (AAV). In some embodiments, recombinant nucleic acids are transferred into T cells using recombinant lentiviral vectors or retroviral vectors, such as gamma-retroviral vectors (see, e.g., Koste et al. (2014) Gene Therapy 2014 Apr. 3. doi: 10.1038/gt.2014.25; Carlens et al. (2000) Exp Hematol 28(10): 1137-46; Alonso-Camino et al. (2013) Mol Ther Nucl Acids 2, e93; Park et al., Trends Biotechnol. 2011 Nov. 29(11): 550-557).
(233) In some embodiments, the retroviral vector has a long terminal repeat sequence (LTR), e.g., a retroviral vector derived from the Moloney murine leukemia virus (MoMLV), myeloproliferative sarcoma virus (MPSV), murine embryonic stem cell virus (MESV), murine stem cell virus (MSCV), spleen focus forming virus (SFFV), human immunodeficiency virus type 1 (HIV-1) or adeno-associated virus (AAV). Most retroviral vectors are derived from murine retroviruses. In some embodiments, the retroviruses include those derived from any avian or mammalian cell source. The retroviruses typically are amphotropic, meaning that they are capable of infecting host cells of several species, including humans. In one embodiment, the gene to be expressed replaces the retroviral gag, pol and/or env sequences. A number of illustrative retroviral systems have been described (e.g., U.S. Pat. Nos. 5,219,740; 6,207,453; 5,219,740; Miller and Rosman (1989) BioTechniques 7:980-990; Miller, A. D. (1990) Human Gene Therapy 1:5-14; Scarpa et al. (1991) Virology 180:849-852; Burns et al. (1993) Proc. Natl. Acad. Sci. USA 90:8033-8037; and Boris-Lawrie and Temin (1993) Cur. Opin. Genet. Develop. 3:102-109.
(234) Methods of lentiviral transduction are known. Exemplary methods are described in, e.g., Wang et al. (2012) J. Immunother. 35(9): 689-701; Cooper et al. (2003) Blood. 101:1637-1644; Verhoeyen et al. (2009) Methods Mol Biol. 506: 97-114; and Cavalieri et al. (2003) Blood. 102(2): 497-505.
(235) In some embodiments, recombinant nucleic acids are transferred into T cells via electroporation (see, e.g., Chicaybam et al, (2013) PLoS ONE 8(3): e60298 and Van Tedeloo et al. (2000) Gene Therapy 7(16): 1431-1437). In some embodiments, recombinant nucleic acids are transferred into T cells via transposition (see, e.g., Manuri et al. (2010) Hum Gene Ther 21(4): 427-437; Sharma et al. (2013) Molec Ther Nucl Acids 2, e74; and Huang et al. (2009) Methods Mol Biol 506: 115-126). Other methods of introducing and expressing genetic material in immune cells include calcium phosphate transfection (e.g., as described in Current Protocols in Molecular Biology, John Wiley & Sons, New York. N.Y.), protoplast fusion, cationic liposome-mediated transfection; tungsten particle-facilitated microparticle bombardment (Johnston, Nature, 346: 776-777 (1990)); and strontium phosphate DNA co-precipitation (Brash et al., Mol. Cell Biol., 7: 2031-2034 (1987)).
(236) Other approaches and vectors for transfer of the nucleic acids encoding the recombinant products are those described, e.g., in international patent application, Publication No.: WO2014055668, and U.S. Pat. No. 7,446,190.
(237) Among additional nucleic acids, e.g., genes for introduction are those to improve the efficacy of therapy, such as by promoting viability and/or function of transferred cells; genes to provide a genetic marker for selection and/or evaluation of the cells, such as to assess in vivo survival or localization; genes to improve safety, for example, by making the cell susceptible to negative selection in vivo as described by Lupton S. D. et al., Mol. and Cell Biol., 11:6 (1991); and Riddell et al., Human Gene Therapy 3:319-338 (1992); see also the publications of PCT/US91/08442 and PCT/US94/05601 by Lupton et al. describing the use of bifunctional selectable fusion genes derived from fusing a dominant positive selectable marker with a negative selectable marker. See, e.g., Riddell et al., U.S. Pat. No. 6,040,177, at columns 14-17.
(238) In some embodiments, one or more binding molecules, including antibodies and/or recombinant receptors (e.g., CARs), can be genetically engineered to be expressed in cells or plurality of cells. In some embodiments, a first recombinant receptor and a second binding molecule, e.g., recombinant receptor, are encoded by the same or separate nucleic acid molecules. In some embodiments, additional binding molecules are engineered to be expressed in cells or a plurality of cells.
(239) In some embodiments, the vector or construct can contain a single promoter that drives the expression of one or more nucleic acid molecules. In some embodiments, such nucleic acid molecules, e.g., transcripts, can be multicistronic (bicistronic or tricistronic, see e.g., U.S. Pat. No. 6,060,273). For example, in some embodiments, transcription units can be engineered as a bicistronic unit containing an IRES (internal ribosome entry site), which allows coexpression of gene products (e.g. encoding a first and second chimeric receptor) by a message from a single promoter. Alternatively, in some cases, a single promoter may direct expression of an RNA that contains, in a single open reading frame (ORF), two or three genes (e.g. encoding the molecule involved in modulating a metabolic pathway and encoding the recombinant receptor) separated from one another by sequences encoding a self-cleavage peptide (e.g., 2A sequences) or a protease recognition site (e.g., furin). The ORF thus encodes a single polypeptide, which, either during (in the case of 2A) or after translation, is processed into the individual proteins. In some cases, the peptide, such as T2A, can cause the ribosome to skip (ribosome skipping) synthesis of a peptide bond at the C-terminus of a 2A element, leading to separation between the end of the 2A sequence and the next peptide downstream (see, for example, de Felipe. Genetic Vaccines and Ther. 2:13 (2004) and deFelipe et al. Traffic 5:616-626 (2004)). Many 2A elements are known in the art. Examples of 2A sequences that can be used in the methods and nucleic acids disclosed herein, without limitation, 2A sequences from the foot-and-mouth disease virus (F2A, e.g., SEQ ID NO: 601), equine rhinitis A virus (E2A, e.g., SEQ ID NO: 600), Thosea asigna virus (T2A, e.g., SEQ ID NO: 596 or 597), and porcine teschovirus-1 (P2A, e.g., SEQ ID NO: 598 or 599) as described in U.S. Patent Publication No. 20070116690. In some embodiments, the one or more different or separate promoters drive the expression of one or more nucleic acid molecules encoding the one or more binding molecules, e.g., recombinant receptors.
(240) Any of the binding molecules, e.g., antibodies and/or recombinant receptors provided herein, e.g., BCMA-binding molecules and/or the additional recombinant receptors, can be encoded by polynucleotides containing one or more nucleic acid molecules encoding the receptors, in any combinations or arrangements. For example, one, two, three or more polynucleotides can encode one, two, three or more different receptors or domains. In some embodiments, one vector or construct contains nucleic acid molecules encoding one or more binding molecules, e.g., antibody and/or recombinant receptor, and a separate vector or construct contains nucleic acid molecules encoding an additional binding molecule, e.g., antibody and/or recombinant receptor. Each of the nucleic acid molecule can also encode one or more marker, such as a surface marker, e.g., truncated EGFR (tEGFR).
(241) Also provided are compositions containing one or more of the nucleic acid molecules, vectors or constructs, such as any described above. In some embodiments, the nucleic acid molecules, vectors, constructs or compositions can be used to engineer cells, such as T cells, to express any of the binding molecules, e.g., antibody or recombinant receptor, and/or the additional binding molecules.
(242) b. Preparation of Cells for Engineering
(243) In some embodiments, preparation of the engineered cells includes one or more culture and/or preparation steps. The cells for introduction of the recombinant receptor (e.g., CAR) may be isolated from a sample, such as a biological sample, e.g., one obtained from or derived from a subject. In some embodiments, the subject from which the cell is isolated is one having the disease or condition or in need of a cell therapy or to which cell therapy will be administered. The subject in some embodiments is a human in need of a particular therapeutic intervention, such as the adoptive cell therapy for which cells are being isolated, processed, and/or engineered.
(244) Accordingly, the cells in some embodiments are primary cells, e.g., primary human cells. The samples include tissue, fluid, and other samples taken directly from the subject, as well as samples resulting from one or more processing steps, such as separation, centrifugation, genetic engineering (e.g. transduction with viral vector), washing, and/or incubation. The biological sample can be a sample obtained directly from a biological source or a sample that is processed. Biological samples include, but are not limited to, body fluids, such as blood, plasma, serum, cerebrospinal fluid, synovial fluid, urine and sweat, tissue and organ samples, including processed samples derived therefrom.
(245) In some aspects, the sample from which the cells are derived or isolated is blood or a blood-derived sample, or is or is derived from an apheresis or leukapheresis product. Exemplary samples include whole blood, peripheral blood mononuclear cells (PBMCs), leukocytes, bone marrow, thymus, tissue biopsy, tumor, leukemia, lymphoma, lymph node, gut associated lymphoid tissue, mucosa associated lymphoid tissue, spleen, other lymphoid tissues, liver, lung, stomach, intestine, colon, kidney, pancreas, breast, bone, prostate, cervix, testes, ovaries, tonsil, or other organ, and/or cells derived therefrom. Samples include, in the context of cell therapy, e.g., adoptive cell therapy, samples from autologous and allogeneic sources.
(246) In some embodiments, the cells are derived from cell lines, e.g., T cell lines. The cells in some embodiments are obtained from a xenogeneic source, for example, from mouse, rat, non-human primate, or pig.
(247) In some embodiments, isolation of the cells includes one or more preparation and/or non-affinity based cell separation steps. In some examples, cells are washed, centrifuged, and/or incubated in the presence of one or more reagents, for example, to remove unwanted components, enrich for desired components, lyse or remove cells sensitive to particular reagents. In some examples, cells are separated based on one or more property, such as density, adherent properties, size, sensitivity and/or resistance to particular components.
(248) In some examples, cells from the circulating blood of a subject are obtained, e.g., by apheresis or leukapheresis. The samples, in some aspects, contain lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and/or platelets, and in some aspects contain cells other than red blood cells and platelets.
(249) In some embodiments, the blood cells collected from the subject are washed, e.g., to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In some embodiments, the cells are washed with phosphate buffered saline (PBS). In some embodiments, the wash solution lacks calcium and/or magnesium and/or many or all divalent cations. In some aspects, a washing step is accomplished a semi-automated “flow-through” centrifuge (for example, the Cobe 2991 cell processor, Baxter) according to the manufacturer's instructions. In some aspects, a washing step is accomplished by tangential flow filtration (TFF) according to the manufacturer's instructions. In some embodiments, the cells are resuspended in a variety of biocompatible buffers after washing, such as, for example, Ca.sup.++/Mg.sup.++ free PBS. In certain embodiments, components of a blood cell sample are removed and the cells directly resuspended in culture media.
(250) In some embodiments, the methods include density-based cell separation methods, such as the preparation of white blood cells from peripheral blood by lysing the red blood cells and centrifugation through a Percoll or Ficoll gradient.
(251) In some embodiments, the isolation methods include the separation of different cell types based on the expression or presence in the cell of one or more specific molecules, such as surface markers, e.g., surface proteins, intracellular markers, or nucleic acid. In some embodiments, any known method for separation based on such markers may be used. In some embodiments, the separation is affinity- or immunoaffinity-based separation. For example, the isolation in some aspects includes separation of cells and cell populations based on the cells' expression or expression level of one or more markers, typically cell surface markers, for example, by incubation with an antibody or binding partner that specifically binds to such markers, followed generally by washing steps and separation of cells having bound the antibody or binding partner, from those cells having not bound to the antibody or binding partner.
(252) Such separation steps can be based on positive selection, in which the cells having bound the reagents are retained for further use, and/or negative selection, in which the cells having not bound to the antibody or binding partner are retained. In some examples, both fractions are retained for further use. In some aspects, negative selection can be particularly useful where no antibody is available that specifically identifies a cell type in a heterogeneous population, such that separation is best carried out based on markers expressed by cells other than the desired population.
(253) The separation need not result in 100% enrichment or removal of a particular cell population or cells expressing a particular marker. For example, positive selection of or enrichment for cells of a particular type, such as those expressing a marker, refers to increasing the number or percentage of such cells, but need not result in a complete absence of cells not expressing the marker. Likewise, negative selection, removal, or depletion of cells of a particular type, such as those expressing a marker, refers to decreasing the number or percentage of such cells, but need not result in a complete removal of all such cells.
(254) In some examples, multiple rounds of separation steps are carried out, where the positively or negatively selected fraction from one step is subjected to another separation step, such as a subsequent positive or negative selection. In some examples, a single separation step can deplete cells expressing multiple markers simultaneously, such as by incubating cells with a plurality of antibodies or binding partners, each specific for a marker targeted for negative selection. Likewise, multiple cell types can simultaneously be positively selected by incubating cells with a plurality of antibodies or binding partners expressed on the various cell types.
(255) For example, in some aspects, specific subpopulations of T cells, such as cells positive or expressing high levels of one or more surface markers, e.g., CD28+, CD62L+, CCR7+, CD27+, CD127+, CD4+, CD8+, CD45RA+, and/or CD45RO+ T cells, are isolated by positive or negative selection techniques.
(256) For example, CD3+, CD28+ T cells can be positively selected using anti-CD3/anti-CD28 conjugated magnetic beads (e.g., DYNABEADS® M-450 CD3/CD28 T Cell Expander, MACSiBeads, etc.).
(257) In some embodiments, isolation is carried out by enrichment for a particular cell population by positive selection, or depletion of a particular cell population, by negative selection. In some embodiments, positive or negative selection is accomplished by incubating cells with one or more antibodies or other binding agent that specifically bind to one or more surface markers expressed or expressed (marker.sup.+) at a relatively higher level (marker.sup.high) on the positively or negatively selected cells, respectively.
(258) In some embodiments, T cells are separated from a PBMC sample by negative selection of markers expressed on non-T cells, such as B cells, monocytes, or other white blood cells, such as CD14. In some aspects, a CD4+ or CD8+ selection step is used to separate CD4+ helper and CD8+ cytotoxic T cells. Such CD4+ and CD8+ populations can be further sorted into sub-populations by positive or negative selection for markers expressed or expressed to a relatively higher degree on one or more naive, memory, and/or effector T cell subpopulations.
(259) In some embodiments, CD8+ cells are further enriched for or depleted of naive, central memory, effector memory, and/or central memory stem cells, such as by positive or negative selection based on surface antigens associated with the respective subpopulation. In some embodiments, enrichment for central memory T (T.sub.CM) cells is carried out to increase efficacy, such as to improve long-term survival, expansion, and/or engraftment following administration, which in some aspects is particularly robust in such sub-populations. See Terakura et al. (2012) Blood. 1:72-82; Wang et al. (2012) J Immunother. 35(9):689-701. In some embodiments, combining T.sub.CM-enriched CD8+ T cells and CD4+ T cells further enhances efficacy.
(260) In embodiments, memory T cells are present in both CD62L+ and CD62L− subsets of CD8+ peripheral blood lymphocytes. PBMC can be enriched for or depleted of CD62L-CD8+ and/or CD62L+CD8+ fractions, such as using anti-CD8 and anti-CD62L antibodies.
(261) In some embodiments, the enrichment for central memory T (T.sub.CM) cells is based on positive or high surface expression of CD45RO, CD62L, CCR7, CD28, CD3, and/or CD 127; in some aspects, it is based on negative selection for cells expressing or highly expressing CD45RA and/or granzyme B. In some aspects, isolation of a CD8+ population enriched for T.sub.CM cells is carried out by depletion of cells expressing CD4, CD14, CD45RA, and positive selection or enrichment for cells expressing CD62L. In one aspect, enrichment for central memory T (T.sub.CM) cells is carried out starting with a negative fraction of cells selected based on CD4 expression, which is subjected to a negative selection based on expression of CD14 and CD45RA, and a positive selection based on CD62L. Such selections in some aspects are carried out simultaneously and in other aspects are carried out sequentially, in either order. In some aspects, the same CD4 expression-based selection step used in preparing the CD8+ cell population or subpopulation, also is used to generate the CD4+ cell population or subpopulation, such that both the positive and negative fractions from the CD4-based separation are retained and used in subsequent steps of the methods, optionally following one or more further positive or negative selection steps.
(262) In a particular example, a sample of PBMCs or other white blood cell sample is subjected to selection of CD4+ cells, where both the negative and positive fractions are retained. The negative fraction then is subjected to negative selection based on expression of CD14 and CD45RA, and positive selection based on a marker characteristic of central memory T cells, such as CD62L or CCR7, where the positive and negative selections are carried out in either order.
(263) CD4+ T helper cells are sorted into naïve, central memory, and effector cells by identifying cell populations that have cell surface antigens. CD4+ lymphocytes can be obtained by standard methods. In some embodiments, naive CD4+ T lymphocytes are CD45RO−, CD45RA+, CD62L+, CD4+ T cells. In some embodiments, central memory CD4+ cells are CD62L+ and CD45RO+. In some embodiments, effector CD4+ cells are CD62L− and CD45RO−.
(264) In one example, to enrich for CD4+ cells by negative selection, a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8. In some embodiments, the antibody or binding partner is bound to a solid support or matrix, such as a magnetic bead or paramagnetic bead, to allow for separation of cells for positive and/or negative selection. For example, in some embodiments, the cells and cell populations are separated or isolated using immunomagnetic (or affinitymagnetic) separation techniques (reviewed in Methods in Molecular Medicine, vol. 58: Metastasis Research Protocols, Vol. 2: Cell Behavior In vitro and In vivo, p 17-25 Edited by: S. A. Brooks and U. Schumacher© Humana Press Inc., Totowa, N.J.).
(265) In some aspects, the sample or composition of cells to be separated is incubated with small, magnetizable or magnetically responsive material, such as magnetically responsive particles or microparticles, such as paramagnetic beads (e.g., such as Dynabeads or MACS beads). The magnetically responsive material, e.g., particle, generally is directly or indirectly attached to a binding partner, e.g., an antibody, that specifically binds to a molecule, e.g., surface marker, present on the cell, cells, or population of cells that it is desired to separate, e.g., that it is desired to negatively or positively select.
(266) In some embodiments, the magnetic particle or bead comprises a magnetically responsive material bound to a specific binding member, such as an antibody or other binding partner. There are many well-known magnetically responsive materials used in magnetic separation methods. Suitable magnetic particles include those described in Molday, U.S. Pat. No. 4,452,773, and in European Patent Specification EP 452342 B, which are hereby incorporated by reference. Colloidal sized particles, such as those described in Owen U.S. Pat. No. 4,795,698, and Liberti et al., U.S. Pat. No. 5,200,084, are other examples.
(267) The incubation generally is carried out under conditions whereby the antibodies or binding partners, or molecules, such as secondary antibodies or other reagents, which specifically bind to such antibodies or binding partners, which are attached to the magnetic particle or bead, specifically bind to cell surface molecules if present on cells within the sample.
(268) In some aspects, the sample is placed in a magnetic field, and those cells having magnetically responsive or magnetizable particles attached thereto will be attracted to the magnet and separated from the unlabeled cells. For positive selection, cells that are attracted to the magnet are retained; for negative selection, cells that are not attracted (unlabeled cells) are retained. In some aspects, a combination of positive and negative selection is performed during the same selection step, where the positive and negative fractions are retained and further processed or subject to further separation steps.
(269) In certain embodiments, the magnetically responsive particles are coated in primary antibodies or other binding partners, secondary antibodies, lectins, enzymes, or streptavidin. In certain embodiments, the magnetic particles are attached to cells via a coating of primary antibodies specific for one or more markers. In certain embodiments, the cells, rather than the beads, are labeled with a primary antibody or binding partner, and then cell-type specific secondary antibody- or other binding partner (e.g., streptavidin)-coated magnetic particles, are added. In certain embodiments, streptavidin-coated magnetic particles are used in conjunction with biotinylated primary or secondary antibodies.
(270) In some embodiments, the magnetically responsive particles are left attached to the cells that are to be subsequently incubated, cultured and/or engineered; in some aspects, the particles are left attached to the cells for administration to a patient. In some embodiments, the magnetizable or magnetically responsive particles are removed from the cells. Methods for removing magnetizable particles from cells are known and include, e.g., the use of competing non-labeled antibodies, magnetizable particles or antibodies conjugated to cleavable linkers, etc. In some embodiments, the magnetizable particles are biodegradable.
(271) In some embodiments, the affinity-based selection is via magnetic-activated cell sorting (MACS) (Miltenyi Biotec, Auburn, Calif.). Magnetic Activated Cell Sorting (MACS) systems are capable of high-purity selection of cells having magnetized particles attached thereto. In certain embodiments, MACS operates in a mode wherein the non-target and target species are sequentially eluted after the application of the external magnetic field. That is, the cells attached to magnetized particles are held in place while the unattached species are eluted. Then, after this first elution step is completed, the species that were trapped in the magnetic field and were prevented from being eluted are freed in some manner such that they can be eluted and recovered. In certain embodiments, the non-target cells are labelled and depleted from the heterogeneous population of cells.
(272) In certain embodiments, the isolation or separation is carried out using a system, device, or apparatus that carries out one or more of the isolation, cell preparation, separation, processing, incubation, culture, and/or formulation steps of the methods. In some aspects, the system is used to carry out each of these steps in a closed or sterile environment, for example, to minimize error, user handling and/or contamination. In one example, the system is a system as described in International Patent Application, Publication Number WO2009/072003, or US 20110003380 A1.
(273) In some embodiments, the system or apparatus carries out one or more, e.g., all, of the isolation, processing, engineering, and formulation steps in an integrated or self-contained system, and/or in an automated or programmable fashion. In some aspects, the system or apparatus includes a computer and/or computer program in communication with the system or apparatus, which allows a user to program, control, assess the outcome of, and/or adjust various aspects of the processing, isolation, engineering, and formulation steps.
(274) In some aspects, the separation and/or other steps is carried out using CliniMACS system (Miltenyi Biotec), for example, for automated separation of cells on a clinical-scale level in a closed and sterile system. Components can include an integrated microcomputer, magnetic separation unit, peristaltic pump, and various pinch valves. The integrated computer in some aspects controls all components of the instrument and directs the system to perform repeated procedures in a standardized sequence. The magnetic separation unit in some aspects includes a movable permanent magnet and a holder for the selection column. The peristaltic pump controls the flow rate throughout the tubing set and, together with the pinch valves, ensures the controlled flow of buffer through the system and continual suspension of cells.
(275) The CliniMACS system in some aspects uses antibody-coupled magnetizable particles that are supplied in a sterile, non-pyrogenic solution. In some embodiments, after labelling of cells with magnetic particles the cells are washed to remove excess particles. A cell preparation bag is then connected to the tubing set, which in turn is connected to a bag containing buffer and a cell collection bag. The tubing set consists of pre-assembled sterile tubing, including a pre-column and a separation column, and are for single use only. After initiation of the separation program, the system automatically applies the cell sample onto the separation column. Labelled cells are retained within the column, while unlabeled cells are removed by a series of washing steps. In some embodiments, the cell populations for use with the methods described herein are unlabeled and are not retained in the column. In some embodiments, the cell populations for use with the methods described herein are labeled and are retained in the column. In some embodiments, the cell populations for use with the methods described herein are eluted from the column after removal of the magnetic field, and are collected within the cell collection bag.
(276) In certain embodiments, separation and/or other steps are carried out using the CliniMACS Prodigy system (Miltenyi Biotec). The CliniMACS Prodigy system in some aspects is equipped with a cell processing unity that permits automated washing and fractionation of cells by centrifugation. The CliniMACS Prodigy system can also include an onboard camera and image recognition software that determines the optimal cell fractionation endpoint by discerning the macroscopic layers of the source cell product. For example, peripheral blood may be automatically separated into erythrocytes, white blood cells and plasma layers. The CliniMACS Prodigy system can also include an integrated cell cultivation chamber which accomplishes cell culture protocols such as, e.g., cell differentiation and expansion, antigen loading, and long-term cell culture. Input ports can allow for the sterile removal and replenishment of media and cells can be monitored using an integrated microscope. See, e.g., Klebanoff et al. (2012) J Immunother. 35(9): 651-660, Terakura et al. (2012) Blood. 1:72-82, and Wang et al. (2012) J Immunother. 35(9):689-701.
(277) In some embodiments, a cell population described herein is collected and enriched (or depleted) via flow cytometry, in which cells stained for multiple cell surface markers are carried in a fluidic stream. In some embodiments, a cell population described herein is collected and enriched (or depleted) via preparative scale (FACS)-sorting. In certain embodiments, a cell population described herein is collected and enriched (or depleted) by use of microelectromechanical systems (MEMS) chips in combination with a FACS-based detection system (see, e.g., WO 2010/033140, Cho et al. (2010) Lab Chip 10, 1567-1573; and Godin et al. (2008) J Biophoton. 1(5):355-376. In both cases, cells can be labeled with multiple markers, allowing for the isolation of well-defined T cell subsets at high purity.
(278) In some embodiments, the antibodies or binding partners are labeled with one or more detectable marker, to facilitate separation for positive and/or negative selection. For example, separation may be based on binding to fluorescently labeled antibodies. In some examples, separation of cells based on binding of antibodies or other binding partners specific for one or more cell surface markers are carried in a fluidic stream, such as by fluorescence-activated cell sorting (FACS), including preparative scale (FACS) and/or microelectromechanical systems (MEMS) chips, e.g., in combination with a flow-cytometric detection system. Such methods allow for positive and negative selection based on multiple markers simultaneously.
(279) In some embodiments, the preparation methods include steps for freezing, e.g., cryopreserving, the cells, either before or after isolation, incubation, and/or engineering. In some embodiments, the freeze and subsequent thaw step removes granulocytes and, to some extent, monocytes in the cell population. In some embodiments, the cells are suspended in a freezing solution, e.g., following a washing step to remove plasma and platelets. Any of a variety of known freezing solutions and parameters in some aspects may be used. One example involves using PBS containing 20% DMSO and 8% human serum albumin (HSA), or other suitable cell freezing media. This is then diluted 1:1 with media so that the final concentration of DMSO and HSA are 10% and 4%, respectively. The cells are then frozen to −80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank.
(280) In some embodiments, the provided methods include cultivation, incubation, culture, and/or genetic engineering steps. For example, in some embodiments, provided are methods for incubating and/or engineering the depleted cell populations and culture-initiating compositions.
(281) Thus, in some embodiments, the cell populations are incubated in a culture-initiating composition. The incubation and/or engineering may be carried out in a culture vessel, such as a unit, chamber, well, column, tube, tubing set, valve, vial, culture dish, bag, or other container for culture or cultivating cells.
(282) In some embodiments, the cells are incubated and/or cultured prior to or in connection with genetic engineering. The incubation steps can include culture, cultivation, stimulation, activation, and/or propagation. In some embodiments, the compositions or cells are incubated in the presence of stimulating conditions or a stimulatory agent. Such conditions include those designed to induce proliferation, expansion, activation, and/or survival of cells in the population, to mimic antigen exposure, and/or to prime the cells for genetic engineering, such as for the introduction of a recombinant antigen receptor.
(283) The conditions can include one or more of particular media, temperature, oxygen content, carbon dioxide content, time, agents, e.g., nutrients, amino acids, antibiotics, ions, and/or stimulatory factors, such as cytokines, chemokines, antigens, binding partners, fusion proteins, recombinant soluble receptors, and any other agents designed to activate the cells.
(284) In some embodiments, the stimulating conditions or agents include one or more agent, e.g., ligand, which is capable of activating an intracellular signaling domain of a TCR complex. In some aspects, the agent turns on or initiates TCR/CD3 intracellular signaling cascade in a T cell. Such agents can include antibodies, such as those specific for a TCR, e.g. anti-CD3. In some embodiments, the stimulating conditions include one or more agent, e.g. ligand, which is capable of stimulating a costimulatory receptor, e.g., anti-CD28. In some embodiments, such agents and/or ligands may be, bound to solid support such as a bead, and/or one or more cytokines. Optionally, the expansion method may further comprise the step of adding anti-CD3 and/or anti CD28 antibody to the culture medium (e.g., at a concentration of at least about 0.5 ng/ml). In some embodiments, the stimulating agents include IL-2, IL-15 and/or IL-7. In some aspects, the IL-2 concentration is at least about 10 units/mL.
(285) In some aspects, incubation is carried out in accordance with techniques such as those described in U.S. Pat. No. 6,040,177 to Riddell et al., Klebanoff et al. (2012) J Immunother. 35(9): 651-660, Terakura et al. (2012) Blood. 1:72-82, and/or Wang et al. (2012) J Immunother. 35(9):689-701.
(286) In some embodiments, the T cells are expanded by adding to the culture-initiating composition feeder cells, such as non-dividing peripheral blood mononuclear cells (PBMC), (e.g., such that the resulting population of cells contains at least about 5, 10, 20, or 40 or more PBMC feeder cells for each T lymphocyte in the initial population to be expanded); and incubating the culture (e.g. for a time sufficient to expand the numbers of T cells). In some aspects, the non-dividing feeder cells can comprise gamma-irradiated PBMC feeder cells. In some embodiments, the PBMC are irradiated with gamma rays in the range of about 3000 to 3600 rads to prevent cell division. In some aspects, the feeder cells are added to culture medium prior to the addition of the populations of T cells.
(287) In some embodiments, the stimulating conditions include temperature suitable for the growth of human T lymphocytes, for example, at least about 25 degrees Celsius, generally at least about 30 degrees, and generally at or about 37 degrees Celsius. Optionally, the incubation may further comprise adding non-dividing EBV-transformed lymphoblastoid cells (LCL) as feeder cells. LCL can be irradiated with gamma rays in the range of about 6000 to 10,000 rads. The LCL feeder cells in some aspects is provided in any suitable amount, such as a ratio of LCL feeder cells to initial T lymphocytes of at least about 10:1.
(288) In embodiments, antigen-specific T cells, such as antigen-specific CD4+ and/or CD8+ T cells, are obtained by stimulating naive or antigen specific T lymphocytes with antigen. For example, antigen-specific T cell lines or clones can be generated to cytomegalovirus antigens by isolating T cells from infected subjects and stimulating the cells in vitro with the same antigen.
(289) c. Engineered Cells, Vectors and Compositions for Multi-Targeting
(290) Also provided are cells such as engineered cells that can bind to and/or target multiple antigens. In some embodiments, improved selectivity and specificity is achieved through strategies targeting multiple antigens. Such strategies generally involve multiple antigen-binding domains, which typically are present on distinct genetically engineered antigen receptors and specifically bind to distinct antigens. In some embodiments, the cells are engineered with the ability to bind more than one antigen. For example, in some embodiments, the cells are engineered to express multispecific binding molecules. In some embodiments, the cells express multiple binding molecules, e.g., recombinant receptors, each of which can target one antigen or multiple antigens, e.g., one receptor that targets BCMA, such as any described herein, and another receptor that targets another antigen, e.g., tumor antigen. In some aspects, a plurality of genetically engineered antigen receptors are introduced into the cell, which specifically bind to different antigens, each expressed in or on the disease or condition to be targeted with the cells or tissues or cells thereof. Such features can in some aspects address or reduce the likelihood of off-target effects or increase efficacy. For example, where a single antigen expressed in a disease or condition is also expressed on or in non-diseased or normal cells, such multi-targeting approaches can provide selectivity for desired cell types by requiring binding via multiple antigen receptors in order to activate the cell or induce a particular effector function. In some embodiments, a plurality of cells can be engineered to express one or more different binding molecules, e.g., recombinant receptors, each of which can target one antigen or multiple antigens.
(291) Also provided are multispecific cells containing any of the binding molecules described herein, such as cells containing a cell surface protein including the anti-BCMA antibody and an additional cell surface protein, such as an additional chimeric receptor, which binds to a different antigen or a different epitope on BCMA. In some embodiments, provided are compositions of cells that express recombinant receptors, wherein one or more of the binding molecules, multispecific binding molecules and/or recombinant receptors bind and/or target BCMA. Also provided are compositions of cells containing a plurality of cells that express one or more different binding molecules, e.g., recombinant receptors that can target one or multiple antigens. In some embodiments, the multispecific binding molecules and/or recombinant receptors target one or more different epitopes on BCMA.
(292) In some embodiments, provided are composition of cells, wherein each type of cell expresses one or more binding molecules, e.g., recombinant receptors. In some embodiments, the cell comprises (e.g., has been transformed with) one or more vectors comprising one or more nucleic acid that encodes one or more an amino acid sequence comprising one or more antibodies and/or portions thereof, e.g., antigen-binding fragments thereof. In some embodiments, one or more such cells are provided. In some embodiments, a composition containing one or more such cells is provided. In some embodiments, the one or more cells can express different antibodies, or the same antibody. In some embodiments, each of the cells expresses one or more antibodies, such as more than one antibody. In some embodiments, each of the cells expresses a multispecific binding molecule, e.g., a multispecific receptor, e.g., CAR.
(293) In some embodiments, the cells include multi-targeting strategies that target BCMA and a second or additional antigen associated with a particular disease or condition. In some embodiments, the second or additional antigen is targeted by a multispecific binding molecule and/or multiple binding molecules and/or a plurality of cells, e.g., one or more cells, each engineered to express one or more recombinant receptors. In some embodiments, a recombinant receptor targeting a second or additional antigen is expressed on the same cell as a BCMA binding molecule, or on a different cell.
(294) In some embodiments, among the second or additional antigens for multi-targeting strategies includes those in which at least one of the antigens is a universal tumor antigen, or a family member thereof. In some embodiments, the second or additional antigen is an antigen expressed on a tumor. In some embodiments, the BCMA-binding molecules provided herein target an antigen on the same tumor type as the second or additional antigen. In some embodiments, the second or additional antigen may also be a universal tumor antigen or may be a tumor antigen specific to a tumor type. In some embodiments, the cell further comprises an additional genetically engineered antigen receptor that recognizes a second or additional antigen expressed on a disease or condition to be treated and induces a stimulatory or activating signal.
(295) Exemplary antigens include CD4, CD5, CD8, CD14, CD15, CD19, CD20, CD21, CD22, CD23, CD25, CD33, CD37, CD38, CD40, CD40L, CD46, CD52, CD54, CD74, CD80, CD126, CD138, B7, MUC-1, Ia, HM1.24, HLA-DR, tenascin, an angiogenesis factor, VEGF, PIGF, ED-B fibronectin, an oncogene, an oncogene product, CD66a-d, necrosis antigens, Ii, IL-2, T101, TAC, IL-6, ROR1, TRAIL-R1 (DR4), TRAIL-R2 (DR5), B cell maturation antigen (BCMA), tEGFR, Her2, L1-CAM, mesothelin, CEA, hepatitis B surface antigen, anti-folate receptor, CD24, CD30, CD44, EGFR, EGP-2, EGP-4, EPHa2, ErbB2, ErbB3, ErbB4, erbB dimers, EGFR vIII, FBP, FCRL5, FCRH5, fetal acetylcholine receptor, GD2, GD3, HMW-MAA, IL-22R-alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, L1-cell adhesion molecule (L1-CAM), Melanoma-associated antigen (MAGE)-A1, MAGE-A3, MAGE-A6, Preferentially expressed antigen of melanoma (PRAME), survivin, EGP2, EGP40, TAG72, B7-H6, IL-13 receptor a2 (IL-13Ra2), CA9, CD171, G250/CAIX, HLA-AI MAGE A1, HLA-A2 NY-ESO-1, PSCA, folate receptor-a, CD44v6, CD44v7/8, avb6 integrin, 8H9, NCAM, VEGF receptors, 5T4, Foetal AchR, NKG2D ligands, dual antigen, an antigen associated with a universal tag, a cancer-testes antigen, MUC1, MUC16, NY-ESO-1, MART-1, gp100, oncofetal antigen, VEGF-R2, carcinoembryonic antigen (CEA), prostate specific antigen, PSMA, Her2/neu, estrogen receptor, progesterone receptor, ephrinB2, CD123, c-Met, GD-2, O-acetylated GD2 (OGD2), CE7, Wilms Tumor 1 (WT-1), a cyclin, cyclin A2, CCL-1, hTERT, MDM2, CYP1B, WT1, livin, AFP, p53, cyclin (D1), CS-1, BCMA, BAFF-R, TACI, CD56, TIM-3, CD123, L1-cell adhesion molecule, MAGE-A1, MAGE A3, a cyclin, such as cyclin A1 (CCNA1) and/or a pathogen-specific antigen, biotinylated molecules, molecules expressed by HIV, HCV, HBV and/or other pathogens, and/or in some aspects, neoepitopes or neoantigens thereof. In some embodiments, the antigen is associated with or is a universal tag.
(296) In some embodiments, the plurality of antigens, e.g., the first antigen, e.g., BCMA, and the second or additional antigens, are expressed on the cell, tissue, or disease or condition being targeted, such as on the cancer cell. In some aspects, the cell, tissue, disease or condition is multiple myeloma or a multiple myeloma cell. One or more of the plurality of antigens generally also is expressed on a cell which it is not desired to target with the cell therapy, such as a normal or non-diseased cell or tissue, and/or the engineered cells themselves. In such embodiments, by requiring ligation of multiple receptors to achieve a response of the cell, specificity and/or efficacy is/are achieved.
(297) In some aspects, the antigen, e.g., the second or additional antigen, such as the disease-specific antigen and/or related antigen, is expressed on multiple myeloma, such as CD38 (cyclic ADP ribose hydrolase), CD138 (syndecan-1, syndecan, SYN-1), CS-1 (CS1, CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24), BAFF-R, TACI and/or FcRH5. Other exemplary multiple myeloma antigens include CD56, TIM-3, CD33, CD123, CD44, CD20, CD40, CD74, CD200, EGFR, β2-Microglobulin, HM1.24, IGF-1R, IL-6R, TRAIL-R1, and the activin receptor type IIA (ActRIIA). See Benson and Byrd, J. Clin. Oncol. (2012) 30(16): 2013-15; Tao and Anderson, Bone Marrow Research (2011):924058; Chu et al., Leukemia (2013) 28(4):917-27; Garfall et al., Discov Med. (2014) 17(91):37-46. In some embodiments, the antigens include those present on lymphoid tumors, myeloma, AIDS-associated lymphoma, and/or post-transplant lymphoproliferations, such as CD38. Antibodies or antigen-binding fragments directed against such antigens are known and include, for example, those described in U.S. Pat. Nos. 8,153,765; 8,603,477, 8,008,450; U.S. Pub. No. US20120189622 or US20100260748; and/or International PCT Publication Nos. WO2006099875, WO2009080829 or WO2012092612 or WO2014210064. In some embodiments, such antibodies or antigen-binding fragments thereof (e.g. scFv) are contained in multispecific antibodies, multispecific chimeric receptors, such as multispecific CARs, and/or multispecific cells.
(298) In some embodiments, the cells and methods include multi-targeting strategies, such as expression of two or more genetically engineered receptors on the cell, each recognizing a different antigen and typically each including a different intracellular signaling component. Such multi-targeting strategies are described, for example, in International Patent Application, Publication No.: WO 2014055668 A1 (describing combinations of activating and costimulatory CARs, e.g., targeting two different antigens present individually on off-target, e.g., normal cells, but present together only on cells of the disease or condition to be treated) and Fedorov et al., Sci. Transl. Medicine, 5(215) (December, 2013) (describing cells expressing an activating and an inhibitory CAR, such as those in which the activating CAR binds to one antigen expressed on both normal or non-diseased cells and cells of the disease or condition to be treated, and the inhibitory CAR binds to another antigen expressed only on the normal cells or cells which it is not desired to treat).
(299) In some embodiments, a plurality of cells, each engineered to express one or more recombinant receptors, are provided. For example, in some embodiments, one cell is engineered to express a binding molecule that binds and/or targets BCMA, and another cell is engineered to express a binding molecule that binds and/or targets an additional or second antigen. In some embodiments, the cells can each express a multispecific binding molecule, e.g., a multispecific recombinant receptor, where one or more of the target antigen is BCMA. In some of such embodiments, the plurality of cells can be administered together or separately. In some embodiments, some of the plurality of cells are administered simultaneously or concurrently with other cells, e.g., administered on the same day, and/or sequentially with or intermittently with, in any order, another engineered cell in the plurality. For example, in some embodiments, an engineered cell expressing a BCMA-binding molecule, e.g., CAR, is administered simultaneously with or sequentially with, in any order, another engineered cell expressing a binding molecule that binds a different target antigen or a different epitope on BCMA. In some embodiments, the plurality of cells can be in the same composition or in different compositions. Exemplary compositions of the cells include compositions described in Section II below.
II. Pharmaceutical Compositions
(300) Also provided are compositions including the BCMA-binding molecules, immunoconjugates, recombinant receptors, and engineered cells, including pharmaceutical compositions and formulations.
(301) Provided are pharmaceutical formulations comprising a BCMA-binding molecule (e.g., antibody), an immunoconjugate, a recombinant receptor (e.g., chimeric antigen receptor), engineered cells expressing said molecules (e.g., recombinant receptor), a plurality of engineered cells expressing said molecules (e.g., recombinant receptor) and/or additional agents for combination treatment or therapy. The pharmaceutical compositions and formulations generally include one or more optional pharmaceutically acceptable carrier or excipient. In some embodiments, the composition includes at least one additional therapeutic agent.
(302) The term “pharmaceutical formulation” refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
(303) A “pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
(304) In some aspects, the choice of carrier is determined in part by the particular cell, binding molecule, and/or antibody, and/or by the method of administration. Accordingly, there are a variety of suitable formulations. For example, the pharmaceutical composition can contain preservatives. Suitable preservatives may include, for example, methylparaben, propylparaben, sodium benzoate, and benzalkonium chloride. In some aspects, a mixture of two or more preservatives is used. The preservative or mixtures thereof are typically present in an amount of about 0.0001% to about 2% by weight of the total composition. Carriers are described, e.g., by Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980). Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG).
(305) Buffering agents in some aspects are included in the compositions. Suitable buffering agents include, for example, citric acid, sodium citrate, phosphoric acid, potassium phosphate, and various other acids and salts. In some aspects, a mixture of two or more buffering agents is used. The buffering agent or mixtures thereof are typically present in an amount of about 0.001% to about 4% by weight of the total composition. Methods for preparing administrable pharmaceutical compositions are known. Exemplary methods are described in more detail in, for example, Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins; 21st ed. (May 1, 2005).
(306) Formulations of the antibodies described herein can include lyophilized formulations and aqueous solutions.
(307) The formulation or composition may also contain more than one active ingredient useful for the particular indication, disease, or condition being treated with the binding molecules or cells, preferably those with activities complementary to the binding molecule or cell, where the respective activities do not adversely affect one another. Such active ingredients are suitably present in combination in amounts that are effective for the purpose intended. Thus, in some embodiments, the pharmaceutical composition further includes other pharmaceutically active agents or drugs, such as chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc. In some embodiments, the cells or antibodies are administered in the form of a salt, e.g., a pharmaceutically acceptable salt. Suitable pharmaceutically acceptable acid addition salts include those derived from mineral acids, such as hydrochloric, hydrobromic, phosphoric, metaphosphoric, nitric, and sulphuric acids, and organic acids, such as tartaric, acetic, citric, malic, lactic, fumaric, benzoic, glycolic, gluconic, succinic, and arylsulphonic acids, for example, p-toluenesulphonic acid.
(308) Active ingredients may be entrapped in microcapsules, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. In certain embodiments, the pharmaceutical composition is formulated as an inclusion complex, such as cyclodextrin inclusion complex, or as a liposome. Liposomes can serve to target the host cells (e.g., T-cells or NK cells) to a particular tissue. Many methods are available for preparing liposomes, such as those described in, for example, Szoka et al., Ann. Rev. Biophys. Bioeng., 9: 467 (1980), and U.S. Pat. Nos. 4,235,871, 4,501,728, 4,837,028, and 5,019,369.
(309) The pharmaceutical composition in some aspects can employ time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated. Many types of release delivery systems are available and known. Such systems can avoid repeated administrations of the composition, thereby increasing convenience to the subject and the physician.
(310) The pharmaceutical composition in some embodiments contains the binding molecules and/or cells in amounts effective to treat or prevent the disease or condition, such as a therapeutically effective or prophylactically effective amount. Therapeutic or prophylactic efficacy in some embodiments is monitored by periodic assessment of treated subjects. For repeated administrations over several days or longer, depending on the condition, the treatment is repeated until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful and can be determined. The desired dosage can be delivered by a single bolus administration of the composition, by multiple bolus administrations of the composition, or by continuous infusion administration of the composition.
(311) In certain embodiments, in the context of genetically engineered cells containing the binding molecules, a subject is administered the range of about one million to about 100 billion cells, such as, e.g., 1 million to about 50 billion cells (e.g., about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, or a range defined by any two of the foregoing values), such as about 10 million to about 100 billion cells (e.g., about 20 million cells, about 30 million cells, about 40 million cells, about 60 million cells, about 70 million cells, about 80 million cells, about 90 million cells, about 10 billion cells, about 25 billion cells, about 50 billion cells, about 75 billion cells, about 90 billion cells, or a range defined by any two of the foregoing values), and in some cases about 100 million cells to about 50 billion cells (e.g., about 120 million cells, about 250 million cells, about 350 million cells, about 450 million cells, about 650 million cells, about 800 million cells, about 900 million cells, about 3 billion cells, about 30 billion cells, about 45 billion cells) or any value in between these ranges, and/or such a number of cells per kilogram of body weight of the subject.
(312) The may be administered using standard administration techniques, formulations, and/or devices. Provided are formulations and devices, such as syringes and vials, for storage and administration of the compositions. Administration of the cells can be autologous or heterologous. For example, immunoresponsive cells or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject. Peripheral blood derived immunoresponsive cells or their progeny (e.g., in vivo, ex vivo or in vitro derived) can be administered via localized injection, including catheter administration, systemic injection, localized injection, intravenous injection, or parenteral administration. When administering a therapeutic composition (e.g., a pharmaceutical composition containing a genetically modified immunoresponsive cell), it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion).
(313) Formulations include those for oral, intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration. In some embodiments, the cell populations are administered parenterally. The term “parenteral,” as used herein, includes intravenous, intramuscular, subcutaneous, rectal, vaginal, intracranial, intrathoracic, and intraperitoneal administration. In some embodiments, the cell populations are administered to a subject using peripheral systemic delivery by intravenous, intraperitoneal, or subcutaneous injection.
(314) Compositions in some embodiments are provided as sterile liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may in some aspects be buffered to a selected pH. Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues. Liquid or viscous compositions can comprise carriers, which can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
(315) Sterile injectable solutions can be prepared by incorporating the binding molecule in a solvent, such as in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like. The compositions can also be lyophilized. The compositions can contain auxiliary substances such as wetting, dispersing, or emulsifying agents (e.g., methylcellulose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired. Standard texts may in some aspects be consulted to prepare suitable preparations.
(316) Various additives which enhance the stability and sterility of the compositions, including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added. Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, and the like. Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin.
(317) Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
(318) The formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
(319) Also provided are pharmaceutical compositions for combination therapy. Any of the additional agents for combination therapy described herein, such as agents described in Section III.B, can be prepared and administered as one or more pharmaceutical compositions, with the BCMA-binding molecule (e.g., antibody), immunoconjugate, recombinant receptor (e.g., chimeric antigen receptor) and/or engineered cells expressing said molecules (e.g., recombinant receptor) described herein. The combination therapy can be administered in one or more pharmaceutical compositions, e.g., where the binding molecules, recombinant receptors and/or cells are in the same pharmaceutical composition as the additional agent, or in separate pharmaceutical compositions. For example, in some embodiments, the additional agent is an additional engineered cell, e.g., cell engineered to express a different recombinant receptor that targets a different antigen or a different epitope on BCMA, and is administered in the same composition or in a separate composition. In some embodiments, each of the pharmaceutical composition is formulated in a suitable formulation according to the particular binding molecule, recombinant receptor, cell, e.g., engineered cell, and/or additional agent, and the particular dosage regimen and/or method of delivery.
III. Methods and Uses
(320) Also provided methods, such as methods of treatment, of using and uses of the BCMA-binding molecules, immunoconjugates, recombinant receptors, engineered cells, and pharmaceutical compositions and formulations thereof, such as in the treatment of diseases, conditions, and disorders in which BCMA is expressed, and/or detection, diagnostic, and prognostic methods. Also provided are methods of combination therapy and/or treatment.
(321) A. Therapeutic and Prophylactic Methods and Uses
(322) Also provided are methods of administering and uses, such as therapeutic and prophylactic uses, of the BCMA-binding molecules, including the anti-BCMA antibodies, e.g., antibody fragments and proteins containing the same such as the recombinant receptors (e.g., CARs), engineered cells expressing the recombinant receptors (e.g., CARs), plurality of engineered cells expressing the receptors, and/or compositions comprising the same. Such methods and uses include therapeutic methods and uses, for example, involving administration of the molecules (e.g., BCMA-binding molecules, recombinant receptors), cells (e.g., engineered cells), or compositions containing the same, to a subject having a disease, condition, or disorder associated with BCMA such as a disease, condition, or disorder associated with BCMA expression, and/or in which cells or tissues express, e.g., specifically express BCMA. In some embodiments, the molecule, cell, and/or composition is administered in an effective amount to effect treatment of the disease or disorder. Provided herein are uses of the binding molecules (e.g., anti-BCMA antibodies or antigen-binding fragments thereof), recombinant receptors (e.g., CARs), and cells (e.g., engineered cells) in such methods and treatments, and in the preparation of a medicament in order to carry out such therapeutic methods. In some embodiments, the methods are carried out by administering the binding molecules or cells, or compositions comprising the same, to the subject having, having had, or suspected of having the disease or condition. In some embodiments, the methods thereby treat the disease or condition or disorder in the subject. Also provided herein are of use of any of the compositions, such as pharmaceutical compositions provided herein, for the treatment of a disease or disorder associated with BCMA, for example, multiple myeloma.
(323) As used herein, “treatment” (and grammatical variations thereof such as “treat” or “treating”) refers to complete or partial amelioration or reduction of a disease or condition or disorder, or a symptom, adverse effect or outcome, or phenotype associated therewith. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. The terms do not imply complete curing of a disease or complete elimination of any symptom or effect(s) on all symptoms or outcomes.
(324) As used herein, “delaying development of a disease” means to defer, hinder, slow, retard, stabilize, suppress and/or postpone development of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or subject being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the subject does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.
(325) “Preventing,” as used herein, includes providing prophylaxis with respect to the occurrence or recurrence of a disease in a subject that may be predisposed to the disease but has not yet been diagnosed with the disease. In some embodiments, the provided molecules and compositions are used to delay development of a disease or to slow the progression of a disease.
(326) As used herein, to “suppress” a function or activity is to reduce the function or activity when compared to otherwise same conditions except for a condition or parameter of interest, or alternatively, as compared to another condition. For example, an antibody or composition or cell which suppresses tumor growth reduces the rate of growth of the tumor compared to the rate of growth of the tumor in the absence of the antibody or composition or cell.
(327) An “effective amount” of an agent, e.g., a pharmaceutical formulation, binding molecule, antibody, cells, or composition, in the context of administration, refers to an amount effective, at dosages/amounts and for periods of time necessary, to achieve a desired result, such as a therapeutic or prophylactic result.
(328) A “therapeutically effective amount” of an agent, e.g., a pharmaceutical formulation, binding molecule, antibody, cells, or composition refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result, such as for treatment of a disease, condition, or disorder, and/or pharmacokinetic or pharmacodynamic effect of the treatment. The therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the subject, and the populations of cells administered. In some embodiments, the provided methods involve administering the molecules, antibodies, cells, and/or compositions at effective amounts, e.g., therapeutically effective amounts.
(329) A “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
(330) As used herein, a “subject” or an “individual” is a mammal. In some embodiments, a “mammal” includes humans, non-human primates, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, rabbits, cattle, pigs, hamsters, gerbils, mice, ferrets, rats, cats, monkeys, etc. In some embodiments, the subject is human.
(331) Among the diseases to be treated is any disease or disorder associated with BCMA or any disease or disorder in which BCMA is specifically expressed and/or in which BCMA has been targeted for treatment (also referred to herein interchangeably as a “BCMA-associated disease or disorder”). Cancers associated with BCMA expression include hematologic malignancies such as multiple myeloma, Waldenstrom macroglobulinemia as well as both Hodgkin's and non-Hodgkin's lymphomas. See Coquery et al., Crit Rev Immunol., 2012, 32(4):287-305 for a review of BCMA. Since BCMA has been implicated in mediating tumor cell survival, it is a potential target for cancer therapy. Anti-BCMA antibodies have been previously described such as the inhibitory anti-BCMA antibody SG1 which promoted antibody-dependent cell-mediated cytotoxicity of BCMA-expressing multiple myeloma cells. See Ryan et al., Mol Cancer Ther., 2007, 6(11):3009-3018 and International PCT Pub. No. WO2010/104949. Chimeric antigen receptors containing mouse anti-human BCMA antibodies and cells expressing such chimeric receptors have also been previously described. See Carpenter et al., Clin Cancer Res., 2013, 19(8):2048-2060.
(332) In some embodiments, the disease or disorder associated with BCMA is a B cell-related disorder. In some embodiments, the disease or disorder associated with BCMA is one or more diseases or conditions from among glioblastoma, lymphomatoid granulomatosis, post-transplant lymphoproliferative disorder, an immunoregulatory disorder, heavy-chain disease, primary or immunocyte-associated amyloidosis, or monoclonal gammopathy of undetermined significance.
(333) In some embodiments, the disease or disorder associated with BCMA is an autoimmune disease or disorder. Such autoimmune diseases or disorder include, but are not limited to, systemic lupus erythematosus (SLE), lupus nephritis, inflammatory bowel disease, rheumatoid arthritis (e.g., juvenile rheumatoid arthritis), ANCA associated vasculitis, idiopathic thrombocytopenia purpura (ITP), thrombotic thrombocytopenia purpura (TTP), autoimmune thrombocytopenia, Chagas' disease, Grave's disease, Wegener's granulomatosis, poly-arteritis nodosa, Sjogren's syndrome, pemphigus vulgaris, scleroderma, multiple sclerosis, psoriasis, IgA nephropathy, IgM polyneuropathies, vasculitis, diabetes mellitus, Reynaud's syndrome, anti-phospholipid syndrome, Goodpasture's disease, Kawasaki disease, autoimmune hemolytic anemia, myasthenia gravis, or progressive glomerulonephritis.
(334) In certain diseases and conditions, BCMA is expressed on malignant cells and cancers. In some embodiments, the cancer (e.g., a BCMA-expressing cancer) is a B cell malignancy. In some embodiments, the cancer (e.g., a BCMA-expressing cancer) is a leukemia (e.g., B cell leukemia), lymphoma (e.g., Hodgkin's lymphoma, non-Hodgkin's lymphoma, etc.), or a myeloma, e.g., a multiple myeloma (MM), a plasma cell malignancy (e.g., plasmacytoma). Lymphomas contemplated herein include, but are not limited to, Burkitt lymphoma (e.g., endemic Burkitt's lymphoma or sporadic Burkitt's lymphoma), non-Hodgkin's lymphoma (NHL), Hodgkin's lymphoma, Waldenstrom macroglobulinemia, follicular lymphoma, small non-cleaved cell lymphoma, mucosa-associated lymphatic tissue lymphoma (MALT), marginal zone lymphoma, splenic lymphoma, nodal monocytoid B cell lymphoma, immunoblastic lymphoma, large cell lymphoma, diffuse mixed cell lymphoma, pulmonary B cell angiocentric lymphoma, small lymphocytic lymphoma, primary mediastinal B cell lymphoma, lymphoplasmacytic lymphoma (LPL), or mantle cell lymphoma (MCL). Leukemias contemplated here, include, but are not limited to, chronic lymphocytic leukemia (CLL), plasma cell leukemia or acute lymphocytic leukemia (ALL). Also contemplated herein are myelomas, e.g., multiple myeloma (MM, e.g., non-secretory multiple myeloma, smoldering multiple myeloma). Also contemplated herein are plasma cell malignancies including, but not limited to, plasmacytoma. Among the diseases, disorders or conditions associated with BCMA (e.g., a BCMA-expressing cancer) that can be treated include, but are not limited to, neuroblastoma, renal cell carcinoma, colon cancer, colorectal cancer, breast cancer, epithelial squamous cell cancer, melanoma, myeloma (e.g., multiple myeloma), stomach cancer, brain cancer, lung cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, prostate cancer, testicular cancer, thyroid cancer, uterine cancer, adrenal cancer and head and neck cancer.
(335) In some embodiments, the methods may identify a subject who has, is suspected to have, or is at risk for developing a BCMA-associated disease or disorder. Hence, provided are methods for identifying subjects with diseases or disorders associated with elevated BCMA expression and selecting them for treatment with a provided BCMA-binding molecule, including any of the anti-BCMA antibodies, e.g., antibody fragments and proteins containing the same such as the recombinant receptors (e.g., CARs), and/or engineered cells expressing the recombinant receptors.
(336) For example, a subject may be screened for the presence of a disease or disorder associated with elevated BCMA expression, such as a BCMA-expressing cancer. In some embodiments, the methods include screening for or detecting the presence of a BCMA-associated disease, e.g. a tumor. Thus, in some aspects, a sample may be obtained from a patient suspected of having a disease or disorder associated with elevated BCMA expression and assayed for the expression level of BCMA. In some aspects, a subject who tests positive for a BCMA-associated disease or disorder may be selected for treatment by the present methods, and may be administered a therapeutically effective amount of a BCMA-binding molecule (e.g., anti-BCMA antibody or antigen-binding fragment thereof), recombinant receptor (e.g., CAR) comprising a BCMA-binding molecule, cells containing a recombinant receptor or a pharmaceutical composition thereof as described herein. In some embodiments, the methods can be used to monitor the size or density of a BCMA-expressing tissue, e.g. tumor, over time, e.g., before, during, or after treatment by the methods.
(337) In some embodiments, the subject has persistent or relapsed disease, e.g., following treatment with another BCMA-specific antibody and/or cells expressing a BCMA-targeting chimeric receptor and/or other therapy, including chemotherapy, radiation, and/or hematopoietic stem cell transplantation (HSCT), e.g., allogenic HSCT. In some embodiments, the administration effectively treats the subject despite the subject having become resistant to another BCMA-targeted therapy. In some embodiments, the subject has not relapsed but is determined to be at risk for relapse, such as at a high risk of relapse, and thus the compound or composition is administered prophylactically, e.g., to reduce the likelihood of or prevent relapse.
(338) In some embodiments, the treatment does not induce an immune response by the subject to the therapy, and/or does not induce such a response to a degree that prevents effective treatment of the disease or condition. In some aspects, the degree of immunogenicity and/or graft versus host response is less than that observed with a different but comparable treatment. For example, in the case of adoptive cell therapy using cells expressing CARs including the provided anti-BCMA antibodies, the degree of immunogenicity in some embodiments is reduced compared to CARs including a different antibody that binds to a similar, e.g., overlapping epitope and/or that competes for binding to BCMA with the provided antibody, such as a mouse or monkey or rabbit or humanized antibody.
(339) In some embodiments, the methods include adoptive cell therapy, whereby genetically engineered cells expressing the provided recombinant receptors comprising a BCMA-binding molecule (e.g., CARs comprising anti-BCMA antibody or antigen-binding fragment thereof) are administered to subjects. Such administration can promote activation of the cells (e.g., T cell activation) in a BCMA-targeted manner, such that the cells of the disease or disorder are targeted for destruction.
(340) Thus, the provided methods and uses include methods and uses for adoptive cell therapy. In some embodiments, the methods include administration of the cells, the plurality of cells a composition containing the cells or the plurality of cells to a subject, tissue, or cell, such as one having, at risk for, or suspected of having the disease, condition or disorder. In some embodiments, the cells, populations, and compositions are administered to a subject having the particular disease or condition to be treated, e.g., via adoptive cell therapy, such as adoptive T cell therapy. In some embodiments, the cells or compositions are administered to the subject, such as a subject having or at risk for the disease or condition. In some aspects, the methods thereby treat, e.g., ameliorate one or more symptom of the disease or condition, such as by lessening tumor burden in a BCMA-expressing cancer.
(341) Methods for administration of cells for adoptive cell therapy are known and may be used in connection with the provided methods and compositions. For example, adoptive T cell therapy methods are described, e.g., in US Patent Application Publication No. 2003/0170238 to Gruenberg et al; U.S. Pat. No. 4,690,915 to Rosenberg; Rosenberg (2011) Nat Rev Clin Oncol. 8(10):577-85). See, e.g., Themeli et al. (2013) Nat Biotechnol. 31(10): 928-933; Tsukahara et al. (2013) Biochem Biophys Res Commun 438(1): 84-9; Davila et al. (2013) PLoS ONE 8(4): e61338.
(342) In some embodiments, the cell therapy, e.g., adoptive cell therapy, e.g., adoptive T cell therapy, is carried out by autologous transfer, in which the cells are isolated and/or otherwise prepared from the subject who is to receive the cell therapy, or from a sample derived from such a subject. Thus, in some aspects, the cells are derived from a subject, e.g., patient, in need of a treatment and the cells, following isolation and processing are administered to the same subject.
(343) In some embodiments, the cell therapy, e.g., adoptive cell therapy, e.g., adoptive T cell therapy, is carried out by allogeneic transfer, in which the cells are isolated and/or otherwise prepared from a subject other than a subject who is to receive or who ultimately receives the cell therapy, e.g., a first subject. In such embodiments, the cells then are administered to a different subject, e.g., a second subject, of the same species. In some embodiments, the first and second subjects are genetically identical. In some embodiments, the first and second subjects are genetically similar. In some embodiments, the second subject expresses the same HLA class or supertype as the first subject.
(344) In some embodiments, the subject, to whom the cells, cell populations, or compositions are administered is a primate, such as a human. In some embodiments, the subject, to whom the cells, cell populations, or compositions are administered is a non-human primate. In some embodiments, the non-human primate is a monkey (e.g., cynomolgus monkey) or an ape. The subject can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects. In some embodiments, the subject is a non-primate mammal, such as a rodent (e.g., mouse, rat, etc.). In some examples, the patient or subject is a validated animal model for disease, adoptive cell therapy, and/or for assessing toxic outcomes such as cytokine release syndrome (CRS).
(345) The BCMA-binding molecules such as antibodies, recombinant receptors (e.g., CARs) containing the antibodies and cells expressing the same, can be administered by any suitable means, for example, by injection, e.g., intravenous or subcutaneous injections, intraocular injection, periocular injection, subretinal injection, intravitreal injection, trans-septal injection, subscleral injection, intrachoroidal injection, intracameral injection, subconjunctival injection, subconjunctival injection, sub-Tenon's injection, retrobulbar injection, peribulbar injection, or posterior juxtascleral delivery. In some embodiments, they are administered by parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, intracranial, intrathoracic, or subcutaneous administration. Dosing and administration may depend in part on whether the administration is brief or chronic. Various dosing schedules include but are not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion.
(346) For the prevention or treatment of disease, the appropriate dosage of the binding molecule, recombinant receptor or cell may depend on the type of disease to be treated, the type of binding molecule or recombinant receptor, the severity and course of the disease, whether the binding molecule or recombinant receptor is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the binding molecule, recombinant receptor or cell, and the discretion of the attending physician. The compositions and molecules and cells are in some embodiments suitably administered to the patient at one time or over a series of treatments.
(347) Depending on the type and severity of the disease, dosages of binding molecules (e.g., anti-BCMA antibody or antigen-binding fragment thereof) or recombinant receptors may include about 1 μg/kg to about 15 mg/kg (e.g. 0.1 mg/kg-10 mg/kg), about 1 mg/kg to about 100 mg/kg, about 0.05 mg/kg to about 10 mg/kg, about 0.5 mg/kg, about 2.0 mg/kg, about 4.0 mg/kg or about 10 mg/kg. Multiple doses may be administered intermittently, e.g. every week or every three weeks. An initial higher loading dose, followed by one or more lower doses may be administered.
(348) In certain embodiments, in the context of genetically engineered cells containing the binding molecules or recombinant receptors, a subject is administered the range of about one million to about 100 billion cells and/or that amount of cells per kilogram of body weight, such as, e.g., about 1 million to about 50 billion cells (e.g., about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, or a range defined by any two of the foregoing values), such as about 10 million to about 100 billion cells (e.g., about 20 million cells, about 30 million cells, about 40 million cells, about 60 million cells, about 70 million cells, about 80 million cells, about 90 million cells, about 10 billion cells, about 25 billion cells, about 50 billion cells, about 75 billion cells, about 90 billion cells, or a range defined by any two of the foregoing values), and in some cases about 100 million cells to about 50 billion cells (e.g., about 120 million cells, about 250 million cells, about 350 million cells, about 450 million cells, about 650 million cells, about 800 million cells, about 900 million cells, about 3 billion cells, about 30 billion cells, about 45 billion cells) or any value in between these ranges and/or per kilogram of body weight. Again, dosages may vary depending on attributes particular to the disease or disorder and/or patient and/or other treatments.
(349) In some embodiments, for example, where the subject is a human, the dose includes fewer than about 1×10.sup.8 total recombinant receptor (e.g., CAR)-expressing cells, T cells, or peripheral blood mononuclear cells (PBMCs), e.g., in the range of about 1×10.sup.6 to 1×10.sup.8 such cells, such as 2×10.sup.6, 5×10.sup.6, 1×10.sup.7, 5×10.sup.7, or 1×10.sup.8 or total such cells, or the range between any two of the foregoing values.
(350) In some aspects, the size of the dose is determined based on one or more criteria such as response of the subject to prior treatment, e.g. chemotherapy, disease burden in the subject, such as tumor load, bulk, size, or degree, extent, or type of metastasis, stage, and/or likelihood or incidence of the subject developing toxic outcomes, e.g., CRS, macrophage activation syndrome, tumor lysis syndrome, neurotoxicity, and/or a host immune response against the cells and/or recombinant receptors being administered.
(351) In some aspects, the size of the dose is determined by the burden of the disease or condition in the subject. For example, in some aspects, the number of cells administered in the dose is determined based on the tumor burden that is present in the subject immediately prior to administration of the initiation of the dose of cells. In some embodiments, the size of the first and/or subsequent dose is inversely correlated with disease burden. In some aspects, as in the context of a large disease burden, the subject is administered a low number of cells. In other embodiments, as in the context of a lower disease burden, the subject is administered a larger number of cells.
(352) In some embodiments, the cells, binding molecules, or recombinant receptors are administered as part of a combination treatment, such as simultaneously with or sequentially with, in any order, another therapeutic intervention, such as another antibody or engineered cell or receptor or agent, such as a cytotoxic or therapeutic agent, such as any described in Section I.C or III.B.
(353) The cells, binding molecules and/or recombinant receptors in some embodiments are co-administered with one or more additional therapeutic agents or in connection with another therapeutic intervention, either simultaneously or sequentially in any order. In some contexts, the cells are co-administered with another therapy sufficiently close in time such that the cell populations enhance the effect of one or more additional therapeutic agents, or vice versa. In some embodiments, the cells, binding molecules and/or recombinant receptors are administered prior to the one or more additional therapeutic agents. In some embodiments, the cells, binding molecules and/or recombinant receptors are administered after to the one or more additional therapeutic agents.
(354) Once the cells are administered to a mammal (e.g., a human), the biological activity of the engineered cell populations and/or antibodies in some aspects is measured by any of a number of known methods. Parameters to assess include specific binding of an engineered or natural T cell or other immune cell to antigen, in vivo, e.g., by imaging, or ex vivo, e.g., by ELISA or flow cytometry. In certain embodiments, the ability of the engineered cells to destroy target cells can be measured using any suitable method known in the art, such as cytotoxicity assays described in, for example, Kochenderfer et al., J. Immunotherapy, 32(7): 689-702 (2009), and Herman et al. J. Immunological Methods, 285(1): 25-40 (2004). In certain embodiments, the biological activity of the cells also can be measured by assaying expression and/or secretion of certain cytokines, such as CD 107a, IFNγ, IL-2, and TNF. In some aspects the biological activity is measured by assessing clinical outcome, such as reduction in tumor burden or load.
(355) In certain embodiments, engineered cells are modified in any number of ways, such that their therapeutic or prophylactic efficacy is increased. For example, the engineered CAR or TCR expressed by the population in some embodiments are conjugated either directly or indirectly through a linker to a targeting moiety. The practice of conjugating compounds, e.g., the CAR or TCR, to targeting moieties is known in the art. See, for instance, Wadwa et al., J. Drug Targeting, 3(2):111 (1995), and U.S. Pat. No. 5,087,616.
(356) B. Combination Therapy
(357) Also provided are methods of combination therapy that includes administering and uses, such as therapeutic and prophylactic uses, of the BCMA-binding molecules, including the anti-BCMA antibodies, e.g., antibody fragments and proteins containing the same such as the recombinant receptors (e.g., CARs), engineered cells expressing the recombinant receptors (e.g., CARs), plurality of engineered cells expressing the receptors, and/or compositions comprising the same.
(358) In some embodiments, the BCMA-binding molecule (e.g., antibody), immunoconjugate, recombinant receptor (e.g., chimeric antigen receptor) and/or engineered cells expressing said molecules (e.g., recombinant receptor) described herein are administered as part of a combination treatment or combination therapy, such as simultaneously with, sequentially with or intermittently with, in any order, one or more additional therapeutic intervention. In some embodiments, the one or more additional therapeutic intervention includes, for example, an antibody, an engineered cell, a receptor and/or an agent, such as a cell expressing a recombinant receptor, and/or cytotoxic or therapeutic agent, e.g., a chemotherapeutic agent. In some embodiments, the combination therapy includes administration of one or more additional agents, therapies and/or treatments, e.g., any of the additional agents, therapy and/or treatments described herein. In some embodiments, the combination therapy includes administration of one or more additional agents for treatment or therapy, such as an immunomodulatory agent, immune checkpoint inhibitor, adenosine pathway or adenosine receptor antagonist or agonist and kinase inhibitors. In some embodiments, the combination treatment or combination therapy includes an additional treatment, such as a surgical treatment, transplant, and/or radiation therapy. Also provided are methods of combination treatment or combination therapy that includes administering the binding molecules (e.g., BCMA-binding molecules), recombinant receptors, cells and/or compositions described herein and one or more additional therapeutic interventions.
(359) In some embodiments, the additional agent for combination treatment or combination therapy enhances, boosts and/or promotes the efficacy and/or safety of the therapeutic effect of binding molecules, recombinant receptors, cells and/or compositions. In some embodiments, the additional agent enhances or improves the efficacy, survival or persistence of the administered cells, e.g., cells expressing the binding molecule or a recombinant receptor. In some embodiments, the additional agent is selected from among a protein phosphatase inhibitor, a kinase inhibitor, a cytokine, an immunomodulator, or an agent that decreases the level or activity of a regulatory T (Treg) cell. In some embodiments, the additional agent enhances safety, by virtue of reducing or ameliorating adverse effects of the administered binding molecules, recombinant receptors, cells and/or compositions. In some embodiments, the additional agent can treat the same disease, condition or a comorbidity. In some embodiments, the additional agent can ameliorate, reduce or eliminate one or more toxicities, adverse effects or side effects that are associated with administration of the binding molecules, recombinant receptors, cells and/or compositions, e.g., CAR-expressing cells.
(360) In some embodiments, the additional therapy, treatment or agent includes chemotherapy, radiation therapy, surgery, transplantation, adoptive cell therapy, antibodies, cytotoxic agents, chemotherapeutic agents, cytokines, growth inhibitory agents, anti-hormonal agents, kinase inhibitors, anti-angiogenic agents, cardioprotectants, immunostimulatory agents, immunosuppressive agents, immune checkpoint inhibitors, antibiotics, angiogenesis inhibitors, metabolic modulators or other therapeutic agents or any combination thereof. In some embodiments, the additional agent is a protein, a peptide, a nucleic acid, a small molecule agent, a cell, a toxin, a lipid, a carbohydrate or combinations thereof, or any other type of therapeutic agent, e.g. radiation. In some embodiments, the additional therapy, agent or treatment includes surgery, chemotherapy, radiation therapy, transplantation, administration of cells expressing a recombinant receptor, e.g., CAR, kinase inhibitor, immune checkpoint inhibitor, mTOR pathway inhibitor, immunosuppressive agents, immunomodulators, antibodies, immunoablative agents, antibodies and/or antigen binding fragments thereof, antibody conjugates, other antibody therapies, cytotoxins, steroids, cytokines, peptide vaccines, hormone therapy, antimetabolites, metabolic modulators, drugs that inhibit either the calcium dependent phosphatase calcineurin or the p70S6 kinase FK506) or inhibit the p70S6 kinase, alkylating agents, anthracyclines, vinca alkaloids, proteasome inhibitors, GITR agonists, protein tyrosine phosphatase inhibitors, protein kinase inhibitors, an oncolytic virus, and/or other types of immunotherapy. In some embodiments, the additional agent or treatment is bone marrow transplantation, T cell ablative therapy using chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, and/or antibody therapy.
(361) In some embodiments, the cells, binding molecules (e.g., BCMA-binding molecules), recombinant receptors and/or compositions, e.g., CAR-expressing cells, are administered in combination with other engineered cells, e.g., other CAR-expressing cells. In some embodiments, the additional agent is a kinase inhibitor, e.g., an inhibitor of Bruton's tyrosine kinase (Btk), e.g., ibrutinib. In some embodiments, the additional agent is an adenosine pathway or adenosine receptor antagonist or agonist. In some embodiments, the additional agent is an immunomodulator such as thalidomide or a thalidomide derivative (e.g., lenalidomide). In some embodiments, the additional therapy, agent or treatment is a cytotoxic or chemotherapy agent, a biologic therapy (e.g., antibody, e.g., monoclonal antibody, or cellular therapy), or an inhibitor (e.g., kinase inhibitor).
(362) In some embodiments, a chemotherapeutic agent (sometimes referred to as a cytotoxic agent) is administered to the subject to disrupt a lesion. In certain embodiments, the lesion is tumor. In particular embodiments, the lesion is cancerous. In particular embodiments, the chemotherapeutic agent is any agent known to those of skill in the art to be effective for the treatment, prevention or amelioration of hyperproliferative disorders such as cancer. Chemotherapeutic agents include, but are not limited to, small molecules, synthetic drugs, peptides, polypeptides, proteins, nucleic acids (e.g., DNA and RNA polynucleotides including, but not limited to, antisense nucleotide sequences, triple helices and nucleotide sequences encoding biologically active proteins, polypeptides or peptides), antibodies, synthetic or natural inorganic molecules, mimetic agents, and synthetic or natural organic molecules. In particular embodiments, chemotherapeutic drugs include alkylating agents, anthracyclines, cytoskeletal disruptors (taxanes), epothilones, histone deacetylase inhibitors, topoisomerase inhibitors, topoisomerase II inhibitors, kinase inhibitors, nucleotide analogs and precursor analogs, peptide antibiotics, platinum-based agents, and vinca alkaloids and derivatives.
(363) In certain embodiments, a lesion is disrupted by administering a chemotherapeutic agent to modulate genetically engineered cells in vivo. Chemotherapeutic agents may include, but are not limited to, abarelix, aldesleukin, alemtuzumab, alitretinoin, allopurinol, altretamine, amifostine, anastrozole, arsenic trioxide, asparaginase, BCG live, bevaceizumab, bexarotene, bleomycin, bortezomib, busulfan, calusterone, camptothecin, capecitabine, carboplatin, carmustine, celecoxib, cetuximab, chlorambucil, cinacalcet, cisplatin, cladribine, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, darbepoetin alfa, daunorubicin, denileukin diftitox, dexrazoxane, docetaxel, doxorubicin, dromostanolone, Elliott's B solution, epirubicin, epoetin alfa, estramustine, etoposide, exemestane, filgrastim, floxuridine, fludarabine, fluorouracil, fulvestrant, gemcitabine, gemtuzumab ozogamicin, gefitinib, goserelin, hydroxyurea, ibritumomab tiuxetan, idarubicin, ifosfamide, imatinib, interferon alfa-2a, interferon alfa-2b, irinotecan, letrozole, leucovorin, levamisole, lomustine, meclorethamine, megestrol, melphalan, mercaptopurine, mesna, methotrexate, methoxsalen, methylprednisolone, mitomycin C, mitotane, mitoxantrone, nandrolone, nofetumomab, oblimersen, oprelvekin, oxaliplatin, paclitaxel, pamidronate, pegademase, pegaspargase, pegfilgrastim, pemetrexed, pentostatin, pipobroman, plicamycin, polifeprosan, porfimer, procarbazine, quinacrine, rasburicase, rituximab, sargramostim, streptozocin, talc, tamoxifen, tarceva, temozolomide, teniposide, testolactone, thioguanine, thiotepa, topotecan, toremifene, tositumomab, trastuzumab, tretinoin, uracil mustard, valrubicin, vinblastine, vincristine, vinorelbine, and zoledronate.
(364) In some embodiments, exemplary chemotherapeutic agents include an anthracycline (e.g., doxorubicin, such as liposomal doxorubicin); a vinca alkaloid (e.g., vinblastine, vincristine, vindesine, vinorelbine); an alkylating agent (e.g., cyclophosphamide, decarbazine, melphalan, ifosfamide, temozolomide); an immune cell antibody (e.g., alemtuzumab, gemtuzumab, rituximab, tositumomab); an antimetabolite (including, e.g., folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors such as fludarabine); a TNFR glucocorticoid induced TNFR related protein (GITR) agonist; a proteasome inhibitor (e.g., aclacinomycin A, gliotoxin or bortezomib); an immunomodulatory such as thalidomide or a thalidomide derivative (e.g., lenalidomide).
(365) In some embodiments, the additional therapy or treatment is cell therapy, e.g., adoptive cell therapy. In some embodiments, the additional therapy includes administration of engineered cells, e.g., additional CAR-expressing cell. In some embodiments, the additional engineered cell is a CAR-expressing cell that expresses the same or different recombinant receptor as the engineered cells provided herein, e.g., anti-BCMA CAR-expressing cells. In some embodiments, the recombinant receptor, e.g., CAR, expressed on the additional engineered cell, recognizes a different antigen and/or epitope. In some embodiments, the recombinant receptor, e.g., CAR, expressed on the additional engineered cell, recognizes a different epitope of the same antigen as the recombinant receptors described herein, e.g., BCMA. In some embodiments, the recombinant receptor, e.g., CAR, expressed on the additional engineered cell, recognizes a different antigen, e.g., a different tumor antigen or combination of antigens. For example, in some embodiments, the recombinant receptor, e.g., CAR, expressed on the additional engineered cell, targets cancer cells that express early lineage markers, e.g., cancer stem cells, while other CAR-expressing cells target cancer cells that express later lineage markers. In such embodiments, the additional engineered cell is administered prior to, concurrently with, or after administration (e.g., infusion) of the CAR-expressing cells described herein. In some embodiments, the additional engineered cell expresses allogeneic CAR.
(366) In some embodiments, the configurations of one or more of the CAR molecules comprise a primary intracellular signaling domain and two or more, e.g., 2, 3, 4, or 5 or more, costimulatory signaling domains. In some embodiments, the one or more of the CAR molecules may have the same or a different primary intracellular signaling domain, the same or different costimulatory signaling domains, or the same number or a different number of costimulatory signaling domains. In some embodiments, the one or more of the CAR molecules can be configured as a split CAR, in which one of the CAR molecules comprises an antigen binding domain and a costimulatory domain (e.g., 4-1BB), while the other CAR molecule comprises an antigen binding domain and a primary intracellular signaling domain (e.g., CD3 zeta).
(367) In some embodiments, the additional agent is any of the multispecific binding molecules and/or cells engineered to express one or more of the binding molecules described herein and/or cells engineered to express additional binding molecules, e.g., recombinant receptors, e.g., CAR, that target a different antigen. In some embodiments, the additional agent includes any of the cells or plurality of cells described herein, e.g., in Section I.C. In some embodiments, the additional agent is a cell engineered to express a recombinant receptor, e.g., CAR, targeting a different epitope and/or antigen, e.g., a different antigen associated with a disease or condition. In some embodiments, the additional agent is a cell engineered to express a recombinant receptor, e.g., CAR, targeting a second or additional antigen expressed in multiple myeloma, e.g., CD38, CD138, CS-1, BAFF-R, TACI and/or FcRH5.
(368) In some embodiments, the additional agent is an immunomodulatory agent. In some embodiments, the combination therapy includes an immunomodulatory agent that can stimulate, amplify and/or otherwise enhance an anti-tumor immune response, e.g. anti-tumor immune response from the administered engineered cells, such as by inhibiting immunosuppressive signaling or enhancing immunostimulant signaling. In some embodiments, the immunomodulatory agent is a peptide, protein or is a small molecule. In some embodiments, the protein can be a fusion protein or a recombinant protein. In some embodiments, the immunomodulatory agent binds to an immunologic target, such as a cell surface receptor expressed on immune cells, such a T cells, B cells or antigen-presenting cells. For example, in some embodiments, the immunomodulatory agent is an antibody or antigen-binding antibody fragment, a fusion protein, a small molecule or a polypeptide. In some embodiments, the binding molecules, recombinant receptors, cells and/or compositions are administered in combination with an additional agent that is an antibody or an antigen-binding fragment thereof, such as a monoclonal antibody.
(369) In some embodiments, the immunomodulatory agent blocks, inhibits or counteracts a component of the immune checkpoint pathway. The immune system has multiple inhibitory pathways that are involved in maintaining self-tolerance and for modulating immune responses. Tumors can use certain immune-checkpoint pathways as a major mechanism of immune resistance, particularly against T cells that are specific for tumor antigens (Pardoll (2012) Nature Reviews Cancer 12:252-264), e.g., engineered cells such as CAR-expressing cells. Because many such immune checkpoints are initiated by ligand-receptor interactions, they can be readily blocked by antibodies against the ligands and/or their receptors.
(370) Therefore, therapy with antagonistic molecules blocking an immune checkpoint pathway, such as small molecules, nucleic acid inhibitors (e.g., RNAi) or antibody molecules, are becoming promising avenues of immunotherapy for cancer and other diseases. In contrast to the majority of anti-cancer agents, checkpoint inhibitors do not necessarily target tumor cells directly, but rather target lymphocyte receptors or their ligands in order to enhance the endogenous antitumor activity of the immune system.
(371) As used herein, the term “immune checkpoint inhibitor” refers to molecules that totally or partially reduce, inhibit, interfere with or modulate one or more checkpoint proteins. Checkpoint proteins regulate T-cell activation or function. These proteins are responsible for co-stimulatory or inhibitory interactions of T-cell responses. Immune checkpoint proteins regulate and maintain self-tolerance and the duration and amplitude of physiological immune responses. In some embodiments, the subject can be administered an additional agent that can enhance or boost the immune response, e.g., immune response effected by the binding molecules (e.g., BCMA-binding molecules), recombinant receptors, cells and/or compositions provided herein, against a disease or condition, e.g., a cancer, such as any described herein.
(372) Immune checkpoint inhibitors include any agent that blocks or inhibits in a statistically significant manner, the inhibitory pathways of the immune system. Such inhibitors may include small molecule inhibitors or may include antibodies, or antigen binding fragments thereof, that bind to and block or inhibit immune checkpoint receptors, ligands and/or receptor-ligand interaction. In some embodiments, modulation, enhancement and/or stimulation of particular receptors can overcome immune checkpoint pathway components. Illustrative immune checkpoint molecules that may be targeted for blocking, inhibition, modulation, enhancement and/or stimulation include, but are not limited to, PD-1 (CD279), PD-L1 (CD274, B7-H1), PDL2 (CD273, B7-DC), CTLA-4, LAG-3 (CD223), TIM-3, 4-1BB (CD137), 4-1BBL (CD137L), GITR (TNFRSF18, AITR), CD40, OX40 (CD134, TNFRSF4), CXCR2, tumor associated antigens (TAA), B7-H3, B7-H4, BTLA, HVEM, GAL9, B7H3, B7H4, VISTA, KIR, 2B4 (belongs to the CD2 family of molecules and is expressed on all NK, γδ, and memory CD8+(αβ) T cells), CD160 (also referred to as BY55), CGEN-15049, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and a transforming growth factor receptor (TGFR; e.g., TGFR beta). Immune checkpoint inhibitors include antibodies, or antigen binding fragments thereof, or other binding proteins that bind to and block or inhibit and/or enhance or stimulate the activity of one or more of any of the said molecules.
(373) Exemplary immune checkpoint inhibitors include Tremelimumab (CTLA-4 blocking antibody, also known as ticilimumab, CP-675,206), anti-OX40, PD-L1 monoclonal antibody (Anti-B7-H1; MEDI4736), MK-3475 (PD-1 blocker), nivolumab (anti-PD-1 antibody), CT-011 (anti-PD-1 antibody), BY55 monoclonal antibody, AMP224 (anti-PD-L1 antibody), BMS-936559 (anti-PD-L1 antibody), MPLDL3280A (anti-PD-L1 antibody), MSB0010718C (anti-PD-L1 antibody) and ipilimumab (anti-CTLA-4 antibody, also known as Yervoy®, MDX-010 and MDX-101). Exemplary of immunomodulatory antibodies include, but are not limited to, Daclizumab (Zenapax), Bevacizumab (Avastin®)), Basiliximab, Ipilimumab, Nivolumab, pembrolizumab, MPDL3280A, Pidilizumab (CT-011), MK-3475, BMS-936559, MPDL3280A (Atezolizumab), tremelimumab, IMP321, BMS-986016, LAG525, urelumab, PF-05082566, TRX518, MK-4166, dacetuzumab (SGN-40), lucatumumab (HCD122), SEA-CD40, CP-870, CP-893, MEDI6469, MEDI6383, MOXR0916, AMP-224, MSB0010718C (Avelumab), MEDI4736, PDR001, rHIgM12B7, Ulocuplumab, BKT140, Varlilumab (CDX-1127), ARGX-110, MGA271, lirilumab (BMS-986015, IPH2101), IPH2201, ARGX-115, Emactuzumab, CC-90002 and MNRP1685A or an antibody-binding fragment thereof. Other exemplary immunomodulators include, e.g., afutuzumab (available from Roche®); pegfilgrastim (Neulasta®); lenalidomide (CC-5013, Revlimid®); thalidomide (Thalomid®), actimid (CC4047); and IRX-2 (mixture of human cytokines including interleukin 1, interleukin 2, and interferon .gamma., CAS 951209-71-5, available from IRX Therapeutics).
(374) Programmed cell death 1 (PD-1) is an immune checkpoint protein that is expressed in B cells, NK cells, and T cells (Shinohara et al., 1995, Genomics 23:704-6; Blank et al., 2007, Cancer Immunol Immunother 56:739-45; Finger et al., 1997, Gene 197:177-87; Pardoll (2012) Nature Reviews Cancer 12:252-264). The major role of PD-1 is to limit the activity of T cells in peripheral tissues during inflammation in response to infection, as well as to limit autoimmunity. PD-1 expression is induced in activated T cells and binding of PD-1 to one of its endogenous ligands acts to inhibit T-cell activation by inhibiting stimulatory kinases. PD-1 also acts to inhibit the TCR “stop signal”. PD-1 is highly expressed on Treg cells and may increase their proliferation in the presence of ligand (Pardoll (2012) Nature Reviews Cancer 12:252-264). Anti-PD 1 antibodies have been used for treatment of melanoma, non-small-cell lung cancer, bladder cancer, prostate cancer, colorectal cancer, head and neck cancer, triple-negative breast cancer, leukemia, lymphoma and renal cell cancer (Topalian et al., 2012, N Engl J Med 366:2443-54; Lipson et al., 2013, Clin Cancer Res 19:462-8; Berger et al., 2008, Clin Cancer Res 14:3044-51; Gildener-Leapman et al., 2013, Oral Oncol 49:1089-96; Menzies & Long, 2013, Ther Adv Med Oncol 5:278-85). Exemplary anti-PD-1 antibodies include nivolumab (Opdivo by BMS), pembrolizumab (Keytruda by Merck), pidilizumab (CT-011 by Cure Tech), lambrolizumab (MK-3475 by Merck), and AMP-224 (Merck), nivolumab (also referred to as Opdivo, BMS-936558 or MDX1106; Bristol-Myers Squibb) is a fully human IgG4 monoclonal antibody which specifically blocks PD-1. Nivolumab (clone 5C4) and other human monoclonal antibodies that specifically bind to PD-1 are described in U.S. Pat. No. 8,008,449 and WO2006/121168. Pidilizumab (CT-011; Cure Tech) is a humanized IgG1k monoclonal antibody that binds to PD-1. Pidilizumab and other humanized anti-PD-1 monoclonal antibodies are described in WO2009/101611. Pembrolizumab (formerly known as lambrolizumab, and also referred to as Keytruda, MK03475; Merck) is a humanized IgG4 monoclonal antibody that binds to PD-1. Pembrolizumab and other humanized anti-PD-1 antibodies are described in U.S. Pat. No. 8,354,509 and WO2009/114335. Other anti-PD-1 antibodies include AMP 514 (Amplimmune), among others, e.g., anti-PD-1 antibodies described in U.S. Pat. No. 8,609,089, US 2010028330, US 20120114649 and/or US 20150210769. AMP-224 (B7-DCIg; Amplimmune; e.g., described in WO2010/027827 and WO2011/066342), is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PD-1 and B7-H1.
(375) PD-L1 (also known as CD274 and B7-H1) and PD-L2 (also known as CD273 and B7-DC) are ligands for PD-1, found on activated T cells, B cells, myeloid cells, macrophages, and some types of tumor cells. Anti-tumor therapies have focused on anti-PD-L1 antibodies. The complex of PD-1 and PD-L1 inhibits proliferation of CD8+ T cells and reduces the immune response (Topalian et al., 2012, N Engl J Med 366:2443-54; Brahmer et al., 2012, N Eng J Med 366:2455-65). Anti-PD-L1 antibodies have been used for treatment of non-small cell lung cancer, melanoma, colorectal cancer, renal-cell cancer, pancreatic cancer, gastric cancer, ovarian cancer, breast cancer, and hematologic malignancies (Brahmer et al., 2012, N Eng J Med 366:2455-65; Ott et al., 2013, Clin Cancer Res 19:5300-9; Radvanyi et al., 2013, Clin Cancer Res 19:5541; Menzies & Long, 2013, Ther Adv Med Oncol 5:278-85; Berger et al., 2008, Clin Cancer Res 14:13044-51). Exemplary anti-PD-L1 antibodies include MDX-1105 (Medarex), MEDI4736 (Medimmune) MPDL3280A (Genentech), BMS-935559 (Bristol-Myers Squibb) and MSB0010718C. MEDI4736 (Medimmune) is a human monoclonal antibody that binds to PD-L1, and inhibits interaction of the ligand with PD-1. MDPL3280A (Genentech/Roche) is a human Fc optimized IgG1 monoclonal antibody that binds to PD-L1. MDPL3280A and other human monoclonal antibodies to PD-L1 are described in U.S. Pat. No. 7,943,743 and U.S Publication No. 20120039906. Other anti-PD-L1 binding agents include YW243.55.570 (see WO2010/077634) and MDX-1105 (also referred to as BMS-936559, and, e.g., anti-PD-L1 binding agents described in WO2007/005874).
(376) Cytotoxic T-lymphocyte-associated antigen (CTLA-4), also known as CD152, is a co-inhibitory molecule that functions to regulate T-cell activation. CTLA-4 is a member of the immunoglobulin superfamily that is expressed exclusively on T-cells. CTLA-4 acts to inhibit T-cell activation and is reported to inhibit helper T-cell activity and enhance regulatory T-cell immunosuppressive activity. Although the precise mechanism of action of CTLA-4 remains under investigation, it has been suggested that it inhibits T cell activation by outcompeting CD28 in binding to CD80 and CD86, as well as actively delivering inhibitor signals to the T cell (Pardoll (2012) Nature Reviews Cancer 12:252-264). Anti-CTLA-4 antibodies have been used in clinical trials for the treatment of melanoma, prostate cancer, small cell lung cancer, non-small cell lung cancer (Robert & Ghiringhelli, 2009, Oncologist 14:848-61; Ott et al., 2013, Clin Cancer Res 19:5300; Weber, 2007, Oncologist 12:864-72; Wada et al., 2013, J Transl Med 11:89). A significant feature of anti-CTLA-4 is the kinetics of anti-tumor effect, with a lag period of up to 6 months after initial treatment required for physiologic response. In some cases, tumors may actually increase in size after treatment initiation, before a reduction is seen (Pardoll (2012) Nature Reviews Cancer 12:252-264). Exemplary anti-CTLA-4 antibodies include ipilimumab (Bristol-Myers Squibb) and tremelimumab (Pfizer). Ipilimumab has recently received FDA approval for treatment of metastatic melanoma (Wada et al., 2013, J Transl Med 11:89).
(377) Lymphocyte activation gene-3 (LAG-3), also known as CD223, is another immune checkpoint protein. LAG-3 has been associated with the inhibition of lymphocyte activity and in some cases the induction of lymphocyte anergy. LAG-3 is expressed on various cells in the immune system including B cells, NK cells, and dendritic cells. LAG-3 is a natural ligand for the MHC class II receptor, which is substantially expressed on melanoma-infiltrating T cells including those endowed with potent immune-suppressive activity. Exemplary anti-LAG-3 antibodies include BMS-986016 (Bristol-Myers Squib), which is a monoclonal antibody that targets LAG-3. IMP701 (Immutep) is an antagonist LAG-3 antibody and IMP731 (Immutep and GlaxoSmithKline) is a depleting LAG-3 antibody. Other LAG-3 inhibitors include IMP321 (Immutep), which is a recombinant fusion protein of a soluble portion of LAG-3 and Ig that binds to MHC class II molecules and activates antigen presenting cells (APC). Other antibodies are described, e.g., in WO2010/019570 and US 2015/0259420
(378) T-cell immunoglobulin domain and mucin domain-3 (TIM-3), initially identified on activated Th1 cells, has been shown to be a negative regulator of the immune response. Blockade of TIM-3 promotes T-cell mediated anti-tumor immunity and has anti-tumor activity in a range of mouse tumor models. Combinations of TIM-3 blockade with other immunotherapeutic agents such as TSR-042, anti-CD137 antibodies and others, can be additive or synergistic in increasing anti-tumor effects. TIM-3 expression has been associated with a number of different tumor types including melanoma, NSCLC and renal cancer, and additionally, expression of intratumoral TIM-3 has been shown to correlate with poor prognosis across a range of tumor types including NSCLC, cervical, and gastric cancers. Blockade of TIM-3 is also of interest in promoting increased immunity to a number of chronic viral diseases. TIM-3 has also been shown to interact with a number of ligands including galectin-9, phosphatidylserine and HMGB1, although which of these, if any, are relevant in regulation of anti-tumor responses is not clear at present. In some embodiments, antibodies, antibody fragments, small molecules, or peptide inhibitors that target TIM-3 can bind to the IgV domain of TIM-3 to inhibit interaction with its ligands. Exemplary antibodies and peptides that inhibit TIM-3 are described in US 2015/0218274, WO2013/006490 and US 2010/0247521. Other anti-TIM-3 antibodies include humanized versions of RMT3-23 (Ngiow et al., 2011, Cancer Res, 71:3540-3551), and clone 8B.2C12 (Monney et al., 2002, Nature, 415:536-541). Bi-specific antibodies that inhibit TIM-3 and PD-1 are described in US 2013/0156774.
(379) In some embodiments, the additional agent is a CEACAM inhibitor (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5 inhibitor). In some embodiments, the inhibitor of CEACAM is an anti-CEACAM antibody molecule. Exemplary anti-CEACAM-1 antibodies are described in WO 2010/125571, WO 2013/082366 WO 2014/059251 and WO 2014/022332, e.g., a monoclonal antibody 34B1, 26H7, and 5F4; or a recombinant form thereof, as described in, e.g., US 2004/0047858, U.S. Pat. No. 7,132,255 and WO 99/052552. In some embodiments, the anti-CEACAM antibody binds to CEACAM-5 as described in, e.g., Zheng et al. PLoS One. (2011) 6(6): e21146), or cross-reacts with CEACAM-1 and CEACAM-5 as described in, e.g., WO 2013/054331 and US 2014/0271618.
(380) 4-1BB, also known as CD137, is transmembrane glycoprotein belonging to the TNFR superfamily. 4-1BB receptors are present on activated T cells and B cells and monocytes. An exemplary anti-4-1BB antibody is urelumab (BMS-663513), which has potential immunostimulatory and antineoplastic activities.
(381) Tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), also known as OX40 and CD134, is another member of the TNFR superfamily. OX40 is not constitutively expressed on resting naïve T cells and acts as a secondary co-stimulatory immune checkpoint molecule. Exemplary anti-OX40 antibodies are MEDI6469 and MOXR0916 (RG7888, Genentech).
(382) In some embodiments, the additional agent includes a molecule that decreases the regulatory T cell (Treg) population. Methods that decrease the number of (e.g., deplete) Treg cells are known in the art and include, e.g., CD25 depletion, cyclophosphamide administration, and modulating Glucocorticoid-induced TNFR family related gene (GITR) function. GITR is a member of the TNFR superfamily that is upregulated on activated T cells, which enhances the immune system. Reducing the number of Treg cells in a subject prior to apheresis or prior to administration of engineered cells, e.g., CAR-expressing cells, can reduce the number of unwanted immune cells (e.g., Tregs) in the tumor microenvironment and reduces the subject's risk of relapse. In some embodiments, the additional agent includes a molecule targeting GITR and/or modulating GITR functions, such as a GITR agonist and/or a GITR antibody that depletes regulatory T cells (Tregs). In some embodiments, the additional agent includes cyclophosphamide. In some embodiments, the GITR binding molecule and/or molecule modulating GITR function (e.g., GITR agonist and/or Treg depleting GITR antibodies) is administered prior to the engineered cells, e.g., CAR-expressing cells. For example, in some embodiments, the GITR agonist can be administered prior to apheresis of the cells. In some embodiments, cyclophosphamide is administered to the subject prior to administration (e.g., infusion or re-infusion) of the engineered cells, e.g., CAR-expressing cells or prior to apheresis of the cells. In some embodiments, cyclophosphamide and an anti-GITR antibody are administered to the subject prior to administration (e.g., infusion or re-infusion) of the engineered cells, e.g., CAR-expressing cells or prior to apheresis of the cells.
(383) In some embodiments, the additional agent is a GITR agonist. Exemplary GITR agonists include, e.g., GITR fusion proteins and anti-GITR antibodies (e.g., bivalent anti-GITR antibodies) such as, e.g., a GITR fusion protein described in U.S. Pat. No. 6,111,090, European Patent No. 090505B 1, U.S. Pat. No. 8,586,023, PCT Publication Nos.: WO 2010/003118 and 2011/090754, or an anti-GITR antibody described, e.g., in U.S. Pat. No. 7,025,962, European Patent No. 1947183B 1, U.S. Pat. Nos. 7,812,135, 8,388,967, 8,591,886, European Patent No. EP 1866339, PCT Publication No. WO 2011/028683, PCT Publication No. WO 2013/039954, PCT Publication No. WO2005/007190, PCT Publication No. WO 2007/133822, PCT Publication No. WO2005/055808, PCT Publication No. WO 99/40196, PCT Publication No. WO 2001/03720, PCT Publication No. WO99/20758, PCT Publication No. WO2006/083289, PCT Publication No. WO 2005/115451, U.S. Pat. No. 7,618,632, and PCT Publication No. WO 2011/051726. An exemplary anti-GITR antibody is TRX518.
(384) In some embodiments, the additional agent enhances tumor infiltration or transmigration of the administered cells, e.g., CAR-expressing cells. For example, in some embodiments, the additional agent stimulates CD40, such as CD40L, e.g., recombinant human CD40L. Cluster of differentiation 40 (CD40) is also a member of the TNFR superfamily. CD40 is a costimulatory protein found on antigen-presenting cells and mediates a broad variety of immune and inflammatory responses. CD40 is also expressed on some malignancies, where it promotes proliferation. Exemplary anti-CD40 antibodies are dacetuzumab (SGN-40), lucatumumab (Novartis, antagonist), SEA-CD40 (Seattle Genetics), and CP-870,893. In some embodiments, the additional agent that enhances tumor infiltration includes tyrosine kinase inhibitor sunitnib, heparanase, and/or chemokine receptors such as CCR2, CCR4, and CCR7.
(385) In some embodiments, the additional agent is a structural or functional analog or derivative of thalidomide and/or an inhibitor of E3 ubiquitin ligase. In some embodiments, the immunomodulatory agent binds to cereblon (CRBN). In some embodiments, the immunomodulatory agent binds to the CRBN E3 ubiquitin-ligase complex. In some embodiments, the immunomodulatory agent binds to CRBN and the CRBN E3 ubiquitin-ligase complex. In some embodiments, the immunomodulatory agent up-regulates the protein or gene expression of CRBN. In some aspects, CRBN is the substrate adaptor for the CRL4.sup.CRBN E3 ubiquitin ligase, and modulates the specificity of the enzyme. In some embodiments, binding to CRB or the CRBN E3 ubiquitin ligase complex inhibits E3 ubiquitin ligase activity. In some embodiments, the immunomodulatory agent induces the ubiquitination of KZF1 (Ikaros) and IKZF3 (Aiolos) and/or induces degradation of IKZF1 (Ikaros) and IKZF3 (Aiolos). In some embodiments, the immunomodulatory agent induces the ubiquitination of casein kinase 1A1 (CK1α) by the CRL4.sup.CRBN E3 ubiquitin ligase. In some embodiments, the ubiquitination of CK1α results in CK1α degradation.
(386) In some embodiments, the additional agent is an inhibitor of the Ikaros (IKZF1) transcription factor. In some embodiments, the additional agent enhances ubiquitination of Ikaros. In some embodiments, the additional agent enhances the degradation of Ikaros. In some embodiments, the additional agent down-regulates the protein or gene expression of Ikaros. In some embodiments, administration of the additional agent causes a decrease in Ikaros protein levels.
(387) In some embodiments, the additional agent is an inhibitor of the Aiolos (IKZF3) transcription factor. In some embodiments, the additional agent enhances ubiquitination of Aiolos. In some embodiments, the additional agent enhances the degradation of Aiolos. In some embodiments, the additional agent down-regulates the protein or gene expression of Aiolos. In some embodiments, administration of the additional agent causes a decrease in Aiolos protein levels.
(388) In some embodiments, the additional agent is an inhibitor of both the Ikaros (IKZF1) and Aiolos (IKZF3) transcription factors. In some embodiments, the additional agent enhances ubiquitination of both Ikaros and Aiolos. In some embodiments, the additional agent enhances the degradation of both Ikaros and Aiolos. In some embodiments, the additional agent enhances ubiquitination and degradation of both Ikaros and Aiolos. In some embodiments, administration of the additional agent causes both Aiolos protein levels and Ikaros protein levels to decrease.
(389) In some embodiments, the additional agent is a selective cytokine inhibitory drug (SelCID). In some embodiments, the additional agent inhibits the activity of phosphodiesterase-4 (PDE4). In some embodiments, the additional agent suppresses the enzymatic activity of the CDC25 phosphatases. In some embodiments, the additional agent alters the intracellular trafficking of CDC25 phosphatases.
(390) In some embodiments, the additional agent is thalidomide (2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione) or an analog or derivative of thalidomide. In certain embodiments, a thalidomide derivative includes structural variants of thalidomide that have a similar biological activity. Exemplary thalidomide derivatives include, but are not limited to lenalidomide (REVLIMMUNOMODULATORY COMPOUND™; Celgene Corporation), pomalidomide (also known as ACTIMMUNOMODULATORY COMPOUND™ or POMALYST™ (Celgene Corporation)), CC-1088, CDC-501, and CDC-801, and the compounds disclosed in U.S. Pat. Nos. 5,712,291; 7,320,991; and 8,716,315; U.S. Appl. No. 2016/0313300; and PCT Pub. Nos. WO 2002/068414 and WO 2008/154252.
(391) In some embodiments, the additional agent is 1-oxo- and 1,3 dioxo-2-(2,6-dioxopiperldin-3-yl) isoindolines substituted with amino in the benzo ring as described in U.S. Pat. No. 5,635,517 which is incorporated herein by reference.
(392) In some embodiments, the additional agent is a compound of the following formula:
(393) ##STR00001##
(394) wherein one of X and Y is —C(O)— and the other of X and Y is —C(O)— or —CH.sub.2—, and R.sup.5 is hydrogen or lower alkyl, or a pharmaceutically acceptable salt thereof. In some embodiments, X is —C(O)— and Y is —CH.sub.2—. In some embodiments, both X and Y are —C(O)—. In some embodiments, R.sup.5 is hydrogen. In other embodiments, R.sup.5 is methyl.
(395) In some embodiments, the additional agent is a compound that belongs to a class of substituted 2-(2, 6-dioxopiperidin-3-yl)phthalate immunomodulatory compounds and substituted 2-(2,6-dioxopiperldin-3-yl)-1-oxoisoindoles, such as those described in U.S. Pat. Nos. 6,281,230; 6,316,471; 6,335,349; and 6,476,052, and International Patent Application No. PCT/US97/13375 (International Publication No. WO 98/03502), each of which is incorporated herein by reference.
(396) In some embodiments, the additional agent is a compound of the following formula:
(397) ##STR00002##
(398) wherein
(399) one of X and Y is —C(O)— and the other of X and Y is —C(O)— or —CH.sub.2—;
(400) (1) each of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently halo, alkyl of 1 to 4 carbon atoms, or alkoxy or 1 to 4 carbon atoms, or
(401) (2) one of R.sup.1, R.sup.3, R.sup.4, and R.sup.5 is —NHR.sup.a and the remaining of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is are hydrogen, wherein R.sup.a is hydrogen or alkyl of 1 to 8 carbon atoms;
(402) R.sup.5 is hydrogen or alkyl of 1 to 8 carbon atoms, benzyl, or halo;
(403) provided that R.sup.5 is other than hydrogen if X and Y are —C(O)— and (i) each of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is fluoro; or (ii) one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is amino;
(404) or a pharmaceutically acceptable salt thereof.
(405) In some embodiments, the additional agent is a compound that belongs to a class of isoindole-immunomodulatory compounds disclosed in U.S. Pat. No. 7,091,353, U.S. Patent Publication No. 2003/0045552, and International Application No. PCT/USOI/50401 (International Publication No. WO02/059106), each of which are incorporated herein by reference. For example, in some embodiments, the additional agent is [2-(2,6-dioxo-piperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-ylmethyl]-amide; (2-(2,6-dioxo-piperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-ylmethyl)-carbamic acid tert-butyl ester; 4-(aminomethyl)-2-(2,6-dioxo(3-piperidyl))-isoindoline-1,3-dione; N-(2-(2,6-dioxo-piperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-ylmethyl)-acetamide; N-{(2-(2,6-dioxo(3-piperidyl)-1,3-dioxoisoindolin-4-yl)methyl}cyclopropyl-carboxamide; 2-chloro-N-{(2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl)methyl}acetamide; N-(2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl)-3-pyridylcarboxamide; 3-{1-oxo-4-(benzylamino)isoindolin-2-yl}piperidine-2,6-dione; 2-(2,6-dioxo(3-piperidyl))-4-(benzylamino)isoindoline-1,3-dione; N-{(2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl)methyl}propanamide; N-{(2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl)methyl}-3-pyridylcarboxamide; N-{(2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl)methyl}heptanamide; N-{(2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl)methyl}-2-furylcarboxamide; {N-(2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl)carbamoyl}methyl acetate; N-(2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl)pentanamide; N-(2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl)-2-thienylcarboxamide; N-{[2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl]methyl}(butylamino)carboxamide; N-{[2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl]methyl}(octylamino)carboxamide; or N-{[2-(2,6-dioxo(3-piperidyl))-1,3-dioxoisoindolin-4-yl]methyl}(benzylamino)carboxamide.
(406) In some embodiments, the additional agent is a compound that belongs to a class of isoindole-immunomodulatory compounds disclosed in U.S. Patent Application Publication Nos. 2002/0045643, International Publication No. WO 98/54170, and U.S. Pat. No. 6,395,754, each of which is incorporated herein by reference. In some embodiments, the additional agent is a tetra substituted 2-(2,6-dioxopiperdin-3-yl)-1-oxoisoindolines described in U.S. Pat. No. 5,798,368, which is incorporated herein by reference. In some embodiments, the additional agent is 1-oxo and 1,3-dioxo-2-(2,6-dioxopiperidin-3-yl) isoindolines disclosed in U.S. Pat. No. 6,403,613, which is incorporated herein by reference. In some embodiments the additional agent is a 1-oxo or 1,3-dioxoisoindoline substituted in the 4- or 5-position of the indoline ring as described in U.S. Pat. Nos. 6,380,239 and 7,244,759, both of which are incorporated herein by reference.
(407) In some embodiments, the additional agent is 2-(4-amino-1-oxo-1,3-dihydro-isoindol-2-yl)-4-carbamoyl-butyric acid or 4-(4-amino-1-oxo-1,3-dihydro-isoindol-2-yl)-4-carbamoyl-butyric acid. In some embodiments, the immunomodulatory compound is 4-carbamoyl-4-{4-[(furan-2-yl-methyl)-amino]-1,3-dioxo-1,3-dihydro-isoindol-2-yl}-butyric acid, 4-carbamoyl-2-{4-[(furan-2-yl-methyl)-amino]-1,3-dioxo-1,3-dihydro-isoindol-2-yl}-butyric acid, 2-{4-[(furan-2-yl-methyl)-amino]-1,3-dioxo-1,3-dihydro-isoindol-2-yl}-4-phenylcarbamoyl-butyric acid, or 2-{4-[(furan-2-yl-methyl)-amino]-1,3-dioxo-1,3-dihydro-isoindol-2-yl}-pentanedioic acid.
(408) In some embodiments, the additional agent is a isoindoline-1-one or isoindoline-1,3-dione substituted in the 2-position with 2,6-dioxo-3-hydroxypiperidin-5-yl as described in U.S. Pat. No. 6,458,810, which is incorporated herein by reference. In some embodiments, the immunomodulatory compound is 3-(5-amino-2-methyl-4-oxo-4H-quinazolin-3-yl)-piperidine-2,6-dione, or an enantiomer or a mixture of enantiomers thereof; or a pharmaceutically acceptable salt, solvate, hydrate, co-crystal, clathrate, or polymorph thereof. In some embodiments, the immunomodulatory compound is 3-[4-(4-morpholin-4-ylmethyl-benzyloxy)-1-oxo-1,3-dihydro-isoindol-2-yl]-piperidine-2,6-dione.
(409) In some embodiments, the additional agent is as described in Oshima, K. et al., Nihon Rinsho., 72(6):1130-5 (2014); Millrine, D. et al., Trends Mol Med., 23(4):348-364 (2017); and Collins, et al., Biochem J., 474(7):1127-1147 (2017).
(410) In some embodiments, the additional agent is lenalidomide, pomalidomide, avadomide, a stereoisomer of lenalidomide, pomalidomide, avadomide or a pharmaceutically acceptable salt, solvate, hydrate, co-crystal, clathrate, or polymorph thereof. In some embodiments, the immunomodulatory compound is lenalidomide, a stereoisomer of lenalidomide or a pharmaceutically acceptable salt, solvate, hydrate, co-crystal, clathrate, or polymorph thereof. In some embodiments, the immunomodulatory compound is lenalidomide, or ((RS)-3-(4-Amino-1-oxo-1,3-dihydro-2H-isoindol-2-yl)piperidine-2,6-dione).
(411) In certain embodiments, the lesion is disrupted by administering the thalidomide derivative lenalidomide, ((RS)-3-(4-Amino-1-oxo-1,3-dihydro-2H-isoindol-2-yl)piperidine-2,6-dione) to the subject. Lenalidomide is FDA approved for the treatment of multiple myeloma, myelodysplastic syndrome associated with deletion 5q, and most recently in relapsed/refractory mantle-cell lymphoma (MCL). Lenalidomide generally is a synthetic derivative of thalidomide, and is currently understood to have multiple immunomodulatory effects, including enforcement of immune synapse formation between T cell and antigen presenting cells (APCs). For example, in some cases, lenalidomide modulates T cell responses and results in increased interleukin (IL)-2 production in CD4.sup.+ and CD8.sup.+ T cells, induces the shift of T helper (Th) responses from Th2 to Th1, inhibits expansion of regulatory subset of T cells (Tregs), and improves functioning of immunological synapses in follicular lymphoma and chronic lymphocytic leukemia (CLL) (Otahal et al., Oncoimmunology (2016) 5(4):e1115940). Lenalidomide also has direct tumoricidal activity in patients with multiple myeloma (MM) and directly and indirectly modulates survival of CLL tumor cells by affecting supportive cells, such as nurse-like cells found in the microenvironment of lymphoid tissues. Lenalidomide also can enhance T-cell proliferation and interferon-γ production in response to activation of T cells via CD3 ligation or dendritic cell-mediated activation. In addition, lenalidomide is thought to decrease proliferation of pro-inflammatory cytokines including TNF-α, IL-1, IL-6, and IL-12 and enhance antibody-dependent cellular cytotoxicity (ADCC) via increased NK cell activation. Lenalidomide can also induce malignant B cells to express higher levels of immunostimulatory molecules such as CD80, CD86, HLA-DR, CD95, and CD40 (Fecteau et al., Blood (2014) 124(10):1637-1644). Cereblon, an E3 ubiquitin ligase, was identified as the primary target for thalidomide-induced teratogenesis (Ito et al., T., (2010) Science 327: 1345-1350). Lenalidomide also targets cereblon and it has been shown that this leads to the reduction of c-Myc and IRF4 expression while also increasing expression of p21 that leads to G1 cell-cycle arrest (Lopez-Girona et al., (2012) Leukemia 26: 2326-2335).
(412) In some embodiments, the additional agent includes thalidomide drugs or analogs thereof and/or derivatives thereof, such as lenalidomide, pomalidomide or apremilast. See, e.g., Bertilaccio et al., Blood (2013) 122:4171, Otahal et al., Oncoimmunology (2016) 5(4):e1115940; Fecteau et al., Blood (2014) 124(10):1637-1644 and Kuramitsu et al., Cancer Gene Therapy (2015) 22:487-495). Lenalidomide ((RS)-3-(4-Amino-1-oxo-1,3-dihydro-2H-isoindol-2-yl)piperidine-2,6-dione; also known as Revlimid) is a synthetic derivative of thalidomide, and has multiple immunomodulatory effects, including enforcement of immune synapse formation between T cell and antigen presenting cells (APCs). For example, in some cases, lenalidomide modulates T cell responses and results in increased interleukin (IL)-2 production in CD4+ and CD8+ T cells, induces the shift of T helper (Th) responses from Th2 to Th1, inhibits expansion of regulatory subset of T cells (Tregs), and improves functioning of immunological synapses in follicular lymphoma and chronic lymphocytic leukemia (CLL) (Otahal et al., Oncoimmunology (2016) 5(4):e1115940). Lenalidomide also has direct tumoricidal activity in patients with multiple myeloma (MM) and directly and indirectly modulates survival of CLL tumor cells by affecting supportive cells, such as nurse-like cells found in the microenvironment of lymphoid tissues. Lenalidomide also can enhance T-cell proliferation and interferon-γ production in response to activation of T cells via CD3 ligation or dendritic cell-mediated activation. Lenalidomide can also induce malignant B cells to express higher levels of immunostimulatory molecules such as CD80, CD86, HLA-DR, CD95, and CD40 (Fecteau et al., Blood (2014) 124(10):1637-1644).
(413) In some embodiments, the additional agent is a B-cell inhibitor. In some embodiments, the additional agent is one or more B-cell inhibitors selected from among inhibitors of CD10, CD19, CD20, CD22, CD34, CD123, CD79a, CD79b, CD179b, FLT-3, or ROR1, or a combination thereof. In some embodiments, the B-cell inhibitor is an antibody (e.g., a mono- or bispecific antibody) or an antigen binding fragment thereof. In some embodiments, the additional agent is an engineered cell expressing recombinant receptors that target B-cell targets, e.g., CD10, CD19, CD20, CD22, CD34, CD123, CD79a, CD79b, CD179b, FLT-3, or ROR1.
(414) In some embodiments, the additional agent is a CD20 inhibitor, e.g., an anti-CD20 antibody (e.g., an anti-CD20 mono- or bi-specific antibody) or a fragment thereof. Exemplary anti-CD20 antibodies include but are not limited to rituximab, ofatumumab, ocrelizumab (also known as GA101 or R05072759), veltuzumab, obinutuzumab, TRU-015 (Trubion Pharmaceuticals), ocaratuzumab (also known as AME-133v or ocaratuzumab), and Pro131921 (Genentech). See, e.g., Lim et al. Haematologica. (2010) 95(1):135-43. In some embodiments, the anti-CD20 antibody comprises rituximab. Rituximab is a chimeric mouse/human monoclonal antibody IgG1 kappa that binds to CD20 and causes cytolysis of a CD20 expressing cell. In some embodiments, the additional agent includes rituximab. In some embodiments, the CD20 inhibitor is a small molecule.
(415) In some embodiments, the additional agent is a CD22 inhibitor, e.g., an anti-CD22 antibody (e.g., an anti-CD22 mono- or bi-specific antibody) or a fragment thereof. Exemplary anti-CD22 antibodies include epratuzumab and RFB4. In some embodiments, the CD22 inhibitor is a small molecule. In some embodiments, the antibody is a monospecific antibody, optionally conjugated to a second agent such as a chemotherapeutic agent. For instance, in some embodiments, the antibody is an anti-CD22 monoclonal antibody-MMAE conjugate (e.g., DCDT2980S). In some embodiments, the antibody is an scFv of an anti-CD22 antibody, e.g., an scFv of antibody RFB4. In some embodiments, the scFv is fused to all of or a fragment of Pseudomonas exotoxin-A (e.g., BL22). In some embodiments, the scFv is fused to all of or a fragment of (e.g., a 38 kDa fragment of) Pseudomonas exotoxin-A (e.g., moxetumomab pasudotox). In some embodiments, the anti-CD22 antibody is an anti-CD19/CD22 bispecific antibody, optionally conjugated to a toxin. For instance, in some embodiments, the anti-CD22 antibody comprises an anti-CD19/CD22 bispecific portion, (e.g., two scFv ligands, recognizing human CD19 and CD22) optionally linked to all of or a portion of diphtheria toxin (DT), e.g., first 389 amino acids of diphtheria toxin (DT), DT 390, e.g., a ligand-directed toxin such as DT2219ARL). In some embodiments, the bispecific portion (e.g., anti-CD 19/anti-CD22) is linked to a toxin such as deglycosylated ricin A chain (e.g., Combotox).
(416) In some embodiments, the immunomodulatory agent is a cytokine. In some embodiments, the immunomodulatory agent is a cytokine or is an agent that induces increased expression of a cytokine in the tumor microenvironment. Cytokines have important functions related to T cell expansion, differentiation, survival, and homeostasis. Cytokines that can be administered to the subject receiving the binding molecules (e.g., BCMA-binding molecules), recombinant receptors, cells and/or compositions provided herein include one or more of IL-2, IL-4, IL-7, IL-9, IL-15, IL-18, and IL-21. In some embodiments, the cytokine administered is IL-7, IL-15, or IL-21, or a combination thereof. In some embodiments, administration of the cytokine to the subject that has sub-optimal response to the administration of the engineered cells, e.g., CAR-expressing cells improves efficacy and/or anti-tumor activity of the administered cells, e.g., CAR-expressing cells.
(417) By “cytokine” is meant a generic term for proteins released by one cell population that act on another cell as intercellular mediators. Examples of such cytokines are lymphokines, monokines, and traditional polypeptide hormones. Included among the cytokines are growth hormones such as human growth hormone, N-methionyl human growth hormone, and bovine growth hormone; parathyroid hormone; thyroxine; insulin; proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); hepatic growth factor; fibroblast growth factor; prolactin; placental lactogen; tumor necrosis factor-alpha and -beta; mullerian-inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor; integrin; thrombopoietin (TPO); nerve growth factors such as NGF-beta; platelet-growth factor; transforming growth factors (TGFs) such as TGF-alpha and TGF-beta; insulin-like growth factor-I and -II; erythropoietin (EPO); osteoinductive factors; interferons such as interferon-alpha, beta, and -gamma; colony stimulating factors (CSFs) such as macrophage-CSF (M-CSF); granulocyte-macrophage-CSF (GM-CSF); and granulocyte-CSF (G-CSF); interleukins (ILs) such as IL-1, IL-1alpha, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12; IL-15, a tumor necrosis factor such as TNF-alpha or TNF-beta; and other polypeptide factors including LIF and kit ligand (KL). As used herein, the term cytokine includes proteins from natural sources or from recombinant cell culture, and biologically active equivalents of the native sequence cytokines. For example, the immunomodulatory agent is a cytokine and the cytokine is IL-4, TNF-α, GM-CSF or IL-2.
(418) In some embodiments, the additional agent includes an interleukin-15 (IL-15) polypeptide, an interleukin-15 receptor alpha (IL-15Ra) polypeptide, or combination thereof, e.g., hetIL-15 (Admune Therapeutics, LLC). hetIL-15 is a heterodimeric non-covalent complex of IL-15 and IL-15Ra. hetIL-15 is described in, e.g., U.S. Pat. No. 8,124,084, U.S. 2012/0177598, U.S. 2009/0082299, U.S. 2012/0141413, and U.S. 2011/0081311. In some embodiments, the immunomodulatory agent can contain one or more cytokines. For example, the interleukin can include leukocyte interleukin injection (Multikine), which is a combination of natural cytokines. In some embodiments, the immunomodulatory agent is a Toll-like receptor (TLR) agonist, an adjuvant or a cytokine.
(419) In some embodiments, the additional agent is an agent that ameliorates or neutralizes one or more toxicities or side effects associated with the cell therapy. In some embodiments, the additional agent is selected from among a steroid (e.g., corticosteroid), an inhibitor of TNFα, and an inhibitor of IL-6. An example of a TNFα inhibitor is an anti-TNFα antibody molecule such as, infliximab, adalimumab, certolizumab pegol, and golimumab. Another example of a TNFα inhibitor is a fusion protein such as entanercept. Small molecule inhibitors of TNFα include, but are not limited to, xanthine derivatives (e.g. pentoxifylline) and bupropion. An example of an IL-6 inhibitor is an anti-IL-6 antibody molecule such as tocilizumab, sarilumab, elsilimomab, CNTO 328, ALD518/BMS-945429, CNTO 136, CPSI-2364, CDP6038, VX30, ARGX-109, FE301, and FM101. In some embodiments, the anti-IL-6 antibody molecule is tocilizumab. In some embodiments, the additional agent is an IL-1R inhibitor, such as anakinra.
(420) In some embodiments, the additional agent is a modulator of adenosine levels and/or an adenosine pathway component. Adenosine can function as an immunomodulatory agent in the body. For example, adenosine and some adenosine analogs that non-selectively activate adenosine receptor subtypes decrease neutrophil production of inflammatory oxidative products (Cronstein et al., Ann. N.Y. Acad. Sci. 451:291, 1985; Roberts et al., Biochem. J., 227:669, 1985; Schrier et al., J. Immunol. 137:3284, 1986; Cronstein et al., Clinical Immunol. Immunopath. 42:76, 1987). In some cases, concentration of extracellular adenosine or adenosine analogs can increase in specific environments, e.g., tumor microenvironment (TME). In some cases, adenosine or adenosine analog signaling depends on hypoxia or factors involved in hypoxia or its regulation, e.g., hypoxia inducible factor (HIF). In some embodiments, increase in adenosine signaling can increase in intracellular cAMP and cAMP-dependent protein kinase that results in inhibition of proinflammatory cytokine production, and can lead to the synthesis of immunosuppressive molecules and development of Tregs (Sitkovsky et al., Cancer Immunol Res (2014) 2(7):598-605). In some embodiments, the additional agent can reduce or reverse immunosuppressive effects of adenosine, adenosine analogs and/or adenosine signaling. In some embodiments, the additional agent can reduce or reverse hypoxia-driven A2-adenosinergic T cell immunosuppression. In some embodiments, the additional agent is selected from among antagonists of adenosine receptors, extracellular adenosine-degrading agents, inhibitors of adenosine generation by CD39/CD73 ectoenzymes, and inhibitors of hypoxia-HIF-1a signaling. In some embodiments, the additional agent is an adenosine receptor antagonist or agonist.
(421) Inhibition or reduction of extracellular adenosine or the adenosine receptor by virtue of an inhibitor of extracellular adenosine (such as an agent that prevents the formation of, degrades, renders inactive, and/or decreases extracellular adenosine), and/or an adenosine receptor inhibitor (such as an adenosine receptor antagonist) can enhance immune response, such as a macrophage, neutrophil, granulocyte, dendritic cell, T- and/or B cell-mediated response. In addition, inhibitors of the Gs protein mediated cAMP dependent intracellular pathway and inhibitors of the adenosine receptor-triggered Gi protein mediated intracellular pathways, can also increase acute and chronic inflammation.
(422) In some embodiments, the additional agent is an adenosine receptor antagonist or agonist, e.g., an antagonist or agonist of one or more of the adenosine receptors A2a, A2b, A1, and A3. A1 and A3 inhibit, and A2a and A2b stimulate, respectively, adenylate cyclase activity. Certain adenosine receptors, such as A2a, A2b, and A3, can suppress or reduce the immune response during inflammation. Thus, antagonizing immunosuppressive adenosine receptors can augment, boost or enhance immune response, e.g., immune response from administered cells, e.g., CAR-expressing T cells. In some embodiments, the additional agent inhibits the production of extracellular adenosine and adenosine-triggered signaling through adenosine receptors. For example, enhancement of an immune response, local tissue inflammation, and targeted tissue destruction can be enhanced by inhibiting or reducing the adenosine-producing local tissue hypoxia; by degrading (or rendering inactive) accumulated extracellular adenosine; by preventing or decreasing expression of adenosine receptors on immune cells; and/or by inhibiting/antagonizing signaling by adenosine ligands through adenosine receptors.
(423) An antagonist is any substance that tends to nullify the action of another, as an agent that binds to a cell receptor without eliciting a biological response. In some embodiments, the antagonist is a chemical compound that is an antagonist for an adenosine receptor, such as the A2a, A2b, or A3 receptor. In some embodiments, the antagonist is a peptide, or a peptidomimetic, that binds the adenosine receptor but does not trigger a Gi protein dependent intracellular pathway. Exemplary antagonists are described in U.S. Pat. Nos. 5,565,566; 5,545,627, 5,981,524; 5,861,405; 6,066,642; 6,326,390; 5,670,501; 6,117,998; 6,232,297; 5,786,360; 5,424,297; 6,313,131, 5,504,090; and 6,322,771.
(424) In some embodiments, the additional agent is an A2 receptor (A2R) antagonist, such as an A2a antagonist. Exemplary A2R antagonists include KW6002 (istradefyline), SCH58261, caffeine, paraxanthine, 3,7-dimethyl-1-propargylxanthine (DMPX), 8-(m-chlorostyryl) caffeine (CSC), MSX-2, MSX-3, MSX-4, CGS-15943, ZM-241385, SCH-442416, preladenant, vipadenant (B11014), V2006, ST-1535, SYN-115, PSB-1115, ZM241365, FSPTP, and an inhibitory nucleic acid targeting A2R expression, e.g., siRNA or shRNA, or any antibodies or antigen-binding fragment thereof that targets an A2R. In some embodiments, the additional agent is an A2R antagonist described in, e.g., Ohta et al., Proc Natl Acad Sci USA (2006) 103:13132-13137; Jin et al., Cancer Res. (2010) 70(6):2245-2255; Leone et al., Computational and Structural Biotechnology Journal (2015) 13:265-272; Beavis et al., Proc Natl Acad Sci USA (2013) 110:14711-14716; and Pinna, A., Expert Opin Investig Drugs (2009) 18:1619-1631; Sitkovsky et al., Cancer Immunol Res (2014) 2(7):598-605; U.S. Pat. Nos. 8,080,554; 8,716,301; US 20140056922; WO2008/147482; U.S. Pat. No. 8,883,500; US 20140377240; WO02/055083; U.S. Pat. Nos. 7,141,575; 7,405,219; 8,883,500; 8,450,329 and 8,987,279).
(425) In some embodiments, the antagonist is an antisense molecule, inhibitory nucleic acid molecule (e.g., small inhibitory RNA (siRNA)) or catalytic nucleic acid molecule (e.g. a ribozyme) that specifically binds mRNA encoding an adenosine receptor. In some embodiments, the antisense molecule, inhibitory nucleic acid molecule or catalytic nucleic acid molecule binds nucleic acids encoding A2a, A2b, or A3. In some embodiments, an antisense molecule, inhibitory nucleic acid molecule or catalytic nucleic acid targets biochemical pathways downstream of the adenosine receptor. For example, the antisense molecule or catalytic nucleic acid can inhibit an enzyme involved in the Gs protein- or Gi protein-dependent intracellular pathway. In some embodiments, the additional agent includes dominant negative mutant form of an adenosine receptor, such as A2a, A2b, or A3.
(426) In some embodiments, the additional agent that inhibits extracellular adenosine includes agents that render extracellular adenosine non-functional (or decrease such function), such as a substance that modifies the structure of adenosine to inhibit the ability of adenosine to signal through adenosine receptors. In some embodiments, the additional agent is an extracellular adenosine-generating or adenosine-degrading enzyme, a modified form thereof or a modulator thereof. For example, in some embodiments, the additional agent is an enzyme (e.g. adenosine deaminase) or another catalytic molecule that selectively binds and destroys the adenosine, thereby abolishing or significantly decreasing the ability of endogenously formed adenosine to signal through adenosine receptors and terminate inflammation.
(427) In some embodiments, the additional agent is an adenosine deaminase (ADA) or a modified form thereof, e.g., recombinant ADA and/or polyethylene glycol-modified ADA (ADA-PEG), which can inhibit local tissue accumulation of extracellular adenosine. ADA-PEG has been used in treatment of patients with ADA SCID (Hershfield (1995) Hum Mutat. 5:107). In some embodiments, an agent that inhibits extracellular adenosine includes agents that prevent or decrease formation of extracellular adenosine, and/or prevent or decrease the accumulation of extracellular adenosine, thereby abolishing, or substantially decreasing, the immunosuppressive effects of adenosine. In some embodiments, the additional agent specifically inhibits enzymes and proteins that are involved in regulation of synthesis and/or secretion of pro-inflammatory molecules, including modulators of nuclear transcription factors. Suppression of adenosine receptor expression or expression of the Gs protein- or Gi protein-dependent intracellular pathway, or the cAMP dependent intracellular pathway, can result in an increase/enhancement of immune response.
(428) In some embodiments, the additional agent can target ectoenzymes that generate or produce extracellular adenosine. In some embodiments, the additional agent targets CD39 and CD73 ectoenzymes, which function in tandem to generate extracellular adenosine. CD39 (also called ectonucleoside triphosphate diphosphohydrolase) converts extracellular ATP (or ADP) to 5′AMP. Subsequently, CD73 (also called 5′ nucleotidase) converts 5′AMP to adenosine. The activity of CD39 is reversible by the actions of NDP kinase and adenylate kinase, whereas the activity of CD73 is irreversible. CD39 and CD73 are expressed on tumor stromal cells, including endothelial cells and Tregs, and also on many cancer cells. For example, the expression of CD39 and CD73 on endothelial cells is increased under the hypoxic conditions of the tumor microenvironment. Tumor hypoxia can result from inadequate blood supply and disorganized tumor vasculature, impairing delivery of oxygen (Carroll and Ashcroft (2005), Expert. Rev. Mol. Med. 7(6):1-16). Hypoxia also inhibits adenylate kinase (AK), which converts adenosine to AMP, leading to very high extracellular adenosine concentration. Thus, adenosine is released at high concentrations in response to hypoxia, which is a condition that frequently occurs the tumor microenvironment (TME), in or around solid tumors. In some embodiments, the additional agent is one or more of anti-CD39 antibody or antigen binding fragment thereof, anti-CD73 antibody or antigen binding fragment thereof, e.g., MEDI9447 or TY/23, α-β-methylene-adenosine diphosphate (ADP), ARL 67156, POM-3, IPH52 (see, e.g., Allard et al. Clin Cancer Res (2013) 19(20):5626-5635; Hausler et al., Am J Transl Res (2014) 6(2):129-139; Zhang, B., Cancer Res. (2010) 70(16):6407-6411).
(429) In some embodiments, the additional agent is an inhibitor of hypoxia inducible factor 1 alpha (HIF-1α) signaling. Exemplary inhibitors of HIF-1α include digoxin, acriflavine, sirtuin-7 and ganetespib.
(430) In some embodiments, the additional agent includes a protein tyrosine phosphatase inhibitor, e.g., a protein tyrosine phosphatase inhibitor described herein. In some embodiments, the protein tyrosine phosphatase inhibitor is an SHP-1 inhibitor, e.g., an SHP-1 inhibitor described herein, such as, e.g., sodium stibogluconate. In some embodiments, the protein tyrosine phosphatase inhibitor is an SHP-2 inhibitor, e.g., an SHP-2 inhibitor described herein.
(431) In some embodiments, the additional agent is a kinase inhibitor. Kinase inhibitors, such as a CDK4 kinase inhibitor, a BTK kinase inhibitor, a MNK kinase inhibitor, or a DGK kinase inhibitor, can regulate the constitutively active survival pathways that exist in tumor cells and/or modulate the function of immune cells. In some embodiments, the kinase inhibitor is a Bruton's tyrosine kinase (BTK) inhibitor, e.g., ibrutinib. In some embodiments, the kinase inhibitor is a phosphatidylinositol-4,5-bisphosphate 3-kinase (PI3K) inhibitor. In some embodiments, the kinase inhibitor is a CDK4 inhibitor, e.g., a CDK4/6 inhibitor. In some embodiments, the kinase inhibitor is an mTOR inhibitor, such as, e.g., rapamycin, a rapamycin analog, OSI-027. The mTOR inhibitor can be, e.g., an mTORC1 inhibitor and/or an mTORC2 inhibitor, e.g., an mTORC1 inhibitor and/or mTORC2 inhibitor. In some embodiments, the kinase inhibitor is an MNK inhibitor, or a dual PI3K/mTOR inhibitor. In some embodiments, other exemplary kinase inhibitors include the AKT inhibitor perifosine, the mTOR inhibitor temsirolimus, the Src kinase inhibitors dasatinib and fostamatinib, the JAK2 inhibitors pacritinib and ruxolitinib, the PKCβ inhibitors enzastaurin and bryostatin, and the AAK inhibitor alisertib.
(432) In some embodiments, the kinase inhibitor is a BTK inhibitor selected from ibrutinib (PCI-32765); GDC-0834; RN-486; CGI-560; CGI-1764; HM-71224; CC-292; ONO-4059; CNX-774; and LFM-A13. In some embodiments, the BTK inhibitor does not reduce or inhibit the kinase activity of interleukin-2-inducible kinase (ITK), and is selected from GDC-0834; RN-486; CGI-560; CGI-1764; HM-71224; CC-292; ONO-4059; CNX-774; and LFM-A13.
(433) In some embodiments, the kinase inhibitor is a BTK inhibitor, e.g., ibrutinib (1-[(3R)-3-[4-Amino-3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]piperidin-1-yl]prop-2-en-1-one; also known as PCI-32765). In some embodiments, the kinase inhibitor is a BTK inhibitor, e.g., ibrutinib (PCI-32765). In some embodiments, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more cycles of ibrutinib are administered. In some embodiments, the BTK inhibitor is a BTK inhibitor described in International Application WO 2015/079417.
(434) In some embodiments, the kinase inhibitor is a PI3K inhibitor. PI3K is central to the PI3K/Akt/mTOR pathway involved in cell cycle regulation and lymphoma survival. Exemplary PI3K inhibitor includes idelalisib (PI3Kδ inhibitor). In some embodiments, the additional agent is idelalisib and rituximab.
(435) In some embodiments, the additional agent is an inhibitor of mammalian target of rapamycin (mTOR). In some embodiments, the kinase inhibitor is an mTOR inhibitor selected from temsirolimus; ridaforolimus (also known as AP23573 and MK8669); everolimus (RAD001); rapamycin (AY22989); simapimod; AZD8055; PF04691502; SF1126; and XL765. In some embodiments, the additional agent is an inhibitor of mitogen-activated protein kinase (MAPK), such as vemurafenib, dabrafenib, and trametinib.
(436) In some embodiments, the additional agent is an agent that regulates pro- or anti-apoptotic proteins. In some embodiments, the additional agent includes a B-cell lymphoma 2 (BCL-2) inhibitor (e.g., venetoclax, also called ABT-199 or GDC-0199; or ABT-737). Venetoclax is a small molecule (4-(4-{[2-(4-Chlorophenyl)-4,4-dimethyl-1-cyclohexen-1-yl]methyl}-1-piperazinyl)-N-({3-nitro-4-[(tetrahydro-2H-pyran-4-ylmethyl)amino]phenyl}sulfonyl)-2-(1H-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide) that inhibits the anti-apoptotic protein, BCL-2. Other agents that modulate pro- or anti-apoptotic protein include BCL-2 inhibitor ABT-737, navitoclax (ABT-263); Mcl-1 siRNA or Mcl-1 inhibitor retinoid N-(4-hydroxyphenyl) retinamide (4-HPR) for maximal efficacy. In some embodiments, the additional agent provides a pro-apoptotic stimuli, such as recombinant tumor necrosis factor-related apoptosis-inducing ligand (TRAIL), which can activate the apoptosis pathway by binding to TRAIL death receptors DR-4 and DR-5 on tumor cell surface, or TRAIL-R2 agonistic antibodies.
(437) In some embodiments, the additional agent includes an indoleamine 2,3-dioxygenase (IDO) inhibitor. IDO is an enzyme that catalyzes the degradation of the amino acid, L-tryptophan, to kynurenine. Many cancers overexpress IDO, e.g., prostatic, colorectal, pancreatic, cervical, gastric, ovarian, head, and lung cancer. Plasmacytoid dendritic cells (pDCs), macrophages, and dendritic cells (DCs) can express IDO. In some aspects, a decrease in L-tryptophan (e.g., catalyzed by IDO) results in an immunosuppressive milieu by inducing T-cell anergy and apoptosis. Thus, in some aspects, an IDO inhibitor can enhance the efficacy of the binding molecules (e.g., BCMA-binding molecules), recombinant receptors, cells and/or compositions described herein, e.g., by decreasing the suppression or death of the administered CAR-expressing cell. Exemplary inhibitors of IDO include but are not limited to 1-methyl-tryptophan, indoximod, and INCB024360 (epacadostat).
(438) In some embodiments, the additional agent includes a cytotoxic agent, e.g., CPX-351 (Celator Pharmaceuticals), cytarabine, daunorubicin, vosaroxin (Sunesis Pharmaceuticals), sapacitabine (Cyclacel Pharmaceuticals), idarubicin, or mitoxantrone. In some embodiments, the additional agent includes a hypomethylating agent, e.g., a DNA methyltransferase inhibitor, e.g., azacitidine or decitabine.
(439) In another embodiment, the additional therapy is a transplantation, e.g., allogeneic stem cell transplant.
(440) In some embodiments, the additional therapy is a lymphodepleting therapy. In some embodiments, lymphodepletion is performed on a subject, e.g., prior to administering engineered cells, e.g., CAR-expressing cells. In some embodiments, the lymphodepletion comprises administering one or more of melphalan, Cytoxan, cyclophosphamide, and fludarabine. In some embodiments, a lymphodepleting chemotherapy is administered to the subject prior to, concurrently with, or after administration (e.g., infusion) of engineered cells, e.g., CAR-expressing cells. In an example, the lymphodepleting chemotherapy is administered to the subject prior to administration of engineered cells, e.g., CAR-expressing cells.
(441) In some embodiments, the additional agent is an oncolytic virus. In some embodiments, oncolytic viruses are capable of selectively replicating in and triggering the death of or slowing the growth of a cancer cell. In some cases, oncolytic viruses have no effect or a minimal effect on non-cancer cells. An oncolytic virus includes but is not limited to an oncolytic adenovirus, oncolytic Herpes Simplex Viruses, oncolytic retrovirus, oncolytic parvovirus, oncolytic vaccinia virus, oncolytic Sinbis virus, oncolytic influenza virus, or oncolytic RNA virus (e.g., oncolytic reovirus, oncolytic Newcastle Disease Virus (NDV), oncolytic measles virus, or oncolytic vesicular stomatitis virus (VSV)).
(442) Other exemplary combination therapy, treatment and/or agents include anti-allergenic agents, anti-emetics, analgesics and adjunct therapies. In some embodiments, the additional agent includes cytoprotective agents, such as neuroprotectants, free-radical scavengers, cardioprotectors, anthracycline extravasation neutralizers and nutrients.
(443) In some embodiments, an antibody used as an additional agent is conjugated or otherwise bound to a therapeutic agent, e.g., a chemotherapeutic agent (e.g., Cytoxan, fludarabine, histone deacetylase inhibitor, demethylating agent, peptide vaccine, anti-tumor antibiotic, tyrosine kinase inhibitor, alkylating agent, anti-microtubule or anti-mitotic agent), anti-allergic agent, anti-nausea agent (or anti-emetic), pain reliever, or cytoprotective agent described herein. In some embodiments, the additional agent is an antibody-drug conjugate.
(444) In some embodiments, the additional agent can modulate, inhibit or stimulate particular factors at the DNA, RNA or protein levels, to enhance or boost the efficacy of the binding molecules (e.g., BCMA-binding molecules), recombinant receptors, cells and/or compositions provided herein. In some embodiments, the additional agent can modulate the factors at the nucleic acid level, e.g., DNA or RNA, within the administered cells, e.g., cells engineered to express recombinant receptors, e.g., CAR. In some embodiments, an inhibitory nucleic acid, e.g., an inhibitory nucleic acid, e.g., a dsRNA, e.g., an siRNA or shRNA, or a clustered regularly interspaced short palindromic repeats (CRISPR), a transcription-activator like effector nuclease (TALEN), or a zinc finger endonuclease (ZFN), can be used to inhibit expression of an inhibitory molecule in the engineered cell, e.g., CAR-expressing cell. In some embodiments the inhibitor is an shRNA. In some embodiments, the inhibitory molecule is inhibited within the engineered cell, e.g., CAR-expressing cell. In some embodiments, a nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is operably linked to a promoter, e.g., a HI- or a U6-derived promoter such that the dsRNA molecule that inhibits expression of the inhibitory molecule is expressed within the engineered cell, e.g., CAR-expressing cell. See, e.g., Brummelkamp T R, et al. (2002) Science 296: 550-553; Miyagishi M, et al. (2002) Nat. Biotechnol. 19: 497-500.
(445) In some embodiments, the additional agent is capable of disrupting the gene encoding an inhibitory molecule, such as any immune checkpoint inhibitors described herein. In some embodiments, disruption is by deletion, e.g., deletion of an entire gene, exon, or region, and/or replacement with an exogenous sequence, and/or by mutation, e.g., frameshift or missense mutation, within the gene, typically within an exon of the gene. In some embodiments, the disruption results in a premature stop codon being incorporated into the gene, such that the inhibitory molecule is not expressed or is not expressed in a form that is capable of being expressed on the cells surface and/or capable of mediating cell signaling. The disruption is generally carried out at the DNA level. The disruption generally is permanent, irreversible, or not transient.
(446) In some aspects, the disruption is carried out by gene editing, such as using a DNA binding protein or DNA-binding nucleic acid, which specifically binds to or hybridizes to the gene at a region targeted for disruption. In some aspects, the protein or nucleic acid is coupled to or complexed with a nuclease, such as in a chimeric or fusion protein. For example, in some embodiments, the disruption is effected using a fusion comprising a DNA-targeting protein and a nuclease, such as a Zinc Finger Nuclease (ZFN) or TAL-effector nuclease (TALEN), or an RNA-guided nuclease such as a clustered regularly interspersed short palindromic nucleic acid (CRISPR)-Cas system, such as CRISPR-Cas9 system, specific for the gene being disrupted. In some embodiments, methods of producing or generating genetically engineered cells, e.g., CAR-expressing cells, include introducing into a population of cells nucleic acid molecules encoding a genetically engineered antigen receptor (e.g. CAR) and nucleic acid molecules encoding an agent targeting an inhibitory molecule that is a gene editing nuclease, such as a fusion of a DNA-targeting protein and a nuclease such as a ZFN or a TALEN, or an RNA-guided nuclease such as of the CRISPR-Cas9 system, specific for an inhibitory molecule.
(447) Any of the additional agents described herein can be prepared and administered as combination therapy with the BCMA-binding molecule (e.g., antibody), immunoconjugate, recombinant receptor (e.g., chimeric antigen receptor) and/or engineered cells expressing said molecules (e.g., recombinant receptor) described herein, such as in pharmaceutical compositions comprising one or more agents of the combination therapy and a pharmaceutically acceptable carrier, such as any described herein. In some embodiments, the BCMA-binding molecule (e.g., antibody), immunoconjugate, recombinant receptor (e.g., chimeric antigen receptor), engineered cells expressing said molecules (e.g., recombinant receptor), plurality of engineered cells expressing said molecules (e.g., recombinant receptor) can be administered simultaneously, concurrently or sequentially, in any order with the additional agents, therapy or treatment, wherein such administration provides therapeutically effective levels each of the agents in the body of the subject. The agents can be co-administered with the binding molecules (e.g., BCMA-binding molecules), recombinant receptors, cells and/or compositions described herein, for example, as part of the same pharmaceutical composition or using the same method of delivery. In some embodiments, the additional agent is incubated with the engineered cell, e.g., CAR-expressing cells, prior to administration of the cells.
(448) In some examples, the one or more additional agents are administered subsequent to or prior to the administration of the binding molecules (e.g., BCMA-binding molecules), recombinant receptors, cells and/or compositions described herein, separated by a selected time period. In some examples, the time period is 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, or 3 months. In some examples, the one or more additional agents are administered multiple times and/or the binding molecules (e.g., BCMA-binding molecules), recombinant receptors, cells and/or compositions described herein, is administered multiple times. For example, in some embodiments, the additional agent is administered prior to the binding molecules (e.g., BCMA-binding molecules), recombinant receptors, cells and/or compositions described herein, e.g., two weeks, 12 days, 10 days, 8 days, one week, 6 days, 5 days, 4 days, 3 days, 2 days or 1 day before the administration. For example, in some embodiments, the additional agent is administered after the binding molecules (e.g., BCMA-binding molecules), recombinant receptors, cells and/or compositions described herein, e.g., two weeks, 12 days, 10 days, 8 days, one week, 6 days, 5 days, 4 days, 3 days, 2 days or 1 day after the administration.
(449) The dose of the additional agent can be any therapeutically effective amount, e.g., any dose amount described herein, and the appropriate dosage of the additional agent may depend on the type of disease to be treated, the type, dose and/or frequency of the binding molecule, recombinant receptor, cell and/or composition administered, the severity and course of the disease, whether the binding molecule, recombinant receptor, cell and/or composition is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the binding molecule, recombinant receptor, cell and/or composition, and the discretion of the attending physician. The binding molecule, recombinant receptor, cell and/or composition and/or the additional agent and/or therapy can be administered to the patient at one time, repeated or administered over a series of treatments.
(450) C. Diagnostic and Detection Methods
(451) Also provided are methods involving use of the provided binding molecules, e.g., antibodies or antigen-binding fragments thereof, in detection of BCMA, for example, in diagnostic and/or prognostic methods in association with a BCMA-expressing disease or condition. The methods in some embodiments include incubating a biological sample with the antibody or antigen-binding fragment thereof and/or administering the antibody or antigen-binding fragment thereof to a subject. In certain embodiments, a biological sample includes a cell or tissue, such as tumor or cancer tissue. In certain embodiments, the contacting is under conditions permissive for binding of the anti-BCMA antibody to BCMA, and detecting whether a complex is formed between the anti-BCMA antibody and BCMA. Such a method may be an in vitro or in vivo method. In one embodiment, an anti-BCMA antibody (e.g., antigen-binding fragment) is used to select subjects eligible for therapy with an anti-BCMA antibody (e.g., antigen-binding fragment) or recombinant receptor, e.g. where BCMA is a biomarker for selection of patients.
(452) In some embodiments, a sample, such as a cell, tissue sample, lysate, composition, or other sample derived therefrom is contacted with the anti-BCMA antibody (e.g., antigen-binding fragment) and binding or formation of a complex between the antibody and the sample (e.g., BCMA in the sample) is determined or detected. When binding in the test sample is demonstrated or detected as compared to a reference cell of the same tissue type, it may indicate the presence of an associated disease or condition. In some embodiments, the sample is from human tissues.
(453) Various methods known in the art for detecting specific antibody-antigen binding can be used. Exemplary immunoassays include fluorescence polarization immunoassay (FPIA), fluorescence immunoassay (FIA), enzyme immunoassay (EIA), nephelometric inhibition immunoassay (NIA), enzyme linked immunosorbent assay (ELISA), and radioimmunoassay (RIA). An indicator moiety, or label group, can be attached to the subject antibodies and is selected so as to meet the needs of various uses of the method which are often dictated by the availability of assay equipment and compatible immunoassay procedures. Exemplary labels include radionuclides (e.g. .sup.125I, .sup.131I, .sup.35S, .sup.3H, or .sup.32P), enzymes (e.g., alkaline phosphatase, horseradish peroxidase, luciferase, or β-galactosidase), fluorescent moieties or proteins (e.g., fluorescein, rhodamine, phycoerythrin, GFP, or BFP), or luminescent moieties (e.g., Qdot™ nanoparticles supplied by the Quantum Dot Corporation, Palo Alto, Calif.). General techniques to be used in performing the various immunoassays noted above are known to those of ordinary skill in the art.
(454) For purposes of diagnosis, the antibodies (e.g., antigen-binding fragments) can be labeled with a detectable moiety including but not limited to radioisotopes, fluorescent labels, and various enzyme-substrate labels know in the art. Methods of conjugating labels to an antibody are known in the art.
(455) In some embodiments, antibodies (e.g., antigen-binding fragments) need not be labeled, and the presence thereof can be detected using a labeled antibody which binds to the antibodies.
(456) The provided antibodies (e.g., antigen-binding fragments) in some embodiments can be employed in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays. Zola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC Press, Inc. 1987).
(457) The antibodies (e.g., antigen-binding fragments) and polypeptides can also be used for in vivo diagnostic assays, such as in vivo imaging. Generally, the antibody is labeled with a radionuclide (such as .sup.111In, .sup.99Tc, .sup.14C, .sup.131I, .sup.125I, or .sup.3H) so that the cells or tissue of interest can be localized in vivo following administration to a subject.
(458) The antibody (e.g., antigen-binding fragment) may also be used as staining reagent in pathology, e.g., using known techniques.
III. Articles of Manufacture or Kits
(459) Also provided are articles of manufacture or kit containing the provided binding molecules (e.g., antibodies), recombinant receptors (e.g., CARs), genetically engineered cells, and/or compositions comprising the same. The articles of manufacture may include a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, test tubes, IV solution bags, etc. The containers may be formed from a variety of materials such as glass or plastic. In some embodiments, the container has a sterile access port. Exemplary containers include an intravenous solution bags, vials, including those with stoppers pierceable by a needle for injection. The article of manufacture or kit may further include a package insert indicating that the compositions can be used to treat a particular condition such as a condition described herein (e.g., multiple myeloma). Alternatively, or additionally, the article of manufacture or kit may further include another or the same container comprising a pharmaceutically-acceptable buffer. It may further include other materials such as other buffers, diluents, filters, needles, and/or syringes.
(460) The label or package insert may indicate that the composition is used for treating the BCMA-expressing or BCMA-associated disease, disorder or condition in an individual. The label or a package insert, which is on or associated with the container, may indicate directions for reconstitution and/or use of the formulation. The label or package insert may further indicate that the formulation is useful or intended for subcutaneous, intravenous, or other modes of administration for treating or preventing a BCMA-expressing or BCMA-associated disease, disorder or condition in an individual.
(461) The container in some embodiments holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition. The article of manufacture or kit may include (a) a first container with a composition contained therein (i.e., first medicament), wherein the composition includes the antibody (e.g., anti-BCMA antibody) or antigen-binding fragment thereof or recombinant receptor (e.g., CAR); and (b) a second container with a composition contained therein (i.e., second medicament), wherein the composition includes a further agent, such as a cytotoxic or otherwise therapeutic agent, and which article or kit further comprises instructions on the label or package insert for treating the subject with the second medicament, in an effective amount.
IV. Definitions
(462) As used herein, reference to a “corresponding form” of an antibody means that when comparing a property or activity of two antibodies, the property is compared using the same form of the antibody. For example, if it is stated that an antibody has greater activity compared to the activity of the corresponding form of a first antibody, that means that a particular form, such as an scFv of that antibody, has greater activity compared to the scFv form of the first antibody.
(463) “Effector functions” refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: C1q binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
(464) The term “Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. In one embodiment, a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.
(465) The terms “full length antibody,” “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
(466) An “isolated” antibody is one which has been separated from a component of its natural environment. In some embodiments, an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC). For review of methods for assessment of antibody purity, see, e.g., Flatman et al., J. Chromatogr. B 848:79-87 (2007).
(467) An “isolated” nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
(468) “Isolated nucleic acid encoding an anti-BCMA antibody” refers to one or more nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
(469) The terms “host cell,” “host cell line,” and “host cell culture” are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
(470) As used herein, “percent (%) amino acid sequence identity” and “percent identity” and “sequence identity” when used with respect to an amino acid sequence (reference polypeptide sequence) is defined as the percentage of amino acid residues in a candidate sequence (e.g., the subject antibody or fragment) that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
(471) An amino acid substitution may include replacement of one amino acid in a polypeptide with another amino acid. Amino acid substitutions may be introduced into a binding molecule, e.g., antibody, of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
(472) Amino acids generally can be grouped according to the following common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe.
(473) Non-conservative amino acid substitutions will involve exchanging a member of one of these classes for another class.
(474) The term “vector,” as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as “expression vectors.”
(475) The term “package insert” is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
(476) As used herein, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. For example, “a” or “an” means “at least one” or “one or more.” It is understood that aspects, embodiments, and variations described herein include “comprising,” “consisting,” and/or “consisting essentially of” aspects, embodiments and variations.
(477) Throughout this disclosure, various aspects of the claimed subject matter are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the claimed subject matter. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, where a range of values is provided, it is understood that each intervening value, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the claimed subject matter. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and are also encompassed within the claimed subject matter, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the claimed subject matter. This applies regardless of the breadth of the range.
(478) The term “about” as used herein refers to the usual error range for the respective value readily known to the skilled person in this technical field. Reference to “about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X”.
(479) As used herein, a “composition” refers to any mixture of two or more products, substances, or compounds, including cells. It may be a solution, a suspension, liquid, powder, a paste, aqueous, non-aqueous or any combination thereof.
(480) As used herein, a statement that a cell or population of cells is “positive” for a particular marker refers to the detectable presence on or in the cell of a particular marker, typically a surface marker. When referring to a surface marker, the term refers to the presence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is detectable by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control under otherwise identical conditions and/or at a level substantially similar to that for cell known to be positive for the marker, and/or at a level substantially higher than that for a cell known to be negative for the marker.
(481) As used herein, a statement that a cell or population of cells is “negative” for a particular marker refers to the absence of substantial detectable presence on or in the cell of a particular marker, typically a surface marker. When referring to a surface marker, the term refers to the absence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is not detected by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control under otherwise identical conditions, and/or at a level substantially lower than that for cell known to be positive for the marker, and/or at a level substantially similar as compared to that for a cell known to be negative for the marker.
(482) Unless defined otherwise, all terms of art, notations and other technical and scientific terms or terminology used herein are intended to have the same meaning as is commonly understood by one of ordinary skill in the art to which the claimed subject matter pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art.
IV. Exemplary Embodiments
(483) Among the embodiments provided herein are:
(484) 1. An antibody or antigen-binding fragment thereof, wherein said antibody or antigen-binding fragment comprises a heavy chain variable (V.sub.H) region comprising:
(485) a heavy chain complementarity determining region 3 (CDR-H3) comprising the amino acid sequence selected from any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378; or
(486) a CDR-H3 contained within the heavy chain variable (V.sub.H) region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(487) 2. An antibody or antigen-binding fragment thereof, wherein said antibody or antigen-binding fragment comprises a V.sub.H region having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(488) 3. The antibody or antigen-binding fragment of embodiment 2, wherein the V.sub.H region comprises a CDR-H3 comprising the amino acid sequence X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13X.sub.14 (SEQ ID NO:355), wherein X.sub.1 is A, D, E, G, L, V or W; X.sub.2 is A, D, G, L, P, Q or S; X.sub.3 is A, D, G, L or Y; X.sub.4 is D, G, P, R, S, V, Y or null; X.sub.5 is D, I, P, S, T, Y or null; X.sub.6 is A, G, I, S, T, V, Y or null; X.sub.7 is A, D, E, F, L, P, S, Y or null; X.sub.8 is P, Q, T, Y or null; X.sub.9 is D, G, R, Y or null; X.sub.10 is A, F, Y or null; X.sub.11 is D, F or null; X.sub.12 is F or null; X.sub.13 is D, T or Y; and X.sub.14 is I, L, N, V or Y.
(489) 4. The antibody or antigen-binding fragment of embodiment 2 or embodiment 3, wherein the V.sub.H region comprises:
(490) a CDR-H3 comprising the amino acid sequence selected from any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378; or
(491) a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(492) 5. The antibody or antigen-binding fragment of any one of embodiments 1-4, wherein the V.sub.H region comprises:
(493) a heavy chain complementarity determining region 1 (CDR-H1) comprising the amino acid sequence X.sub.1X.sub.2X.sub.3MX.sub.4 (SEQ ID NO:353) X.sub.1 is D or S; X.sub.2 is Y or S; X.sub.3 is A, G, W, or Y; and X.sub.4 is H, Q, or S; and/or
(494) a heavy chain complementarity determining region 2 (CDR-H2) comprising the amino acid sequence X.sub.1IX.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11YX.sub.12X.sub.13X.sub.14X.sub.15X.sub.16X.sub.17 (SEQ ID NO:354), wherein X.sub.1 is F, G, H, V, W or Y; X.sub.2 is N, R, S or V; X.sub.3 is P, Q, S, V, W or Y; X.sub.4 is K or null; X.sub.5 is A or null; X.sub.6 is D, G, N, S, or Y; X.sub.7 is G or S; X.sub.8 is G or S; X.sub.9 is E, G, N, T or S; X.sub.10 is I, K, or T; X.sub.11 is E, G, N or Y; X.sub.12 is A or V; X.sub.13 is A, D or Q; X.sub.14 is K or S; X.sub.15 is F or V; X.sub.16 is K or Q; and X.sub.17 is E or G.
(495) 6. The antibody or antigen-binding fragment of any one of embodiments 1-5, wherein the V.sub.H region comprises:
(496) a heavy chain complementarity determining region 1 (CDR-H1) comprising the amino acid sequence selected from any one of SEQ ID NOs:1-3 and 140-144; and/or
(497) a heavy chain complementarity determining region 2 (CDR-H2) comprising the amino acid sequence selected from any one of SEQ ID NOs:4-6, 145-148 and 372-374.
(498) 7. The antibody or antigen-binding fragment of any one of embodiments 1-6, wherein the V.sub.H region comprises:
(499) a CDR-H1 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533; and/or
(500) a CDR-H2 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(501) 8. The antibody or antigen-binding fragment thereof of embodiment 7, wherein:
(502) the CDR-H1 comprises the amino acid sequence selected from any one of SEQ ID NOs: 1-3, 141, 143 and 144 or a CDR-H1 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522;
(503) the CDR-H2 comprises the amino acid sequence selected from any one of SEQ ID NOs: 4-6, 145, 147, 148 and 372 or a CDR-H2 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522; and/or
(504) the CDR-H3 comprises the amino acid sequence selected from any one of SEQ ID NOs: 7-10, 149, 153-157 and 376 or a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522.
(505) 9. The antibody or antigen-binding fragment thereof of embodiment 7 or embodiment 8, wherein:
(506) the CDR-H1 comprises the amino acid sequence of SEQ ID NO:1 or a CDR-H1 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 115 and 256;
(507) the CDR-H2 comprises the amino acid sequence of SEQ ID NO:5 or a CDR-H2 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 115 and 256; and/or the CDR-H3 comprises the amino acid sequence selected from any one of SEQ ID NOs: 10 and 157 or a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 115 and 256.
(508) 10. An antibody or antigen-binding fragment thereof, comprising a heavy chain variable (V.sub.H) region comprising a heavy chain complementarity determining region 1 (CDR-H1), CDR-H2, and CDR-H3, wherein:
(509) the CDR-H1 comprises the amino acid sequence selected from any one of SEQ ID NOs:1-3 and 140-144 or a CDR-H1 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533;
(510) the CDR-H2 comprises the amino acid sequence selected from any one of SEQ ID NOs:4-6, 145-148 and 372-374 or a CDR-H2 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533; and/or the CDR-H3 comprises the amino acid sequence selected from any one of SEQ ID NOs:7-11, 149-157, 279-287 and 376-378 or a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(511) 11. The antibody or antigen-binding fragment thereof of embodiment 10, wherein:
(512) the CDR-H1 comprises the amino acid sequence selected from any one of SEQ ID NOs: 1-3, 141, 143 and 144 or a CDR-H1 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522;
(513) the CDR-H2 comprises the amino acid sequence selected from any one of SEQ ID NOs: 4-6, 145, 147, 148 and 372 or a CDR-H2 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522; and/or
(514) the CDR-H3 comprises the amino acid sequence selected from any one of SEQ ID NOs: 7-10, 149, 153-157 and 376 or a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-113, 115, 248, 252-256 and 518-522.
(515) 12. The antibody or antigen-binding fragment thereof of embodiment 10 or embodiment 11, wherein:
(516) the CDR-H1 comprises the amino acid sequence of SEQ ID NO:1 or a CDR-H1 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 115 and 256;
(517) the CDR-H2 comprises the amino acid sequence of SEQ ID NO:5 or a CDR-H2 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 115 and 256; and/or
(518) the CDR-H3 comprises the amino acid sequence selected from any one of SEQ ID NOs: 10 and 157 or a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 115 and 256.
(519) 13. The antibody or antigen-binding fragment of any one of embodiments 1-10, comprising a V.sub.H region comprising a CDR-H1, CDR-H2, and CDR-H3, selected from:
(520) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:1, 4, and 7, respectively;
(521) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 8, respectively;
(522) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 9, respectively;
(523) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 10, respectively;
(524) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 6, and 11, respectively;
(525) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:140, 145, and 149, respectively;
(526) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:141, 145, and 149, respectively;
(527) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:141, 145, and 150, respectively;
(528) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:142, 146, and 151, respectively;
(529) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 152, respectively;
(530) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:143, 147, and 153, respectively;
(531) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:144, 148, and 154, respectively;
(532) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 6, and 155, respectively;
(533) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 156, respectively;
(534) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 157, respectively;
(535) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 6, and 376, respectively;
(536) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 372, and 376, respectively;
(537) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 6, and 376, respectively;
(538) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 6, and 377, respectively;
(539) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 373, and 152, respectively;
(540) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 378, respectively; or a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 374, and 9, respectively.
(541) 14. The antibody or antigen-binding fragment of embodiment 13, wherein the CDR-H1, CDR-H2, and CDR-H3, are selected from:
(542) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:1, 4, and 7, respectively;
(543) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 8, respectively;
(544) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 9, respectively;
(545) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 10, respectively;
(546) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:141, 145, and 149, respectively;
(547) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:143, 147, and 153, respectively;
(548) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:144, 148, and 154, respectively;
(549) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 6, and 155, respectively;
(550) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 156, respectively;
(551) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 5, and 157, respectively;
(552) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:2, 6, and 376, respectively;
(553) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs:3, 372, and 376, respectively; or a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of and SEQ ID NOs:3, 6, and 376, respectively;
(554) 15. The antibody or antigen-binding fragment of embodiment 13, wherein the CDR-H1, CDR-H2, and CDR-H3, are selected from:
(555) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of SEQ ID NOs: 2, 5, and 10, respectively; or
(556) a CDR-H1, CDR-H2, and CDR-H3 comprising the amino acid sequence of and SEQ ID NOs: 2, 5, and 157, respectively;
(557) 16. An antibody or antigen-binding fragment thereof, wherein said antibody or antigen-binding fragment comprises a V.sub.H region comprising a CDR-H1, a CDR-H2, and a CDR-H3, respectively, comprising the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(558) 17. The antibody or antigen-binding fragment thereof of embodiment 16, wherein the CDR-H1, the CDR-H2, and the CDR-H3, respectively, comprise the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 110-113, 115, 248, 252-256 and 518-522.
(559) 18. The antibody or antigen-binding fragment thereof of embodiment 16 or embodiment 17, wherein the CDR-H1, the CDR-H2, and the CDR-H3, respectively, comprise the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 115 and 256.
(560) 19. The antibody or antigen-binding fragment of any one of embodiments 1-16, wherein the V.sub.H region comprises a framework region 1 (FR1), a FR2, a FR3, and/or a FR4 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity, respectively, to a FR1, FR2, FR3, and/or FR4 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(561) 20. The antibody or antigen-binding fragment of any one of embodiments 1-19, wherein the V.sub.H region comprises a FR1, a FR2, a FR3, and/or a FR4, selected from:
(562) a FR1 comprising the amino acid sequence selected from any one of SEQ ID NOs:59-63, 195-203 and 434-439;
(563) the FR2 comprising the amino acid sequence selected from any one of SEQ ID NOs:64-66 and 204-209;
(564) a FR3 comprising the amino acid sequence selected from any one of SEQ ID NOs:67-69, 210-216, 441 and 443; and/or
(565) a FR4 comprising the amino acid sequence selected from any one of SEQ ID NOs:70-71, 217-220, 444 and 445.
(566) 21. The antibody or antigen-binding fragment of any one of embodiments 1-16, wherein the V.sub.H region comprises the amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(567) 22. The antibody or antigen-binding fragment thereof of embodiment 21, wherein the V.sub.H region comprises the amino acid sequence selected from any one of SEQ ID NOs: 110-113, 115, 248, 252-256 and 518-522.
(568) 23. The antibody or antigen-binding fragment thereof of embodiment 21 or embodiment 22, wherein the V.sub.H region comprises the amino acid sequence selected from any one of SEQ ID NOs: 115 and 256.
(569) 24. The antibody or antigen-binding fragment of any one of embodiments 1-21, wherein the antibody or antigen-binding fragment does not comprise a light chain variable (V.sub.L) region, does not comprise a light chain complementarity determining region (CDR-L1), CDR-L2, and/or CDR-L3, and/or is a single-domain antibody (sdAb) comprising only the V.sub.H region.
(570) 25. The antibody or antigen-binding fragment of any one of embodiments 1-24, wherein the antibody or antigen-binding fragment is an sdAb comprising only the V.sub.H region.
(571) 26. The antibody or antigen-binding fragment of any one of embodiments 1-21, wherein the antibody or antigen-binding fragment further comprises a V.sub.L region.
(572) 27. The antibody or antigen-binding fragment of embodiment 26, wherein the V.sub.L region has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(573) 28. The antibody or antigen-binding fragment of embodiment 26 or embodiment 27, wherein the V.sub.L region comprises a light chain complementarity determining region 3 (CDR-L3) comprising the amino acid sequence X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12, (SEQ ID NO:358), wherein X.sub.1 is A, C, G, H, I, Q or S; X.sub.2 is A, Q, S or V; X.sub.3 is 5, W or Y; X.sub.4 is D, F, G, H or Y; X.sub.5 is D, G, M, R, S or T; X.sub.6 is A, G, H, L, R, S, T or Y; X.sub.7 is L, P, R, S or null; X.sub.8 is D, G, N, R, S, T or null; X.sub.9 is A, G, H, L, P or null; X.sub.10 is F, S or null; X.sub.11 is L, P, W or Y; and X.sub.12 is S, T or V.
(574) 29. The antibody of antigen-binding fragment of any one of embodiments 26-28, wherein the V.sub.L region comprises a light chain complementarity determining region 3 (CDR-L3) comprising the amino acid sequence selected from any one of SEQ ID NOs:47-58, 184-194, 415-427 and 429-433, or a CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(575) 30. The antibody or antigen-binding fragment of any one of embodiments 26-29, wherein the V.sub.L region comprises:
(576) a light chain complementarity determining region 1 (CDR-L1) comprising the amino acid sequence X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13X.sub.14X.sub.15X.sub.16X.sub.17 (SEQ ID NO:356), wherein X.sub.1 is G, K, R, S or T; X.sub.2 is A, G or S; X.sub.3 is G, N, S or T; X.sub.4 is G, K, N, Q, R or S; X.sub.5 is S or null; X.sub.6 is D, N, V or null; X.sub.7 is L, V or null; X.sub.8 is H, S, Y or null; X.sub.9 is S, T or null; X.sub.10 is S or null; X.sub.11 is D, G, I, N, S or null; X.sub.12 is D, E, G, K, I, N or null; X.sub.13 is F, G, K, N, R, S, Y or null; X.sub.14 is D, K, N, T or null; X.sub.15 is A, D, G, L, N, S, T or Y; X.sub.16 is L or V; X.sub.17 is A, H, N, Q or S; and/or
(577) a light chain complementarity determining region 2 (CDR-L2) comprising the amino acid sequence X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7 (SEQ ID NO:357), wherein X.sub.1 is A, D, E, N, S, V or W; X.sub.2 is A, D, N, S or V; X.sub.3 is A, D, H, I, N or S; X.sub.4 is D, K, N, Q, R or T; X.sub.5 is L, R or V; X.sub.6 is A, E, P or Q; and X.sub.7 is A, D, S or T.
(578) 31. The antibody or antigen-binding fragment of any one of embodiments 26-30, wherein the V.sub.L region comprises:
(579) a light chain complementarity determining region 1 (CDR-L1) comprising the amino acid sequence selected from any one of SEQ ID NOs:26-36, 174-178, 380-392 and 394-398; and/or
(580) a light chain complementarity determining region 2 (CDR-L2) comprising the amino acid sequence selected from any one of SEQ ID NOs:37-46, 179-183, 399-409 and 411-414.
(581) 32. The antibody or antigen-binding fragment of any one of embodiments 26-31, wherein the V.sub.L region comprises:
(582) a CDR-L1 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557; and/or
(583) a CDR-L2 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(584) 33. The antibody or antigen-binding fragment of any one of embodiments 26-32, wherein the V.sub.L region comprises:
(585) a CDR-L1 comprising the amino acid sequence selected from any one of SEQ ID NOs:26-36, 174-178, 380-392 and 394-398;
(586) a CDR-L2 comprising the amino acid sequence selected from any one of SEQ ID NOs:37-46, 179-183, 399-409 and 411-414; and/or
(587) a CDR-L3 comprising the amino acid sequence selected from any one of SEQ ID NOs:47-58, 184-194, 415-427 and 429-433.
(588) 34. The antibody or antigen-binding fragment of embodiment 33, wherein the V.sub.L region comprises:
(589) a CDR-L1 comprising the amino acid sequence selected from any one of SEQ ID NOs: 26-28, 30, 31, 33, 34, 174, 176-178 and 380-382;
(590) a CDR-L2 comprising the amino acid sequence selected from any one of SEQ ID NOs: 37-39, 41, 43, 44, 179, 181-183 and 399-401; and/or
(591) a CDR-L3 comprising the amino acid sequence selected from any one of SEQ ID NOs: 47-49, 51, 52, 55, 56, 185, 189-194, 415-418 and 421.
(592) 35. The antibody or antigen-binding fragment of embodiment 33 or embodiment 34, wherein the V.sub.L region comprises:
(593) a CDR-L1 comprising the amino acid sequence selected from any one of SEQ ID NOs: 33 and 178;
(594) a CDR-L2 comprising the amino acid sequence selected from any one of SEQ ID NOs: 43 and 183; and/or
(595) a CDR-L3 comprising the amino acid sequence selected from any one of SEQ ID NOs: 194 and 421.
(596) 36. The antibody or antigen-binding fragment of any one of embodiments 26-33, wherein the V.sub.L region comprises a CDR-L1, CDR-L2, and CDR-L3 selected from:
(597) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:26, 37, and 47, respectively;
(598) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:27, 38, and 48, respectively;
(599) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:28, 39, and 49, respectively;
(600) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:29, 40, and 50, respectively;
(601) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:30, 39, and 51, respectively;
(602) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:31, 41, and 52, respectively;
(603) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:32, 42, and 53, respectively;
(604) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:30, 39, and 54, respectively;
(605) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:33, 43, and 55, respectively;
(606) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:34, 44, and 56, respectively;
(607) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:35, 45, and 57, respectively;
(608) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:36, 46, and 58, respectively;
(609) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 184, respectively;
(610) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 185, respectively;
(611) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 186, respectively;
(612) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 187, respectively;
(613) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:175, 180, and 188, respectively;
(614) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 189, respectively;
(615) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:176, 181, and 190, respectively;
(616) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:177, 182, and 191, respectively;
(617) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 192, respectively;
(618) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:178, 183, and 193, respectively;
(619) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:178, 183, and 194, respectively;
(620) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:30, 399, and 415, respectively;
(621) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:380, 400, and 416, respectively;
(622) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:33, 43, and 421, respectively;
(623) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:381, 401, and 417, respectively;
(624) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:382, 402, and 418, respectively;
(625) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:383, 403, and 419, respectively;
(626) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:384, 39, and 54, respectively;
(627) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:385, 180, and 58, respectively;
(628) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:175, 180, and 188, respectively;
(629) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:386, 404, and 420, respectively;
(630) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:387, 405, and 422, respectively;
(631) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:388, 406, and 423, respectively;
(632) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:388, 407, and 424, respectively;
(633) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:389, 408, and 425, respectively;
(634) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:390, 183, and 193, respectively;
(635) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:391, 409, and 426, respectively;
(636) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:392, 40, and 427, respectively;
(637) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:394, 39, and 429, respectively;
(638) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:395, 411, and 430, respectively;
(639) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:396, 412, and 431, respectively;
(640) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:396, 412, and 58, respectively;
(641) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:397, 413, and 432, respectively; or a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:398, 414, and 433, respectively.
(642) 37. The antibody or antigen-binding fragment of embodiment 36, wherein the CDR-L1, CDR-L2, and CDR-L3 are selected from:
(643) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:26, 37, and 47, respectively;
(644) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:27, 38, and 48, respectively;
(645) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:28, 39, and 49, respectively;
(646) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:29, 40, and 50, respectively;
(647) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:30, 39, and 51, respectively;
(648) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:31, 41, and 52, respectively;
(649) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:32, 42, and 53, respectively;
(650) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:30, 39, and 54, respectively;
(651) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:33, 43, and 55, respectively;
(652) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:34, 44, and 56, respectively;
(653) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:35, 45, and 57, respectively;
(654) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:36, 46, and 58, respectively;
(655) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 184, respectively;
(656) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 185, respectively;
(657) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 186, respectively;
(658) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 187, respectively;
(659) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:175, 180, and 188, respectively;
(660) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 189, respectively;
(661) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:176, 181, and 190, respectively;
(662) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:177, 182, and 191, respectively;
(663) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:174, 179, and 192, respectively;
(664) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:178, 183, and 193, respectively;
(665) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:178, 183, and 194, respectively;
(666) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:30, 399, and 415, respectively;
(667) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:380, 400, and 416, respectively;
(668) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:33, 43, and 421, respectively;
(669) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:381, 401, and 417, respectively;
(670) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:382, 402, and 418, respectively;
(671) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:383, 403, and 419, respectively;
(672) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:384, 39, and 54, respectively;
(673) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:385, 180, and 58, respectively;
(674) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:175, 180, and 188, respectively;
(675) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:386, 404, and 420, respectively;
(676) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:387, 405, and 422, respectively;
(677) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:388, 406, and 423, respectively;
(678) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:388, 407, and 424, respectively;
(679) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:389, 408, and 425, respectively;
(680) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:390, 183, and 193, respectively;
(681) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:391, 409, and 426, respectively;
(682) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:392, 40, and 427, respectively;
(683) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:394, 39, and 429, respectively;
(684) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:395, 411, and 430, respectively;
(685) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:396, 412, and 431, respectively;
(686) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:396, 412, and 58, respectively;
(687) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:397, 413, and 432, respectively; or a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs:398, 414, and 433, respectively.
(688) 38. The antibody or antigen-binding fragment of embodiment 36 or embodiment 37, wherein the CDR-L1, CDR-L2, and CDR-L3 are selected from:
(689) a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs: 178, 183, and 194, respectively; or a CDR-L1, CDR-L2, and CDR-L3 comprising the amino acid sequence of SEQ ID NOs: 33, 43, and 421, respectively.
(690) 39. The antibody or antigen-binding fragment of any one of embodiments 26-36, said antibody or antigen-binding fragment comprises a V.sub.L region comprising a CDR-L1, a CDR-L2, and a CDR-L3, respectively, comprising the amino acid sequence of a CDR-L1, a CDR-L2, and a CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(691) 40. The antibody or antigen-binding fragment thereof of embodiment 39, wherein the CDR-L1, the CDR-L2, and the CDR-L3, respectively, comprise the amino acid sequence of a CDR-L1, a CDR-L2, and a CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs: 116-118, 120, 121, 124, 125, 258, 262-267 and 534-538.
(692) 41. The antibody or antigen-binding fragment thereof of embodiment 39 or embodiment 40, wherein the CDR-L1, the CDR-L2, and the CDR-L3, respectively, comprise the amino acid sequence of a CDR-L1, a CDR-L2, and a CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs: 267 and 536.
(693) 42. The antibody or antigen-binding fragment of any one of embodiments 26-39, wherein the V.sub.L region comprises a framework region 1 (FR1), a FR2, a FR3, and/or a FR4 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity, respectively, to a FR1, FR2, FR3, and/or FR4 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(694) 43. The antibody or antigen-binding fragment of any one of embodiments 26-42, wherein the V.sub.H region comprises a FR1, a FR2, a FR3, and/or a FR4, selected from:
(695) a FR1 comprising the amino acid sequence selected from any one of SEQ ID NOs:72-82, 221-227, 446-459 and 461-466;
(696) a FR2 comprising the amino acid sequence selected from any one of SEQ ID NOs:83-92, 228-232, 467-477 and 479-482;
(697) a FR3 comprising the amino acid sequence selected from any one of SEQ ID NOs:93-101, 233-242, 483-495 and 497-501; and/or
(698) a FR4 comprising the amino acid sequence selected from any one of SEQ ID NOs:102-109, 243-246, 502-506 and 508.
(699) 44. The antibody or antigen-binding fragment of any one of embodiments 26-43, wherein the V.sub.L region comprises the amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(700) 45. The antibody or antigen-binding fragment thereof of embodiment 44, wherein the V.sub.L region comprises the amino acid sequence selected from any one of SEQ ID NOs: 116-118, 120, 121, 124, 125, 258, 262-267 and 534-538.
(701) 46. The antibody or antigen-binding fragment thereof of embodiment 44 or embodiment 45, wherein the V.sub.L region comprises the amino acid sequence selected from any one of SEQ ID NOs:267 and 536.
(702) 47. An antibody or antigen-binding fragment thereof, comprising:
(703) a heavy chain complementarity determining region 1 (CDR-H1), CDR-H2, and CDR-H3, respectively, comprising the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533; and/or
(704) a light chain complementarity determining region 1 (CDR-L1), CDR-L2, and CDR-L3, respectively, comprising the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs:116-127, 257-267, 534-550 and 552-557.
(705) 48. The antibody or antigen-binding fragment thereof of embodiment 47, wherein the CDR-H1, CDR-H2, and CDR-H3, respectively, comprise the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 110-113, 115, 248, 252-256 and 518-522; and/or
(706) a light chain complementarity determining region 1 (CDR-L1), CDR-L2, and CDR-L3, respectively, comprising the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs: 116-118, 120, 121, 124, 125, 258, 262-267 and 534-538.
(707) 49. The antibody or antigen-binding fragment thereof of embodiment 47 or embodiment 48, wherein the CDR-H1, CDR-H2, and CDR-H3, respectively, comprise the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 115 and 256; and/or
(708) a light chain complementarity determining region 1 (CDR-L1), CDR-L2, and CDR-L3, respectively, comprising the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs: 267 and 536.
(709) 50. An antibody or antigen-binding fragment thereof, comprising:
(710) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 116, respectively;
(711) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:111 and 117, respectively;
(712) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 118, respectively;
(713) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 119, respectively;
(714) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 120, respectively;
(715) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 121, respectively;
(716) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 122, respectively;
(717) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 123, respectively;
(718) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:112 and 124, respectively;
(719) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:113 and 125, respectively;
(720) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:114 and 126, respectively;
(721) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:115 and 127, respectively;
(722) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:247 and 257, respectively;
(723) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:248 and 258, respectively;
(724) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:249 and 259, respectively;
(725) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:250 and 260, respectively;
(726) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:251 and 261, respectively;
(727) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:252 and 262, respectively;
(728) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:253 and 263, respectively;
(729) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:254 and 264, respectively;
(730) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:255 and 265, respectively;
(731) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:256 and 266, respectively;
(732) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:256 and 267, respectively;
(733) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:518 and 534, respectively;
(734) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:519 and 535, respectively;
(735) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:115 and 536, respectively;
(736) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:520 and 264, respectively;
(737) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:521 and 537, respectively;
(738) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:522 and 538, respectively;
(739) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:523 and 539, respectively;
(740) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:519 and 540, respectively;
(741) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:524 and 541, respectively;
(742) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:525 and 261, respectively;
(743) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:526 and 542, respectively;
(744) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:527 and 543, respectively;
(745) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:528 and 544, respectively;
(746) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:529 and 545, respectively;
(747) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:528 and 546, respectively;
(748) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:522 and 547, respectively;
(749) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:256 and 548, respectively;
(750) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:530 and 549, respectively;
(751) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:531 and 550, respectively;
(752) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:519 and 552, respectively;
(753) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 553, respectively;
(754) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 118, respectively;
(755) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:533 and 554, respectively;
(756) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:115 and 555, respectively;
(757) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:524 and 556, respectively; or a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:519 and 557, respectively.
(758) 51. The antibody or antigen-binding fragment thereof of embodiment 50, comprising: a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOS:110 and 116, respectively;
(759) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:111 and 117, respectively;
(760) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 118, respectively;
(761) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 120, respectively;
(762) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:110 and 121, respectively;
(763) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:112 and 124, respectively;
(764) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:113 and 125, respectively;
(765) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:248 and 258, respectively;
(766) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:252 and 262, respectively;
(767) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:253 and 263, respectively;
(768) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:254 and 264, respectively;
(769) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:255 and 265, respectively;
(770) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:256 and 266, respectively;
(771) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:256 and 267, respectively;
(772) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:518 and 534, respectively;
(773) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:519 and 535, respectively;
(774) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:115 and 536, respectively;
(775) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:520 and 264, respectively;
(776) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:521 and 537, respectively; or a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to and SEQ ID NOs:522 and 538, respectively.
(777) 52. The antibody or antigen-binding fragment thereof of embodiment 50 or embodiment 51, comprising:
(778) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOS:256 and 267, respectively;
(779) a V.sub.H region and a V.sub.L regions comprising the amino acid sequence having at least 90% identity to SEQ ID NOs:115 and 536, respectively;
(780) 53. The antibody or antigen-binding fragment of embodiment 50, comprising a V.sub.H region sequence that is at least at or about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to such a SEQ ID NO and/or a V.sub.L region sequence that is at least at or about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to such a SEQ ID NO.
(781) 54. The antibody or antigen-binding fragment of embodiment 50 or embodiment 53, wherein:
(782) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 116, respectively;
(783) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:111 and 117, respectively;
(784) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 118, respectively;
(785) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 119, respectively;
(786) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 120, respectively;
(787) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 121, respectively;
(788) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 122, respectively;
(789) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 123, respectively;
(790) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:112 and 124, respectively;
(791) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:113 and 125, respectively;
(792) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:114 and 126, respectively;
(793) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:115 and 127, respectively;
(794) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:247 and 257, respectively;
(795) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:248 and 258, respectively;
(796) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:249 and 259, respectively;
(797) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:250 and 260, respectively;
(798) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:251 and 261, respectively;
(799) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:252 and 262, respectively;
(800) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:253 and 263, respectively;
(801) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:254 and 264, respectively;
(802) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:255 and 265, respectively;
(803) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:256 and 266, respectively;
(804) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:256 and 267, respectively;
(805) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:518 and 534, respectively;
(806) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 535, respectively;
(807) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:115 and 536, respectively;
(808) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:520 and 264, respectively;
(809) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:521 and 537, respectively;
(810) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:522 and 538, respectively;
(811) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:523 and 539, respectively;
(812) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 540, respectively;
(813) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:524 and 541, respectively;
(814) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:525 and 261, respectively;
(815) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:526 and 542, respectively;
(816) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:527 and 543, respectively;
(817) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:528 and 544, respectively;
(818) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:529 and 545, respectively;
(819) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:528 and 546, respectively;
(820) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:522 and 547, respectively;
(821) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:256 and 548, respectively;
(822) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:530 and 549, respectively;
(823) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:531 and 550, respectively;
(824) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 552, respectively;
(825) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 553, respectively;
(826) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 118, respectively;
(827) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:533 and 554, respectively;
(828) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:115 and 555, respectively;
(829) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:524 and 556, respectively; or the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 557, respectively.
(830) 55. The antibody or antigen-binding fragment thereof of embodiment 50, comprising: the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOS:110 and 116, respectively;
(831) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:111 and 117, respectively;
(832) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 118, respectively;
(833) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 120, respectively;
(834) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 121, respectively;
(835) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:112 and 124, respectively;
(836) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:113 and 125, respectively;
(837) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:248 and 258, respectively;
(838) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:252 and 262, respectively;
(839) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:253 and 263, respectively;
(840) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:254 and 264, respectively;
(841) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:255 and 265, respectively;
(842) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:256 and 266, respectively;
(843) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:256 and 267, respectively;
(844) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:518 and 534, respectively;
(845) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 535, respectively;
(846) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:115 and 536, respectively;
(847) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:520 and 264, respectively;
(848) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:521 and 537, respectively; or the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of and SEQ ID NOs:522 and 538, respectively.
(849) 56. The antibody or antigen-binding fragment thereof of embodiment 54 or embodiment 55, comprising:
(850) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOS:256 and 267, respectively;
(851) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:115 and 536, respectively;
(852) 57. The antibody or antigen-binding fragment of any one of embodiments 1-54, wherein said antibody or antigen-binding fragment specifically binds to a BCMA protein.
(853) 58. The antibody or antigen-binding fragment of embodiment 57, wherein the BCMA protein is a human BCMA protein, a mouse BCMA protein, or a non-human primate BCMA protein.
(854) 59. The antibody or antigen-binding fragment of embodiment 57, wherein the BCMA protein is a human BCMA protein.
(855) 60. The antibody or antigen-binding fragment of any of embodiments 1-59, wherein said antibody or antigen-binding fragment comprises a heavy chain complementarity determining region 3 (CDR-H3) comprising the amino acid sequence selected from any one of SEQ ID NOs: 7 and 157, or a CDR-H3 contained within the heavy chain variable (V.sub.H) region amino acid sequence selected from any one of SEQ ID NOs:110, 256 and 519, and/or
(856) a light chain complementarity determining region 3 (CDR-L3) comprising the amino acid sequence selected from any one of SEQ ID NOs: 47, 51, 194 and 416, or a CDR-L3 contained within the light chain variable (V.sub.L) region amino acid sequence selected from any one of SEQ ID NOs: 116, 120, 267 and 535.
(857) 61. The antibody or antigen-binding fragment of any of embodiments 1-60, wherein said antibody or antigen-binding fragment further comprises:
(858) a heavy chain complementarity determining region 1 (CDR-H1) comprising the amino acid sequence selected from any one of SEQ ID NOs: 1 and 2, or a CDR-H1 contained within the heavy chain variable (V.sub.H) region amino acid sequence selected from any one of SEQ ID NOs:110, 256 and 519, and/or
(859) a light chain complementarity determining region 1 (CDR-L1) comprising the amino acid sequence selected from any one of SEQ ID NOs: 26, 30, 178 and 380, or a CDR-L1 contained within the light chain variable (V.sub.L) region amino acid sequence selected from any one of SEQ ID NOs: 116, 120, 267 and 535;
(860) a heavy chain complementarity determining region 2 (CDR-H2) comprising the amino acid sequence selected from any one of SEQ ID NOs: 4 or 5, or a CDR-H2 contained within the heavy chain variable (V.sub.H) region amino acid sequence selected from any one of SEQ ID NOs:110, 256 and 519, and/or
(861) a light chain complementarity determining region 2 (CDR-L2) comprising the amino acid sequence selected from any one of SEQ ID NOs: 37, 39, 183 or 400, or a CDR-L2 contained within the light chain variable (V.sub.L) region amino acid sequence selected from any one of SEQ ID NOs: 116, 120, 267 and 535.
(862) 62. The antibody or antigen-binding fragment of any of embodiments 1-61, wherein said antibody or antigen-binding fragment comprises a V.sub.H region comprising a CDR-H1, a CDR-H2, and a CDR-H3, respectively, comprising the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs: 110, 256 and 519; and/or a V.sub.L region comprising a CDR-L1, a CDR-L2, and a CDR-L3, respectively, comprising the amino acid sequence of a CDR-L1, a CDR-L2, and a CDR-L3 contained within the V.sub.L region amino acid sequence selected from any one of SEQ ID NOs: 116, 120, 267 and 535.
(863) 63. The antibody or antigen-binding fragment of any of embodiments 1-62, wherein:
(864) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 116, respectively;
(865) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:110 and 120, respectively;
(866) the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:256 and 267, respectively; or the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:519 and 535, respectively.
(867) 64. The antibody or antigen-binding fragment of any of embodiments 1-59, wherein said antibody or antigen-binding fragment comprises a heavy chain complementarity determining region 3 (CDR-H3) comprising the amino acid sequence of SEQ ID NO:10, or a CDR-H3 contained within the heavy chain variable (V.sub.H) region amino acid sequence of SEQ ID NO:115, and/or
(868) a light chain complementarity determining region 3 (CDR-L3) comprising the amino acid sequence of SEQ ID NO:421, or a CDR-L3 contained within the light chain variable (V.sub.L) region amino acid sequence of SEQ ID NO:536.
(869) 65. The antibody or antigen-binding fragment of any of embodiments 1-59 and 64, wherein said antibody or antigen-binding fragment further comprises:
(870) a heavy chain complementarity determining region 1 (CDR-H1) comprising the amino acid sequence of SEQ ID NO:2, or a CDR-H1 contained within the heavy chain variable (V.sub.H) region amino acid sequence of SEQ ID NO:115 and/or
(871) a light chain complementarity determining region 1 (CDR-L1) comprising the amino acid sequence selected from any one of SEQ ID NOs: 33, or a CDR-L1 contained within the light chain variable (V.sub.L) region amino acid sequence selected from any one of SEQ ID NOs:536; and/or
(872) a heavy chain complementarity determining region 2 (CDR-H2) comprising the amino acid sequence of SEQ ID NO:5, or a CDR-H1 contained within the heavy chain variable (V.sub.H) region amino acid sequence of SEQ ID NO:115 and/or
(873) a light chain complementarity determining region 2 (CDR-L2) comprising the amino acid sequence selected from any one of SEQ ID NOs:43, or a CDR-L1 contained within the light chain variable (V.sub.L) region amino acid sequence selected from any one of SEQ ID NOs:536.
(874) 66. The antibody or antigen-binding fragment of any of embodiments 1-59 64 and 65, wherein said antibody or antigen-binding fragment comprises a V.sub.H region comprising a CDR-H1, a CDR-H2, and a CDR-H3, respectively, comprising the amino acid sequence of a CDR-H1, a CDR-H2, and a CDR-H3 contained within the V.sub.H region amino acid sequence of SEQ ID NO:115; and/or a V.sub.L region comprising a CDR-L1, a CDR-L2, and a CDR-L3, respectively, comprising the amino acid sequence of a CDR-L1, a CDR-L2, and a CDR-L3 contained within the V.sub.L region amino acid sequence of SEQ ID NO:536.
(875) 67. The antibody or antigen-binding fragment of any of embodiments 1-59 and 64, wherein the V.sub.H and V.sub.L regions of the antibody or antigen-binding fragment thereof comprise the amino acid sequences of SEQ ID NOs:115 and 536, respectively.
(876) 68. The antibody or antigen-binding fragment of any of embodiments 1-59, wherein the antibody or antigen-binding fragment further specifically binds to mouse BCMA or non-human primate BCMA.
(877) 69. The antibody or antigen-binding fragment of any one of embodiments 58-68, wherein said human BCMA protein comprises an amino acid sequence of SEQ ID NO:367 or 368.
(878) 70. The antibody or antigen-binding fragment of any one of embodiments 1-69, wherein the antibody or antigen-binding fragment is human.
(879) 71. The antibody or antigen-binding fragment thereof of any of embodiments 1-70, wherein the antibody is a human antibody.
(880) 72. The antibody or antigen-binding fragment of embodiment 70 or embodiment 71, wherein:
(881) the antibody or antigen-binding fragment comprises a heavy chain variable (V.sub.H) region, said V.sub.H region comprises a portion having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a germline nucleotide human heavy chain V segment, a portion with at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a germline nucleotide human heavy chain D segment, and/or a portion having at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a germline nucleotide human heavy chain J segment; and/or
(882) the antibody or antigen-binding fragment comprises a light chain variable (V.sub.L) region, said V.sub.L region comprises a portion with at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a germline nucleotide human kappa or lambda chain V segment, and/or a portion with at least 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a germline nucleotide human kappa or lambda chain J segment.
(883) 73. The antibody or antigen-binding fragment of any one of embodiments 70-72, wherein:
(884) the CDR-H1 and/or CDR-H2 comprises a sequence 100% identical or with no more than one amino acid difference as compared to an amino acid sequence of a CDR-H1 and/or CDR-H2, respectively, within a sequence encoded by a germline nucleotide human heavy chain V segment; and/or
(885) the CDR-L1 and/or CDR-L2 comprises a sequence 100% identical or with no more than one amino acid difference as compared to an amino acid sequence of a CDR-L1 and/or CDR-L2, respectively, within a sequence encoded by a germline nucleotide human kappa or lambda v segment.
(886) 74. The antibody or antigen-binding fragment of any one of embodiments 1-73, wherein the antibody or antigen-binding fragment is recombinant.
(887) 75. The antibody or antigen-binding fragment of any one of embodiments 1-74, wherein the antibody or antigen-binding fragment is monoclonal.
(888) 76. The antibody or antigen-binding fragment of any one of embodiments 1-75, that is an antigen-binding fragment.
(889) 77. The antibody or antigen-binding fragment of any one of embodiments 1-76, that is a single chain fragment.
(890) 78. The antibody or antigen-binding fragment of any one of embodiments 1-77, wherein the V.sub.H region is amino-terminal to the V.sub.L region.
(891) 79. The antibody or antigen-binding fragment of any of embodiments 1-78, wherein the V.sub.H region is carboxy-terminal to the V.sub.L region.
(892) 80. The antibody or antigen-binding fragment of any one of embodiments 1-79, that is a fragment comprising antibody V.sub.H and V.sub.L regions joined by a flexible linker.
(893) 81. The antibody or antigen-binding fragment of embodiment 77 or embodiment 80, wherein the fragment comprises an scFv.
(894) 82. The antibody or antigen-binding fragment of embodiment 81, wherein the scFv comprises a linker comprising the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO:361).
(895) 83. The antibody or antigen-binding fragment of embodiment 81 or embodiment 82, wherein the scFv comprises the amino acid sequence selected from any one of SEQ ID NOs:128-139, 268-278, 558-576 and 578-583, or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence selected from any one of SEQ ID NOs:128-139, 268-278, 558-576 and 578-583.
(896) 84. The antibody or antigen-binding fragment of any of embodiments 81-83, wherein the scFv comprises the amino acid sequence selected from any one of SEQ ID NOs: 128, 129, 130, 132, 133, 136, 137, 269, 273, 274, 275, 276, 277, 278, 558, 559, 560, 561, 562 and 563, or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence selected from any one of SEQ ID NOs: 128, 129, 130, 132, 133, 136, 137, 269, 273, 274, 275, 276, 277, 278, 558, 559, 560, 561, 562 and 563.
(897) 85. The antibody or antigen-binding fragment of any of embodiments 81-84, wherein the scFv comprises the amino acid sequence selected from any one of SEQ ID NOs: 278 and 560, or an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence selected from any one of SEQ ID NOs: 278 and 560.
(898) 86. A single chain cell-surface protein, comprising the antibody or antigen-binding fragment of any one of embodiments 1-85.
(899) 87. A single chain cell surface protein comprising the scFv amino acid sequence selected from any one of SEQ ID NOs:128-139, 268-278, 558-576 and 578-583 or comprising the V.sub.H region amino acid sequence selected from any one of SEQ ID NOs:110-115, 247-256, 518-531 and 533.
(900) 88. The single chain cell surface protein of embodiment 87, wherein the scFv comprises the amino acid sequence selected from any one of SEQ ID NOs: 128, 129, 130, 132, 133, 136, 137, 269, 273, 274, 275, 276, 277, 278, 558, 559, 560, 561, 562 and 563.
(901) 89. The single chain cell surface protein of embodiment 87 or embodiment 88, wherein the scFv comprises the amino acid sequence selected from any one of SEQ ID NOs: 278 and 560.
(902) 90. The antibody or antigen-binding fragment of any one of embodiments 1-87, which further comprises at least a portion of an immunoglobulin constant region.
(903) 91. The antibody or antigen-binding fragment of embodiment 90, wherein the portion of an immunoglobulin constant region comprises at least a portion of the hinge region.
(904) 92. The antibody or antigen-binding fragment of embodiment 90, wherein the portion of an immunoglobulin constant region comprises an Fc region.
(905) 93. The antibody or antigen-binding fragment of embodiment 92, wherein the Fc region is an Fc region of a human IgG.
(906) 94. A conjugate, comprising the antibody or antigen-binding fragment of any one of embodiments 1-98 and a heterologous molecule or moiety.
(907) 95. A chimeric antigen receptor (CAR) comprising an extracellular portion comprising the antibody or antigen-binding fragment of any one of embodiments 1-93 and an intracellular signaling region.
(908) 96. The chimeric antigen receptor of embodiment 95, wherein the antibody or antigen-binding fragment comprises an sdAb comprising only the V.sub.H region or an scFv and the intracellular signaling region comprises an intracellular signaling domain.
(909) 97. The chimeric antigen receptor of embodiment 96, wherein the intracellular signaling domain is or comprises a primary signaling domain, a signaling domain that is capable of inducing a primary activation signal in a T cell, a signaling domain of a T cell receptor (TCR) component, and/or a signaling domain comprising an immunoreceptor tyrosine-based activation motif (ITAM).
(910) 98. The chimeric antigen receptor of embodiment 97, wherein the intracellular signaling domain is or comprises an intracellular signaling domain of a CD3 chain, optionally a CD3-zeta (CD3ζ) chain, or a signaling portion thereof.
(911) 99. The chimeric antigen receptor of any of embodiments 95-98, wherein the recombinant receptor further comprises a transmembrane domain disposed between the extracellular domain and the intracellular signaling region.
(912) 100. The chimeric antigen receptor of embodiment 99, wherein the transmembrane domain comprises a transmembrane portion of CD28.
(913) 101. The chimeric antigen receptor of any of embodiments 95-100, wherein the intracellular signaling region further comprises a costimulatory signaling domain.
(914) 102. The chimeric antigen receptor of embodiment 101, wherein the costimulatory signaling domain comprises an intracellular signaling domain of a T cell costimulatory molecule or a signaling portion thereof.
(915) 103. The chimeric antigen receptor of embodiment 101 or embodiment 102, wherein the costimulatory signaling domain comprises an intracellular signaling domain of a CD28, a 4-1BB or an ICOS or a signaling portion thereof.
(916) 104. The chimeric antigen receptor of any of embodiments 101-103, wherein the costimulatory signaling domain is between the transmembrane domain and the intracellular signaling domain.
(917) 105. A polynucleotide encoding the antibody or antigen-binding fragment thereof of any one of embodiments 1-93, conjugate of embodiment 94 or the chimeric antigen receptor of any one of embodiments 95-104.
(918) 106. The polynucleotide of embodiment 105, further encoding a GM-CSF signal sequence, a CD8 signal sequence, an Ig kappa signal sequence or a CD33 signal sequence.
(919) 107. A vector, comprising the polynucleotide of embodiment 105 or embodiment 106.
(920) 108. The vector of embodiment 107, wherein the vector is an expression vector.
(921) 109. The vector of embodiment 107 or embodiment 108, wherein the vector is a viral vector.
(922) 110. The vector of embodiment 109, wherein the viral vector is a retroviral vector. 111. The vector of embodiment 109 or embodiment 110, wherein the viral vector is a lentiviral vector.
(923) 112. The vector of embodiment 111, wherein the lentiviral vector is derived from HIV-1.
(924) 113. An engineered cell comprising the vector of any one of embodiments 107-112.
(925) 114. An engineered cell expressing a receptor comprising the antibody or antigen-binding fragment of any one of embodiments 1-93, conjugate of embodiment 94 or the chimeric antigen receptor of any one of embodiments 95-102.
(926) 115. The engineered cell of embodiment 114 or embodiment 115, wherein the engineered cell is a T cell.
(927) 116. A composition comprising the antibody or antigen-binding fragment thereof of any one of embodiments 1-93, conjugate of embodiment 94, the chimeric antigen receptor of any one of embodiments 95-102, or the cell of any one of embodiments 113-115.
(928) 117. The composition of embodiment 116, further comprising a pharmaceutically acceptable excipient.
(929) 118. A method of treatment, comprising administering the composition of embodiment 116 or embodiment 117 to a subject having a disease or disorder associated with BCMA.
(930) 119. A method of treatment, comprising administering an antibody or antigen-binding fragment of any one of embodiments 1-93, conjugate of embodiment 94, the chimeric antigen receptor of any one of embodiments 95-102, or the cell of any one of embodiments 113-115 to a subject having a disease or disorder associated with BCMA.
(931) 120. The method of embodiment 118 or embodiment 119, wherein the disease or disorder associated with BCMA is associated with BCMA expression.
(932) 121. The method of any one of embodiments 118-120, wherein the disease or disorder associated with BCMA is a B cell-related disorder.
(933) 122. The method of any one of embodiments 118-121, wherein the disease or disorder associated with BCMA is an autoimmune disease or disorder.
(934) 123. The method of embodiment 122, wherein the autoimmune disease or disorder is systemic lupus erythematosus (SLE), lupus nephritis, inflammatory bowel disease, rheumatoid arthritis, ANCA associated vasculitis, idiopathic thrombocytopenia purpura (ITP), thrombotic thrombocytopenia purpura (TTP), autoimmune thrombocytopenia, Chagas' disease, Grave's disease, Wegener's granulomatosis, poly-arteritis nodosa, Sjogren's syndrome, pemphigus vulgaris, scleroderma, multiple sclerosis, psoriasis, IgA nephropathy, IgM polyneuropathies, vasculitis, diabetes mellitus, Reynaud's syndrome, anti-phospholipid syndrome, Goodpasture's disease, Kawasaki disease, autoimmune hemolytic anemia, myasthenia gravis, or progressive glomerulonephritis. 124. The method of any one of embodiments 118-121, wherein the disease or disorder associated with BCMA is a cancer.
(935) 125. The method of embodiment 124, wherein the cancer is a BCMA-expressing cancer.
(936) 126. The method of embodiment 124 or embodiment 125, wherein the cancer is a B cell malignancy.
(937) 127. The method of any one of embodiments 124-126, wherein the cancer is a lymphoma, a leukemia, or a plasma cell malignancy.
(938) 128. The method of embodiment 127, wherein the lymphoma is Burkitt's lymphoma, non-Hodgkin's lymphoma (NHL), Hodgkin's lymphoma, Waldenstrom macroglobulinemia, follicular lymphoma, small non-cleaved cell lymphoma, mucosa-associated lymphatic tissue lymphoma (MALT), marginal zone lymphoma, splenic lymphoma, nodal monocytoid B cell lymphoma, immunoblastic lymphoma, large cell lymphoma, diffuse mixed cell lymphoma, pulmonary B cell angiocentric lymphoma, small lymphocytic lymphoma, primary mediastinal B cell lymphoma, lymphoplasmacytic lymphoma (LPL), or mantle cell lymphoma (MCL).
(939) 129. The method of embodiment 127, wherein the leukemia is chronic lymphocytic leukemia (CLL), plasma cell leukemia or acute lymphocytic leukemia (ALL).
(940) 130. The method of embodiment 127, wherein the plasma cell malignancy is multiple myeloma (MM) or plasmacytoma.
(941) 131. A composition of embodiment 116 or embodiment 117 for use in treating a disease or disorder associated with BCMA.
(942) 132. Use of a composition of embodiment 116 or embodiment 117 for the manufacture of a medicament for treating a disease or disorder associated with BCMA.
(943) 133. The composition for use or use of embodiment 132, wherein the disease or disorder associated with BCMA is associated with BCMA expression.
(944) 134. The composition for use or use of any one of embodiments 131-133, wherein the disease or disorder associated with BCMA is a B cell-related disorder.
(945) 135. The composition for use or use of any one of embodiments 131-134, wherein the disease or disorder associated with BCMA is an autoimmune disease or disorder.
(946) 136. The composition for use or use of 135, wherein the autoimmune disease or disorder is systemic lupus erythematosus (SLE), lupus nephritis, inflammatory bowel disease, rheumatoid arthritis, ANCA associated vasculitis, idiopathic thrombocytopenia purpura (ITP), thrombotic thrombocytopenia purpura (TTP), autoimmune thrombocytopenia, Chagas' disease, Grave's disease, Wegener's granulomatosis, poly-arteritis nodosa, Sjogren's syndrome, pemphigus vulgaris, scleroderma, multiple sclerosis, psoriasis, IgA nephropathy, IgM polyneuropathies, vasculitis, diabetes mellitus, Reynaud's syndrome, anti-phospholipid syndrome, Goodpasture's disease, Kawasaki disease, autoimmune hemolytic anemia, myasthenia gravis, or rapidly progressive glomerulonephritis.
(947) 137. The composition for use or use of any one of embodiments 131-134, wherein the disease or disorder associated with BCMA is a cancer.
(948) 138. The composition for use or use of embodiment 137, wherein the cancer is a BCMA-expressing cancer.
(949) 139. The composition for use or use of embodiment 137 or embodiment 138, wherein the cancer is a B cell malignancy.
(950) 140. The composition for use or use of embodiments 137-139, wherein the cancer is a lymphoma, a leukemia, or a plasma cell malignancy.
(951) 141. The composition for use or use of embodiment 140, wherein the lymphoma is Burkitt's lymphoma, non-Hodgkin's lymphoma (NHL), Hodgkin's lymphoma, Waldenstrom macroglobulinemia, follicular lymphoma, small non-cleaved cell lymphoma, mucosa-associated lymphatic tissue lymphoma (MALT), marginal zone lymphoma, splenic lymphoma, nodal monocytoid B cell lymphoma, immunoblastic lymphoma, large cell lymphoma, diffuse mixed cell lymphoma, pulmonary B cell angiocentric lymphoma, small lymphocytic lymphoma, primary mediastinal B cell lymphoma, lymphoplasmacytic lymphoma (LPL), or mantle cell lymphoma (MCL).
(952) 142. The composition for use or use of embodiment 140, wherein the leukemia is chronic lymphocytic leukemia (CLL), plasma cell leukemia or acute lymphocytic leukemia (ALL).
(953) 143. The composition for use or use of embodiment 140, wherein the plasma cell malignancy is multiple myeloma (MM) or plasmacytoma.
V. Examples
(954) The following examples are included for illustrative purposes only and are not intended to limit the scope of the invention.
Example 1: Generation and Assessment of Anti-BCMA Antibodies (V.SUB.H .Chain Only)
(955) Exemplary anti-BCMA antibodies containing a heavy chain variable (V.sub.H) region that specifically bound to BCMA, even in the absence of a light chain variable (V.sub.L) region, were generated and assessed.
(956) 1A. Library Selection and Antibody Generation
(957) A number of BCMA-binding V.sub.H regions were generated through a series of selection steps carried out on members of a dsDNA-encoded His-tagged human normal donor antibody V.sub.H library displayed in a cell-free system. Members of the V.sub.H library were subjected to multiple rounds of screening to select V.sub.H regions that bound specifically to soluble human BCMA fused to an immunoglobulin Fc region (hBCMA-Fc). V.sub.H regions from selected hBCMA-Fc pools were screened, by flow cytometry using a fluorochrome-conjugated anti-HIS antibody, for binding to a recombinant HEK293 cell line expressing human BCMA (hBCMA/HEK293 cell line), as compared to the parental HEK293 cell line not expressing BCMA, as well as to for binding to a human myeloma cell line expressing endogenous BCMA (H929 cells). The results identified V.sub.H region clones that exhibited specific binding to hBCMA/HEK293 cells and, to a lesser degree, to H929 cells.
(958) Exemplary V.sub.H clones exhibiting specific binding to cell lines expressing BCMA but not to BCMA-negative control cells were sequenced and purified for further characterization. Clones were purified and titrated, and their binding affinities (EC.sub.50) to hBCMA/HEK293 cells were measured using a flow cytometry-based assay with the fluorochrome-conjugated anti-HIS-antibody. Table 3 lists heavy chain complementarity determining region 3 (CDR-H3) sequences of exemplary clones, containing human V.sub.H3-derived framework regions and their respective binding affinities (EC.sub.50) observed in this study.
(959) TABLE-US-00003 TABLE 3 CDR3 amino acid sequences for representative V.sub.H clones V.sub.H Clone Heavy Chain CDR3 CDR-H3 Sequence Name sequence (CDR-H3).sup.a Identifier Number EC.sub.50 (nM).sup.b V.sub.H-1 VDGPPSFDI SEQ ID NO: 10 >100 V.sub.H-2 WSAPTDY SEQ ID NO: 7 25 V.sub.H-3 VDGDDAFDI SEQ ID NO: 279 >100 V.sub.H-4 DPLSWDSSGKGPR SEQ ID NO: 280 100 V.sub.H-5 ENYDFWSWRYYYDMDV SEQ ID NO: 281 >100 V.sub.H-6 VDGPPSYDI SEQ ID NO: 282 >100 V.sub.H-7 GDWDDAFDI SEQ ID NO: 283 >100 V.sub.H-8 VDGDYVDDY SEQ ID NO: 9 ND V.sub.H-9 VDGDYEDY SEQ ID NO: 284 >100 V.sub.H-10 DVPSSGDDAFDI SEQ ID NO: 285 >100 V.sub.H-11 VDGDDVFDI SEQ ID NO: 286 >100 V.sub.H-12 VDGDAFDI SEQ ID NO: 287 100 .sup.aAmino acid sequences shown according to Kabat numbering. .sup.bND indicates not detected
Example 2: Generation and Assessment of Anti-BCMA Antibodies (scFvs)
(960) Exemplary anti-BCMA antibodies, formatted as single chain antibody fragments (scFvs), were identified and assessed for binding to BCMA.
(961) 2A. Library Selection and scFv Antibody Generation
(962) Exemplary anti-BCMA scFv antibodies were generated through various selections, carried out on dsDNA-encoded human normal donor antibody libraries displayed in a cell-free system. In one approach, V.sub.H region library members enriched from a first round of screening in the approach described in Example 1 were paired by shuffling with members of a human normal donor V.sub.L library, to generate an scFv library, in V.sub.H-(G.sub.4S).sub.3-V.sub.L format. The resulting scFv libraries were enriched in subsequent rounds of selection for specific binding to BCMA-expressing HEK293 cells as compared to parental HEK293 cells.
(963) In another approach, de novo selection was carried out by screening a normal donor-derived human scFv library for BCMA-specific binding to hBCMA-Fc in the presence or absence of competitive elution with a mouse anti-BCMA reference scFv antibody (either BCMA-C1, V.sub.L-V.sub.H scFv antibody, SEQ ID NO:328; or BCMA-C2, V.sub.H-V.sub.L scFv antibody, SEQ ID NO:329). After at least 2 rounds of selection, scFv binders were recovered.
(964) Specific binding of resulting scFv clones to BCMA-expressing HEK293 cells, as compared to control cells not expressing BCMA, was assessed by flow cytometry either with in vitro translated crude cell lysate or with bacterially-produced supernatant. Certain scFv clones displaying binding preference for BCMA were further analyzed.
(965) The selected scFv clones were sequenced using forward and reverse primers and purified for further characterization. Table 4 lists sequence identifiers (SEQ ID NO) corresponding to amino acid (aa) and nucleotide (nt) sequences of the scFv and amino acid sequences of the corresponding heavy chain (V.sub.H) or light chain (V.sub.L) variable regions, CDRs and framework regions (FRs). With respect to clone BCMA-22, the first residue of light chain CDR3 (a cysteine), which was observed to have been inherited from the germline framework region was replaced with a serine to generate an additional scFv, designated BCMA-23. Table 4 also sets forth the sequence of exemplary mouse anti-BCMA reference antibodies used as controls and in competition studies as described in subsequent Examples.
(966) TABLE-US-00004 TABLE 4 Sequence identifier (SEQ ID NO) for Exemplary Clones and Reference Antibody Heavy Chain Light Chain V.sub.H FR V.sub.L FR CDR-H1, (FR1, 2, CDR-L1, (FR1, 2, CDR-H2, 3, 4 CDR-L2, 3, 4, scFv Clone # V.sub.H CDR-H3 Kabat) V.sub.L CDR-L3 Kabat) aa nt BCMA- 110 1, 4, 7 (Kabat) 59, 64, 116 26, 37, 47 (Kabat) 72, 83, 128 330 1 12, 16, 7 (Chothia) 67, 70 26, 37, 47 (Chothia) 93, 102 19, 23, 7 (AbM) 26, 37, 47 (AbM) BCMA- 111 2, 5, 8 (Kabat) 60, 65, 117 27, 38, 48 (Kabat) 73, 84, 129 331 2 13, 17, 8 (Chothia) 68, 71 27, 38, 48 (Chothia) 94, 103 20, 24, 8 (AbM) 27, 38, 48 (AbM) BCMA- 110 1, 4, 7 (Kabat) 59, 64, 118 28, 39, 49 (Kabat) 74, 85, 130 332 3 12, 16, 7 (Chothia) 67, 70 28, 39, 49 (Chothia) 93, 104 19, 23, 7 (AbM) 28, 39, 49 (AbM) BCMA- 110 1, 4, 7 (Kabat) 59, 64, 119 29, 40, 50 (Kabat) 75, 86, 131 333 4 12, 16, 7 (Chothia) 67, 70 29, 40, 50 (Chothia) 95, 104 19, 23, 7 (AbM) 29, 40, 50 (AbM) BCMA- 110 1, 4, 7 (Kabat) 59, 64, 120 30, 39, 51 (Kabat) 76, 85, 132 334 5 12, 16, 7 (Chothia) 67, 70 30, 39, 51 (Chothia) 93, 105 19, 23, 7 (AbM) 30, 39, 51 (AbM) BCMA- 110 1, 4, 7 (Kabat) 59, 64, 121 31, 41, 52 (Kabat) 77, 87, 133 335 6 12, 16, 7 (Chothia) 67, 70 31, 41, 52 (Chothia) 96, 104 19, 23, 7 (AbM) 31, 41, 52 (AbM) BCMA- 110 1, 4, 7 (Kabat) 59, 64, 122 32, 42, 53 (Kabat) 78, 88, 134 336 7 12, 16, 7 (Chothia) 67, 70 32, 42, 53 (Chothia) 97, 106 19, 23, 7 (AbM) 32, 42, 53 (AbM) BCMA- 110 1, 4, 7 (Kabat) 59, 64, 123 30, 39, 54 (Kabat) 76, 85, 135 337 8 12, 16, 7 (Chothia) 67, 70 30, 39, 54 (Chothia) 93, 107 19, 23, 7 (AbM) 30, 39, 54 (AbM) BCMA- 112 2, 5, 9 (Kabat) 61, 65, 124 33, 43, 55 (Kabat) 79, 89, 136 338 9 13, 17, 9 (Chothia) 69, 70 33, 43, 55 (Chothia) 98, 108 20, 24, 9 (AbM) 33, 43, 55 (AbM) BCMA- 113 2, 5, 10 (Kabat) 62, 65, 125 34, 44, 56 (Kabat) 80, 90, 137 339 10 14, 17, 10 (Chothia) 68, 71 34, 44, 56 (Chothia) 99, 108 21, 24, 10 (AbM) 34, 44, 56 (AbM) BCMA- 114 3, 6, 11 (Kabat) 63, 66, 126 35, 45, 57 (Kabat) 81, 91, 138 340 11 15, 18, 11 (Chothia) 69, 71 35, 45, 57 (Chothia) 100, 108 22, 25, 11 (AbM) 35, 45, 57 (AbM) BCMA- 115 2, 5, 10 (Kabat) 60, 65, 127 36, 46, 58 (Kabat) 82, 92, 139 341 12 13, 17, 10 (Chothia) 68, 71 36, 46, 58 (Chothia) 101, 109 20, 24, 10 (AbM) 36, 46, 58 (AbM) BCMA- 247 140, 145, 149 (Kabat) 195, 204, 257 174, 179, 184 (Kabat) 221, 228, 268 342 13 158, 161, 149 (Chothia) 210, 217 174, 179, 184 (Chothia) 233, 243 165, 170, 149 (AbM) 174, 179, 184 (AbM) BCMA- 248 141, 145, 149 (Kabat) 196, 204, 258 174, 179, 185 (Kabat) 221, 228, 269 343 14 158, 161, 149 (Chothia) 211, 218 174, 179, 185 (Chothia) 234, 109 166, 170, 149 (AbM) 174, 179, 185 (AbM) BCMA- 249 141, 145, 150 (Kabat) 197, 204, 259 174, 179, 186 (Kabat) 222, 228, 270 344 15 158, 161, 150 (Chothia) 212, 70 174, 179, 186 (Chothia) 235, 109 166, 170, 150 (AbM) 174, 179, 186 (AbM) BCMA- 250 142, 146, 151 (Kabat) 198, 205, 260 174, 179, 187 (Kabat) 223, 228, 271 345 16 159, 162, 151 (Chothia) 213, 70 174, 179, 187 (Chothia) 235, 109 167, 171, 151 (AbM) 174, 179, 187 (AbM) BCMA- 251 2, 5, 152 (Kabat) 199, 206, 261 175, 180, 188 (Kabat) 224, 229, 272 346 17 13, 17, 152 (Chothia) 69, 219 175, 180, 188 (Chothia) 237, 109 20, 24, 152 (AbM) 175, 180, 188 (AbM) BCMA- 252 143, 147, 153 (Kabat) 200, 207, 262 174, 179, 189 (Kabat) 222, 228, 273 347 18 158, 163, 153 (Chothia) 214, 70 174, 179, 189 (Chothia) 238, 109 168, 172, 153 (AbM) 174, 179, 189 (AbM) BCMA- 253 144, 148, 154 (Kabat) 201, 208, 263 176, 181, 190 (Kabat) 225, 230, 274 348 19 160, 164, 54 (Chothia) 215, 220 176, 181, 190 (Chothia) 239, 244 169, 173, 154 (AbM) 176, 181, 190 (AbM) BCMA- 254 3, 6, 155 (Kabat) 202, 209, 264 177, 182, 191 (Kabat) 226, 231, 275 349 20 15, 18, 155 (Chothia) 216, 70 177, 182, 191 (Chothia) 240, 245 22, 25, 155 (AbM) 177, 182, 191 (AbM) BCMA- 255 2, 5, 156 (Kabat) 203, 65, 265 174, 179, 192 (Kabat) 222, 228, 276 350 21 13, 17, 156 (Chothia) 68, 70 174, 179, 192 (Chothia) 241, 246 20, 24, 156 (AbM) 174, 179, 192 (AbM) BCMA- 256 2, 5, 157 (Kabat) 60, 65, 266 178, 183, 193 (Kabat) 227, 232, 277 351 22 13, 17, 157 (Chothia) 68, 70 178, 183, 193 (Chothia) 242, 246 20, 24, 157 (AbM) 178, 183, 193 (AbM) BCMA- 256 2, 5, 157 (Kabat) 60, 65, 267 178, 183, 194 (Kabat) 227, 232, 278 352 23 13, 17, 157 (Chothia) 68, 70 178, 183, 194 (Chothia) 242, 246 20, 24, 157 (AbM) 178, 183, 194 (AbM) BCMA- 518 2, 6, 376 (Kabat) 61, 65, 534 30, 399, 415 (Kabat) 76, 85, 558 24 13, 18, 376 (Chothia) 69, 71 30, 399, 415 (Chothia) 483, 508 20, 25, 376 (AbM) 30, 399, 415 (AbM) BCMA- 519 1, 4, 7 (Kabat) 436, 64, 535 380, 400, 416 (Kabat) 446, 467, 559 25 12, 16, 7 (Chothia) 67, 70 380, 400, 416 (Chothia) 484, 502 19, 23, 7 (AbM) 380, 400, 416 (AbM) BCMA- 115 2, 5, 10 (Kabat) 60, 65, 536 33, 43, 421 (Kabat) 80, 89, 560 26 13, 17, 10 (Chothia) 68, 71 33, 43, 421 (Chothia) 98, 108 20, 24, 10 (AbM) 33, 43, 421 (AbM) BCMA- 520 3, 6, 155 (Kabat) 434, 209, 264 177, 182, 191 (Kabat) 226, 231, 561 27 15, 18, 155 (Chothia) 216, 70 177, 182, 191 (Chothia) 240, 245 22, 25, 155 (AbM) 177, 182, 191 (AbM) BCMA- 521 3, 372, 376 (Kabat) 63, 209, 537 381, 401, 417 (Kabat) 447, 468, 562 28 15, 514, 376 (Chothia) 69, 444 381, 401, 417 (Chothia) 485, 508 22, 510, 376 (AbM) 381, 401, 417 (AbM) BCMA- 522 3, 6, 376 (Kabat) 63, 209, 538 382, 402, 418 (Kabat) 448, 469, 563 29 15, 18, 376 (Chothia) 69, 71 382, 402, 418 (Chothia) 486, 503 22, 25, 376 (AbM) 382, 402, 418 (AbM) BCMA- 523 3, 6, 377 (Kabat) 435, 209, 539 383, 403, 419 (Kabat) 449, 470, 564 30 12, 18, 377 (Chothia) 69, 71 383, 403, 419 (Chothia) 487, 104 509, 25, 377 (AbM) 383, 403, 419 (AbM) BCMA- 519 1, 4, 7 (Kabat) 436, 64, 540 384, 39, 54 (Kabat) 450, 471, 565 31 12, 16, 7 (Chothia) 67, 70 384, 39, 54 (Chothia) 93, 504 19, 23, 7 (AbM) 384, 39, 54 (AbM) BCMA- 524 2, 5, 10 (Kabat) 437, 65, 541 385, 180, 58 (Kabat) 451, 472, 566 32 13, 17, 10 (Chothia) 68, 71 385, 180, 58 (Chothia) 488, 109 20, 24, 10 (AbM) 385, 180, 58 (AbM) BCMA- 525 2, 373, 152 (Kabat) 199, 65, 261 175, 180, 188 (Kabat) 224, 229, 567 33 13, 515, 152 (Chothia) 69, 219 175, 180, 188 (Chothia) 237, 109 20, 511, 152 (AbM) 175, 180, 188 (AbM) BCMA- 526 3, 6, 11 (Kabat) 438, 209, 542 386, 404, 420 (Kabat) 452, 84, 568 34 15, 18, 11 (Chothia) 69, 71 386, 404, 420 (Chothia) 489, 504 22, 25, 11 (AbM) 386, 404, 420 (AbM) BCMA- 527 2, 5, 378 (Kabat) 61, 65, 543 33, 43, 421 (Kabat) 453, 89, 569 35 13, 17, 378 (Chothia) 69, 70 33, 43, 421 (Chothia) 98, 505 20, 24, 378 (AbM) 33, 43, 421 (AbM) BCMA- 528 2, 5, 9 (Kabat) 199, 65, 544 387, 405, 422 (Kabat) 454, 473, 570 36 13, 17, 9 (Chothia) 69, 70 387, 405, 422 (Chothia) 490, 109 20, 24, 9 (AbM) 387, 405, 422 (AbM) BCMA- 529 2, 5, 9 (Kabat) 61, 65, 545 388, 406, 423 (Kabat) 455, 474, 571 37 13, 17, 9 (Chothia) 441, 70 388, 406, 423 (Chothia) 491, 109 20, 24, 9 (AbM) 388, 406, 423 (AbM) BCMA- 528 2, 5, 9 (Kabat) 199, 65, 546 388, 407, 424 (Kabat) 456, 474, 572 38 13, 17, 9 (Chothia) 69, 70 388, 407, 424 (Chothia) 492, 109 20, 24, 9 (AbM) 388, 407, 424 (AbM) BCMA- 522 3, 6, 376 (Kabat) 63, 209, 547 389, 408, 425 (Kabat) 457, 475, 573 39 15, 18, 376 (Chothia) 69, 71 389, 408, 425 (Chothia) 493, 103 22, 25, 376 (AbM) 389, 408, 425 (AbM) BCMA- 256 2, 5, 157 (Kabat) 60, 65, 548 390, 183, 193 (Kabat) 227, 232, 574 40 13, 17, 157 (Chothia) 68, 70 390, 183, 193 (Chothia) 242, 108 20, 24, 157 (AbM) 390, 183, 193 (AbM) BCMA- 530 2, 374, 9 (Kabat) 199, 65, 549 391, 409, 426 (Kabat) 458, 476, 575 584 41 13, 516, 9 (Chothia) 68, 70 391, 409, 426 (Chothia) 494, 109 20, 512, 9 (AbM) 391, 409, 426 (AbM) BCMA- 531 1, 4, 7 (Kabat) 439, 64, 550 392, 40, 427 (Kabat) 459, 477, 576 42 12, 16, 7 (Chothia) 67, 70 392, 40, 427 (Chothia) 495, 506 19, 23, 7 (AbM) 392, 40, 427 (AbM) BCMA- 519 1, 4, 7 (Kabat) 436, 64, 552 394, 39, 429 (Kabat) 461, 85, 578 44 12, 16, 7 (Chothia) 67, 70 394, 39, 429 (Chothia) 93, 107 19, 23, 7 (AbM) 394, 39, 429 (AbM) BCMA- 110 1, 4, 7 (Kabat) 59, 64, 553 395, 411, 430 (Kabat) 462, 479, 579 45 12, 16, 7 (Chothia) 67, 70 395, 411, 430 (Chothia) 497, 105 19, 23, 7 (AbM) 395, 411, 430 (AbM) BCMA- 110 1, 4, 7 (Kabat) 59, 64, 118 28, 39, 49 (Kabat) 74, 85, 130 46 12, 16, 7 (Chothia) 67, 70 28, 39, 49 (Chothia) 93, 104 19, 23, 7 (AbM) 28, 39, 49 (AbM) BCMA- 533 2, 5, 10 (Kabat) 197, 65, 554 396, 412, 431 (Kabat) 463, 480, 580 47 13, 17, 10 (Chothia) 443, 445 396, 412, 431 (Chothia) 498, 108 20, 24, 10 (AbM) 396, 412, 431 (AbM) BCMA- 115 2, 5, 10 (Kabat) 60, 65, 555 396, 412, 58 (Kabat) 464, 480, 581 48 13, 17, 10 (Chothia) 68, 71 396, 412, 58 (Chothia) 499, 109 20, 24, 10 (AbM) 396, 412, 58 (AbM) BCMA- 524 2, 5, 10 (Kabat) 437, 65, 556 397, 413, 432 (Kabat) 465, 481, 582 49 13, 17, 10 (Chothia) 68, 71 397, 413, 432 (Chothia) 500, 109 20, 24, 10 (AbM) 397, 413, 432 (AbM) BCMA- 519 1, 4, 7 (Kabat) 436, 64, 557 398, 414, 433 (Kabat) 466, 482, 583 51 12, 16, 7 (Chothia) 67, 70 398, 414, 433 (Chothia) 501, 508 19, 23, 7 (AbM) 398, 414, 433 (AbM) BCMA- 324 288, 290, 292 (Kabat) 308, 310, 326 302, 304, 306 (Kabat) 316, 318, 585 C1, V.sub.H- 294, 296, 292 (Chothia) 312, 314 302, 304, 306 (Chothia) 320, 322 V.sub.L 298, 300, 292 (AbM) 302, 304, 306 (AbM) BCMA- 324 288, 290, 292 (Kabat) 308, 310, 326 302, 304, 306 (Kabat) 316, 318, 328 C1, V.sub.L- 294, 296, 292 (Chothia) 312, 314 302, 304, 306 (Chothia) 320, 322 V.sub.H 298, 300, 292 (AbM) 302, 304, 306 (AbM) BCMA- 325 289, 291, 293 (Kabat) 309, 311, 327 303, 305, 307 (Kabat) 317, 319, 329 C2, V.sub.H- 295, 297, 293 (Chothia) 313, 315 303, 305, 307 (Chothia) 321, 323 V.sub.L 299, 301, 293 (AbM) 303, 305, 307 (AbM) BCMA- 325 289, 291, 293 (Kabat) 309, 311, 327 303, 305, 307 (Kabat) 317, 319, 586 C2, V.sub.L- 295, 297, 293 (Chothia) 313, 315 303, 305, 307 (Chothia) 321, 323 V.sub.H 299, 301, 293 (AbM) 303, 305, 307 (AbM)
(967) 2B. Binding Affinities
(968) Clones were purified and titrated, and their binding affinities (EC.sub.50) to hBMCA-expressing HEK293 cells was assessed using a flow cytometry-based assay using the fluorochrome-conjugated detection antibody as described in Example 1. EC.sub.50 for mouse anti-BCMA antibodies, either BCMA-C1, V.sub.L-V.sub.H scFv antibody (SEQ ID NO:328) or BCMA-C2, V.sub.H-V.sub.L scFv antibody (SEQ ID NO:329), were also determined.
(969) 2C. Binding Selectivity
(970) Binding of exemplary scFv clones to hBMCA-expressing HEK293 cells was assessed and binding was compared to parental HEK293 cells. The results showed that clones exhibited binding selectivity to hBMCA-expressing HEK293 cells over parental HEK293 cells. As an example, clones BCMA-18, -19, -20, -21 and -22 exhibited 2.2-fold, 4.2-fold, 10.8-fold, 3.4-fold and 7.5-fold selective binding, respectively.
(971) Binding of exemplary scFv clones to hBMCA-overexpressing HEK293 cells as compared to OPM2 and RPMI-8226 cell lines that express moderate levels of endogenous BCMA was assessed. The results showed that many of the tested clones exhibited higher binding to hBMCA-expressing HEK293 cells, which express a high level of BCMA, compared to the OPM2 and RPMI-8226 cell lines that express moderate levels of BCMA. For example, clones BCMA-1, -2, -3, -4, -5, -7, -8, -9, -10, -12, -18, -19, -20, -21, -22, -30, -31 and -32 exhibited higher binding to hBCMA-overexpressing HEK293 cells. In this particular experiment, BCMA-13, -14 and -16 did not exhibit substantially higher binding to hBCMA-expressing HEK293 cells compared to negative control.
Example 3: Generation and Assessment of Anti-BCMA Antibodies (scFvs)
(972) Epitopes recognized, e.g., specifically bound to, by exemplary anti-BCMA scFv clones (BCMA-1, BCMA-5, BCMA-9, BCMA-23, BCMA-25, BCMA-26, BCMA-52 and BCMA-55 anti-BCMA scFvs), were assessed using full discontinuous epitope mapping by Chemical Linkage of Peptides onto Scaffolds (CLIPS; Pepscan Presto BV, Lelystad, The Netherlands; see, e.g., Timmerman et al., (2007) J. Mol. Recognit. 20: 283-329). Mapping was carried out using anti-BCMA scFv clones, such as those fused with mouse Fc (scFv-mFc).
(973) Linear and conformational peptide libraries of amino acid residues 1-54 of human BCMA (set forth as amino acid residues 1-54 of SEQ ID NO:367) were generated based on a combinatorial matrix design. Linear peptides and structural mimetics including single loop, α-helix, β-turn, combinatorial and linear disulfide bridge mimics, and discontinuous epitope mimics were used, along with positive and negative control peptides, on an amino-functionalized solid support.
(974) Affinities for binding to the peptides in the epitope library were determined using ELISA. The peptide arrays were incubated with a solution containing the scFv overnight at 4° C. Affinity information was used in iterative screens to define the sequence and conformation of epitopes. Heat maps of affinity information for two or more loops were generated.
(975) scFvs assessed were observed to recognized conformational epitopes that included several discontinuous peptide stretches of the BCMA peptide sequence. BCMA-1, BCMA-5, BCMA-23 and BCMA-25 scFv were observed to bind to a peptide of .sub.30SNTPPLTCQR.sub.39 (set forth in SEQ ID NO:608), which could be recognized in a linear form. In some aspects, such antibodies recognize a non-linear or linear epitope including residues of such peptide of SEQ ID NO: 608, and in some aspects to recognize a non-linear epitope further including residues of 21CIPCQLR.sub.27 (set forth in SEQ ID NO:609), .sub.30SNTPPLTCQR.sub.39 (SEQ ID NO: 608) and/or 44SVTNSVK.sub.50 (set forth in SEQ ID NO:610). The BCMA-26 scFv was observed to recognize an epitope comprising residues present in .sub.8CSQNEYF.sub.14 (set forth in SEQ ID NO:611) and .sub.17LLHACIPCQLR.sub.27 (set forth in SEQ ID NO:612). BCMA-52-scFv-mFc was observed to bind to an epitope containing residues of the following discontinuous peptides: .sub.10QNEYF.sub.14 (SEQ ID NO:613), .sub.21CIPCQL.sub.26 (SEQ ID NO:614), and .sub.7CQRYC.sub.41 (SEQ ID NO:615). BCMA-55-scFv-mFc was observed to specifically bind to an epitope containing residues present in peptides comprising discontinuous portions of the BCMA polypeptide sequence, individually comprising the following sequences: .sub.1MLMAG.sub.6 (SEQ ID NO:616), .sub.13YFDSL.sub.17 (SEQ ID NO:618), and .sub.25QLRCSSNTPPL.sub.35 (SEQ ID NO:619). In some embodiments, the provided antibody or receptor specifically binds to an epitope comprising residues present within one or more of, e.g., each of discontinuous peptides having the sequences of: MLMAG (SEQ ID NO:616), YFDSL (SEQ ID NO:618), and QLRCSSNTPPL (SEQ ID NO:619). In some aspects, the provided antibody or receptor specifically binds to an epitope comprising residues present within one or more of, e.g., each of, the following discontinuous peptides having the sequences of: MLMAG (SEQ ID NO:616), YFDSLL (SEQ ID NO:620), and QLRCSSNTPPL (SEQ ID NO:619); in some aspects, the provided antibody or receptor specifically binds to an epitope comprising residues present within one or more of, e.g., each of, the following discontinuous peptides having the sequences of: MLMAG (SEQ ID NO:617), QNEYFDSLL (SEQ ID NO:617), and QLRCSSNTPPL (SEQ ID NO:619).
(976) The present invention is not intended to be limited in scope to the particular disclosed embodiments, which are provided, for example, to illustrate various aspects of the invention. Various modifications to the compositions and methods described will become apparent from the description and teachings herein. Such variations may be practiced without departing from the true scope and spirit of the disclosure and are intended to fall within the scope of the present disclosure.
(977) TABLE-US-00005 SEQUENCES SEQ ID NO SEQUENCE Description 1 DYAMS BCMA-1, -3, -4, -5, -6, -7, -8, -25, -31, -42, -44, -45, -46, -51 CDR- H1 (aa) Kabat numbering 2 DYYMS BCMA-2, -9, -10, -12, -17, -21, -22, -23, -24, -26, -32, -33, -35, -36, -37, -38, -40, -41, -47, -48, -49 CDR-H1 (aa) Kabat numbering 3 DYAMH BCMA-11, -20, -27, -28, -29, -30, -34, -39 CDR-H1 (aa) Kabat numbering 4 FIRSKAYGGTTEYAASVKG BCMA-1, -3, -4, -5, -6, -7, -8, -25, -31, -42, -44, -45, -46, -51 CDR- H2 (aa) Kabat numbering 5 YISSSGSTIYYADSVKG BCMA-2, -9, -10, -12, -17, -21, -22, -23, -26, -32, -35, -36, -37, -38, -40, -47, -48, -49 CDR- H2 (aa) Kabat numbering 6 GISWNSGSIGYADSVKG BCMA-11, -20, -24, -27, -29, -30, -34, -39 CDR-H2 (aa) Kabat numbering 7 WSAPTDY BCMA-1, -3, -4, -5, -6, -7, -8, -25, -31, -42, -44, -45, -46, -51 and VH-2 CDR-H3 (aa) 8 VDGPPSSDI BCMA-2 CDR-H3 (aa) 9 VDGDYVDDY BCMA-9, -36, -37, -38, -41 and VH-8 CDR-H3 (aa) 10 VDGPPSFDI BCMA-10, -12, -26, -32, -47, -48, -49 and VH-1 CDR-H3 (aa) 11 DLGPDYDPDAFDI BCMA-11, -34 CDR- H3 (aa) 12 GFTFGDY BCMA-1, -3, -4, -5, -6, -7, -8, -25, -30, -31, -42, -44, -45, -46, -51 CDR-H1 (aa) Chothia numbering 13 GFTFSDY BCMA-2, -9, -12, -17, -21, -22, -23, -24, -26, -32, -33, -35, -36, -37, -38, -40, -47, -48, -49 CDR-H1 (aa) Chothia numbering 14 GFPFSDY BCMA-10 CDR-H1 (aa) Chothia numbering 15 GFTFDDY BCMA-11, -20, -27, -28, -29, -34, -39 CDR- H1 (aa) Chothia numbering 16 RSKAYGGT BCMA-1, -3, -4, -5, -6, -7, -8, -25, -31, -42, -44, -45, -46, -51 CDR- H2 (aa) Chothia numbering 17 SSSGST BCMA-2, -9, -10, -12, -17, -21, -22, -23, -26, -32, -35, -36, -38, -40, -47, -48 CDR-H2 (aa) Chothia numbering 18 SWNSGS BCMA-11, -20, -24, -27, -29, -30, -34, -39 CDR-H2 (aa) Chothia numbering 19 GFTFGDYAMS BCMA-1, -3, -4, -5, -6, -7, -8, -25, -31, -42, -44, -45, -46, -51 CDR- H1 (aa) AbM numbering 20 GFTFSDYYMS BCMA-2, -9, -12, -17, -21, -22, -23, -24, -26, -32, -33, -35, -36, -37, -38, -40, -47, -48, -49 CDR-H1 (aa) AbM numbering 21 GFPFSDYYMS BCMA-10 CDR-H1 (aa) AbM numbering 22 GFTFDDYAMH BCMA-11, -20, -27, -28, -29, -34, -39 CDR- H1 (aa) AbM numbering 23 FIRSKAYGGTTE BCMA-1, -3, -4, -5, -6, -7, -8, -25, -31, -42, -44, -45, -46, -51 CDR- H2 (aa) AbM numbering 24 YISSSGSTIY BCMA-2, -9, -10, -12, -17, -21, -22, -23, -26, -32, -35, -36, -38, -40, -47, -48 CDR-H2 (aa) AbM numbering 25 GISWNSGSIG BCMA-11, -20, -24, -27, -29, -30, -34, -39 CDR-H2 (aa) AbM numbering 26 KSSQSVLSTSNNKNYLA BCMA-1 CDR-L1 (aa) 27 RASQSIKTNLA BCMA-2 CDR-L1 (aa) 28 KSSQSVLHSSNNKNYLA BCMA-3, -46 CDR-L1 (aa) 29 RASQDIRNSLA BCMA-4 CDR-L1 (aa) 30 KSSQSVLYSSNNKNYLA BCMA-5, -8, -24 CDR- L1 (aa) 31 RASQSISNSLA BCMA-6 CDR-L1 (aa) 32 RASQDIGDYLA BCMA-7 CDR-L1 (aa) 33 GANNIGSKSVH BCMA-9, -26, -35 CDR-L1 (aa) 34 GGNNIERKNVH BCMA-10 CDR-L1 (aa) 35 SGSSSNIGSNAVN BCMA-11 CDR-L1 (aa) 36 SGSRSNIGNNYVS BCMA-12 CDR-L1 (aa) 37 WASTREA BCMA-1 CDR-L2 (aa) 38 AASTEAT BCMA-2 CDR-L2 (aa) 39 WASTRES BCMA-3, -5, -8, -31, -44, -46 CDR-L2 (aa) 40 AASRLES BCMA-4, -42 CDR-L2 (aa) 41 AASNVED BCMA-6 CDR-L2 (aa) 42 VASTLQS BCMA-7 CDR-L2 (aa) 43 DDDDRPS BCMA-9, -26, -35 CDR-L2 (aa) 44 DDSDRAS BCMA-10 CDR-L2 (aa) 45 NSHQRPS BCMA-11 CDR-L2 (aa) 46 DNAKRPS BCMA-12 CDR-L2 (aa) 47 QQYFSSPYT BCMA-1 CDR-L3 (aa) 48 QQYGSSPT BCMA-2 CDR-L3 (aa) 49 QQYYTTPLT BCMA-3, -46 CDR-L3 (aa) 50 QQYYSLPLS BCMA-4 CDR-L3 (aa) 51 QQYYSTPWT BCMA-5 CDR-L3 (aa) 52 QQSHMYPPT BCMA-6 CDR-L3 (aa) 53 QQYHSHPWT BCMA-7 CDR-L3 (aa) 54 QQYYSTPYT BCMA-8, -31 CDR-L3 (aa) 55 HVWDRSRDHYV BCMA-9 CDR-L3 (aa) 56 QAWDSSSTLYV BCMA-10 CDR-L3 (aa) 57 AAWDDSLRGYV BCMA-11 CDR-L3 (aa) 58 QVWDSSSDHWV BCMA-12, -32, -48 CDR-L3 (aa) 59 QVQLVQSGGGLVQPGRSLRLSCTASGFTFG BCMA-1, -3, -4, -5, -6, -7, -8, -45, -46 VH FR1 (aa) 60 EVQLVESGGGLVKPGGSLRLSCAASGFTFS BCMA-2, -12, -22, -23, -26, -40, -48 VH FR1 (aa) 61 EVQLVQSGGGLVKPGGSLRLSCAASGFTFS BCMA-9, -24, -35, -37 VH FR1 (aa) 62 EVQLVESGGGLVKPGGSLRLSCAASGFPFS BCMA-10 VH FR1 (aa) 63 QVQLVQSGGGLVQPGRSLRLSCAASGFTFD BCMA-11, -28, -29, -39 VH FR1 (aa) 64 WFRQAPGKGLEWVG BCMA-1, -3, -4, -5, -6, -7, -8, -25, -31, -42, -44, -45, -46, -51 VH FR2 (aa) 65 WIRQAPGKGLEWVS BCMA-2, -9, -10, -12, -21, -22, -23, -24, -26, -32, -33, -35, -36, -37, -38, -40, -41, -47, -48, 49 VH FR2 (aa) 66 WVRRAPGKGLEWVS BCMA-11 VH FR2 (aa) 67 RFTISRDDSKSIAYLQMNSLKTEDTAVYYCAA BCMA-1, -3, -4, -5, -6, -7, -8, -25, -31, -42, -44, -45, -46, -51 VH FR3 (aa) 68 RFTISRDNAKNSLYLQMNSLRAEDTAVYYCAK BCMA-2, -10, -12, -21, -22, -23, -26, -32, -40, -41, -48, -49 VH FR3 (aa) 69 RFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR BCMA-9, -11, -17, -24, -28, -29, -30, -33, -34, -35, -36, -38, -39 VH FR3 (aa) 70 WGQGTLVTVSS BCMA-1, -3, -4, -5, -6, -7, -8, -9, -15, -16, -18, -20, -21, -22, -23, -25, -27, -31, -35, -36, -37, -38, -40, -41, -42, -44, -45, -46, -51 VH FR4 (aa) 71 WGQGTMVTVSS BCMA-2, -10, -11, -12, -24, -26, -29, -30, -32, -34, -39, -48, -49, -50 VH FR4 (aa) 72 DIVMTQSPDSLSVSPGERATISC BCMA-1 VL FR1 (aa) 73 EIVMTQSPATLSVSPGETATLSC BCMA-2 VL FR1 (aa) 74 DIVMTQSPDSLVVSLGERATINC BCMA-3, -46 VL FR1 (aa) 75 AIRMTQSPSSLSASLGDRVTITC BCMA-4 VL FR1 (aa) 76 DIVMTQSPDSLAVSLGERATINC BCMA-5, -8, -24 VL FR1 (aa) 77 DIVMTQSPSSLSVSVGERVTITC BCMA-6 VL FR1 (aa) 78 VIQLTQSPSSLSASVGDRVTITC BCMA-7 VL FR1 (aa) 79 SYELTQPPSVSVAPGQTARVTC BCMA-9 VL FR1 (aa) 80 SYVLTQPPSVSVAPGQTARITC BCMA-10, -26 VL FR1 (aa) 81 QLVLTQPPSASGTPGQRVTISC BCMA-11 VL FR1 (aa) 82 QSALTQPPSVSAAPGQKVTISC BCMA-12 VL FR1 (aa) 83 WYQQKPGQPPRLLLY BCMA-1 VL FR2 (aa) 84 WYQQKPGQAPRLLIY BCMA-2, -34 VL FR2 (aa) 85 WYQQKPGQPPKLLIY BCMA-3, -5, -8, -24, -44, -46 VL FR2 (aa) 86 WYQQRPGKAPKLLLS BCMA-4 VL FR2 (aa) 87 WYKQRPGEAPKLLIH BCMA-6 VL FR2 (aa) 88 WFQQRPGKAPKSLIY BCMA-7 VL FR2 (aa) 89 WYQQKPGQAPMLVVY BCMA-9, -26, -35 VL FR2 (aa) 90 WYQQKPGQAPVPVVY BCMA-10 VL FR2 (aa) 91 WYQQLPGTAPEVLIY BCMA-11 VL FR2 (aa) 92 WYQQLPGTAPKLLIY BCMA-12 VL FR2 (aa) 93 GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC BCMA-1, -3, -5, -8, -31, -44, -46 VL FR3 (aa) 94 GIPDRFSGSGSGTDFTLTITRLEPEDFAVYYC BCMA-2 VL FR3 (aa) 95 GVPSRFSGTTSGAEYALSISSLQPEDVASYFC BCMA-4 VL FR3 (aa) 96 GVPSRFSGRGSGTVFTLAISNVQPEDFATYYC BCMA-6 VL FR3 (aa) 97 GVPSRFSGSGSGTHFTLTINSLQPEDFATYYC BCMA-7 VL FR3 (aa) 98 GIPERFSGSNSGNTATLTISGVEAGDEADYFC BCMA-9, -26, -35 VL FR3 (aa) 99 GIPERFSASNSGNTATLTISGAQATDEAEYYC BCMA-10 VL FR3 (aa) 100 GVPDRFSGSKSGTSASLAINGLQSEDEADYYC BCMA-11 VL FR3 (aa) 101 GIPDRFSGSKSGTSATLDIAGLQTGDEADYYC BCMA-12 VL FR3 (aa) 102 FGHGTKLEIK BCMA-1 VL FR4 (aa) 103 FGRGTKLEIK BCMA-2, -39 VL FR4 (aa) 104 FGGGTKVEIK BCMA-3, -4, -6, -30, -46 VL FR4 (aa) 105 FGQGTKVDIK BCMA-5, -45 VL FR4 (aa) 106 FGPGTKVDIK BCMA-7 VL FR4 (aa) 107 FGQGTKLEIK BCMA-8, -44 VL FR4 (aa) 108 FGTGTKLTvL BCMA-9, -10, -11, -26, -40, -47 VL FR4 (aa) 109 FGGGTKLTVL BCMA-12, -14, -15, -16, -17, -18, -32, -33, -36, -37, -38, -41, -48, -49, -50 VL FR4 (aa) 110 QVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-1, -3, -4, -5, -6, EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSS -7, -8, -45, -46 VH Chain (aa) 111 EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-2 V.sub.H Chain (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSSDIWGQGTMVTVSS 112 EVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-9 V.sub.H Chain (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVDGDYVDDYWGQGTLVTVSS 113 EVQLVESGGGLVKPGGSLRLSCAASGFPFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-10 V.sub.H Chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWGQGTMVTVSS (aa) 114 QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRRAPGKGLEWVSGISWNSGSIGY BCMA-11 V.sub.H Chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPDYDPDAFDIWGQGTMVTV (aa) SS 115 EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-12, -26, -48 V.sub.H ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWGQGTMVTVSS Chain (aa) 116 DIVMTQSPDSLSVSPGERATISCKSSQSVLSTSNNKNYLAWYQQKPGQPPRLLLYWASTR BCMA-1 V.sub.L Chain (aa) EAGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYFSSPYTFGHGTKLEIK 117 EIVMTQSPATLSVSPGETATLSCRASQSIKTNLAWYQQKPGQAPRLLIYAASTRATGIPD BCMA-2 V.sub.L Chain (aa) RFSGSGSGTDFTLTITRLEPEDFAVYYCQQYGSSPTFGRGTKLEIK 118 DIVMTQSPDSLVVSLGERATINCKSSQSVLHSSNNKNYLAWYQQKPGQPPKLLIYWASTR BCMA-3, -46 VL Chain ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYTTPLTFGGGTKVEIK (aa) 119 AIRMTQSPSSLSASLGDRVTITCRASQDIRNSLAWYQQRPGKAPKLLLSAASRLESGVPS BCMA-4 V.sub.L Chain (aa) RFSGTTSGAEYALSISSLQPEDVASYFCQQYYSLPLSFGGGTKVEIK 120 DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTR BCMA-5 V.sub.L Chain (aa) ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPWTFGQGTKVDIK 121 DIVMTQSPSSLSVSVGERVTITCRASQSISNSLAWYKQRPGEAPKLLIHAASNVEDGVPS BCMA-6 V.sub.L Chain (aa) RFSGRGSGTVFTLAISNVQPEDFATYYCQQSHMYPPTFGGGTKVEIK 122 VIQLTQSPSSLSASVGDRVTITCRASQDIGDYLAWFQQRPGKAPKSLIYVASTLQSGVPS BCMA-7 V.sub.L Chain (aa) RFSGSGSGTHFTLTINSLQPEDFATYYCQQYHSHPWTFGPGTKVDIK 123 DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTR BCMA-8 V.sub.L Chain (aa) ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYTFGQGTKLEIK 124 SYELTQPPSVSVAPGQTARVTCGANNIGSKSVHWYQQKPGQAPMLVVYDDDDRPSGIPER BCMA-9 V.sub.L Chain (aa) FSGSNSGNTATLTISGVEAGDEADYFCHVWDRSRDHYVFGTGTKLTVL 125 SYVLTQPPSVSVAPGQTARITCGGNNIERKNVHWYQQKPGQAPVPVVYDDSDRASGIPER BCMA-10 V.sub.L Chain FSASNSGNTATLTISGAQATDEAEYYCQAWDSSSTLYVFGTGTKLTVL (aa) 126 QLVLTQPPSASGTPGQRVTISCSGSSSNIGSNAVNWYQQLPGTAPEVLIYNSHQRPSGVP BCMA-11 V.sub.L Chain DRFSGSKSGTSASLAINGLQSEDEADYYCAAWDDSLRGYVFGTGTKLTVL (aa) 127 QSALTQPPSVSAAPGQKVTISCSGSRSNIGNNYVSWYQQLPGTAPKLLIYDNAKRPSGIP BCMA-12 V.sub.L Chain DRFSGSKSGTSATLDIAGLQTGDEADYYCQVWDSSSDHWVFGGGTKLTVL (aa) 128 QVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-1 scFv (aa) EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG GGSGGGGSGGGGSDIVMTQSPDSLSVSPGERATISCKSSQSVLSTSNNKNYLAWYQQKPG QPPRLLLYWASTREAGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYFSSPYTFGHG TKLEIK 129 EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-2 scFv (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSSDIWGQGTMVTVSSGG GGSGGGGSGGGGSEIVMTQSPATLSVSPGETATLSCRASQSIKTNLAWYQQKPGQAPRLL IYAASTRATGIPDRFSGSGSGTDFTLTITRLEPEDFAVYYCQQYGSSPTFGRGTKLEIK 130 QVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-3, 46 scFv (aa) EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG GGSGGGGSGGGGSDIVMTQSPDSLVVSLGERATINCKSSQSVLHSSNNKNYLAWYQQKPG QPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYTTPLTFGGG TKVEIK 131 QVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-4 scFv (aa) EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG GGSGGGGSGGGGSAIRMTQSPSSLSASLGDRVTITCRASQDIRNSLAWYQQRPGKAPKLL LSAASRLESGVPSRFSGTTSGAEYALSISSLQPEDVASYFCQQYYSLPLSFGGGTKVEIK 132 QVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-5 scFv (aa) EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG GGSGGGGSGGGGSDIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPG QPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPWTFGQG TKVDIK 133 QVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-6 scFv (aa) EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG GGSGGGGSGGGGSDIVMTQSPSSLSVSVGERVTITCRASQSISNSLAWYKQRPGEAPKLL IHAASNVEDGVPSRFSGRGSGTVFTLAISNVQPEDFATYYCQQSHMYPPTFGGGTKVEIK 134 QVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-7 scFv (aa) EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG GGSGGGGSGGGGSVIQLTQSPSSLSASVGDRVTITCRASQDIGDYLAWFQQRPGKAPKSL IYVASTLQSGVPSRFSGSGSGTHFTLTINSLQPEDFATYYCQQYHSHPWTFGPGTKVDIK 135 QVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-8 scFv (aa) EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG GGSGGGGSGGGGSDIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPG QPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYTFGQG TKLEIK 136 EVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-9 scFv (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVDGDYVDDYWGQGTLVTVSSGG GGSGGGGSGGGGSSYELTQPPSVSVAPGQTARVTCGANNIGSKSVHWYQQKPGQAPMLVV YDDDDRPSGIPERFSGSNSGNTATLTISGVEAGDEADYFCHVWDRSRDHYVFGTGTKLTV L 137 EVQLVESGGGLVKPGGSLRLSCAASGFPFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-10 scFv (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWGQGTMVTVSSGG GGSGGGGSGGGGSSYVLTQPPSVSVAPGQTARITCGGNNIERKNVHWYQQKPGQAPVPVV YDDSDRASGIPERFSASNSGNTATLTISGAQATDEAEYYCQAWDSSSTLYVFGTGTKLTV L 138 QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRRAPGKGLEWVSGISWNSGSIGY BCMA-11 scFv (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPDYDPDAFDIWGQGTMVTV SSGGGGSGGGGSGGGGSQLVLTQPPSASGTPGQRVTISCSGSSSNIGSNAVNWYQQLPGT APEVLIYNSHQRPSGVPDRFSGSKSGTSASLAINGLQSEDEADYYCAAWDDSLRGYVFGT GTKLTVL 139 EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-12 scFv (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWGQGTMVTVSSGG GGSGGGGSGGGGSQSALTQPPSVSAAPGQKVTISCSGSRSNIGNNYVSWYQQLPGTAPKL LIYDNAKRPSGIPDRFSGSKSGTSATLDIAGLQTGDEADYYCQVWDSSSDHWVFGGGTKL TVL 140 SYAMH BCMA-13 CDR-H1 (aa) Kabat numbering 141 SYGMH BCMA-14, -15 CDR- H1 (aa) Kabat numbering 142 SSAMQ BCMA-16 CDR-H1 (aa) Kabat numbering 143 SYWMS BCMA-18 CDR-H1 (aa) Kabat numbering 144 SYYMH BCMA-19 CDR-H1 (aa) Kabat numbering 145 VISYDGSNKYYADSVKG BCMA-13, -14, -15 CDR-H2 (aa) Kabat numbering 146 WIVVGSGNTNYAQKFQE BCMA-16 CDR-H2 (aa) Kabat numbering 147 HINQDGSEKYYVDSVKG BCMA-18 CDR-H2 (aa) Kabat numbering 148 WINPNSGGTNYAQKFQG BCMA-19 CDR-H2 (aa) Kabat numbering 149 LPGRDGYPGAFDY BCMA-13, -14 CDR- H3 (aa) 150 DQYSSSAQRADFDY BCMA-15 CDR-H3 (aa) 151 APYYDILTGYYL BCMA-16 CDR-H3 (aa) 152 EADSSADY BCMA-17, -33 CDR- H3 (aa) 153 WLAVTN BCMA-18 CDR-H3 (aa) 154 DGGDV BCMA-19 CDR-H3 (aa) 155 GGLGITPYYFDY BCMA-20, -27 CDR- H3 (aa) 156 VDGGYTEDY BCMA-21 CDR-H3 (aa) 157 VDGDYTEDY BCMA-22, -23, -40 CDR-H3 (aa) 158 GFTFSSY BCMA-13, -14, -15, -18 CDR-H1 (aa) Chothia numbering 159 GFTFTSS BCMA-16 CDR-H1 (aa) Chothia numbering 160 GYTFTSY BCMA-19 CDR-H1 (aa) Chothia numbering 161 SYDGSN BCMA-13, -14, -15 CDR-H2 (aa) Chothia numbering 162 VVGSGN BCMA-16 CDR-H2 (aa) Chothia numbering 163 NQDGSE BCMA-18 CDR-H2 (aa) Chothia numbering 164 NPNSGG BCMA-19 CDR-H2 (aa) Chothia numbering 165 GFTFSSYAMH BCMA-13 CDR-H1 (aa) AbM numbering 166 GFTFSSYGMH BCMA-14, -15 CDR- H1 (aa) AbM numbering 167 GFTFTSSAMQ BCMA-16 CDR-H1 (aa) AbM numbering 168 GFTFSSYWMS BCMA-18 CDR-H1 (aa) AbM numbering 169 GYTFTSYYMH BCMA-19 CDR-H1 (aa) AbM numbering 170 VISYDGSNKY BCMA-13, -14, -15 CDR-H2 (aa) AbM numbering 171 WIVVGSGNTN BCMA-16 CDR-H2 (aa) AbM numbering 172 HINQDGSEKY BCMA-18 CDR-H2 (aa) AbM numbering 173 WINPNSGGTN BCMA-19 CDR-H2 (aa) AbM numbering 174 GSGSNIGSNDVS BCMA-13, -14, -15, -16, -18, -21 CDR-L1 (aa) 175 GGNNIGFKGVQ BCMA-17, -33 CDR-L1 (aa) 176 TGTSSDVGDYNYVA BCMA-19 CDR-L1 (aa) 177 SGGKTVN BCMA-20, -27 CDR-L1 (aa) 178 TGSSSDVGKYNLVS BCMA-22, -23 CDR-L1 (aa) 179 WNDQRPS BCMA-13, -14, -15, -16, -18, -21 CDR-L2 (aa) 180 DDSDRPS BCMA-17, -32, -33 CDR-L2 (aa) 181 EVINRPS BCMA-19 CDR-L2 (aa) 182 SNDQRPS BCMA-20, -27 CDR-L2 (aa) 183 DVNKRPS BCMA-22, -23, -40 CDR-L2 (aa) 184 AAWDDSLGGSWV BCMA-13 CDR-L3 (aa) 185 AAWDDRLNGFWV BCMA-14 CDR-L3 (aa) 186 AAWDDSLSGWV BCMA-15 CDR-L3 (aa) 187 ASWDDSLSGWV BCMA-16 CDR-L3 (aa) 188 QVWDSASDHWV BCMA-17, -33 CDR-L3 (aa) 189 AAWDDSLNGWV BCMA-18 CDR-L3 (aa) 190 ISYSRGSTPYV BCMA-19 CDR-L3 (aa) 191 GSWDDSLNAWV BCMA-20, -27 CDR-L3 (aa) 192 AAWDDSLNGYV BCMA-21 CDR-L3 (aa) 193 CSYGGSRSYV BCMA-22, -40 CDR-L3 (aa) 194 SSYGGSRSYV BCMA-23 CDR-L3 (aa) 195 QMQLVQYGGGVVQPGRSLRLSCAASGFTFS BCMA-13 VH FR1 (aa) 196 EVQLLESGGGVVQPGRSLRLSCAASGFTFS BCMA-14 VH FR1 (aa) 197 QVQLLESGGGLVKPGGSLRLSCAASGFTFS BCMA-15, -47 VH FR1 (aa) 198 EVQLVQSGPEVKKPGTSVKVSCKASGFTFT BCMA-16 VH FR1 (aa) 199 QVQLVQSGGGLVKPGGSLRLSCAASGFTFS BCMA-17, -33, -36, -38, -41 VH FR1 (aa) 200 EVQLLESGGGLVQPGGSLRLSCAASGFTFS BCMA-18 VH FR1 (aa) 201 QVQLVQSGAEVKKPGASVKVSCKASGYTFT BCMA-19 VH FR1 (aa) 202 EVQLLESGGGLVQPGRSLRLSCAASGFTFD BCMA-20 VH FR1 (aa) 203 EVQLVESGGGLVKPGGSLKLSCAASGFTFS BCMA-21 VH FR1 (aa) 204 WVRQAPGKGLEWVA BCMA-13, -14, -15 VH FR2 (aa) 205 WVRQARGQRLEWIG BCMA-16 VH FR2 (aa) 206 WIRLAPGKGLEWVS BCMA-17 VH FR2 (aa) 207 WHRQAPGKGPEWVA BCMA-18 VH FR2 (aa) 208 WVRQAPGQGLEWMG BCMA-19 VH FR2 (aa) 209 WVRQAPGKGLEWVS BCMA-20, -27, -28, -29, -30, -34, -39 VH FR2 (aa) 210 RFTISRDNSKNTLYLQMNSLKAEDTAVYYCAT BCMA-13 VH FR3 (aa) 211 RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAT BCMA-14 VH FR3 (aa) 212 RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK BCMA-15 VH FR3 (aa) 213 RVTITRDMSTSTAYMELSSLRSEDTAVYYCAA BCMA-16 VH FR3 (aa) 214 RFTISRDNAESSLYLQMNSLRAEDTAVYYCAR BCMA-18 VH FR3 (aa) 215 RVTMTRDTSISTAYMELSRLRSDDTAVYYCAR BCMA-19 VH FR3 (aa) 216 RFTISRDNAKNSLYLQMNSLRAEDTALYYCAK BCMA-20, -27 VH FR3 (aa) 217 RGQGTLVTVSS BCMA-13 VH FR4 (aa) 218 RGPGTLVTVSS BCMA-14 VH FR4 (aa) 219 WGQGTLVNVSS BCMA-17, -33 VH FR4 (aa) 220 WGQGTTVTVSS BCMA-19 VH FR4 (aa) 221 QAVLTQPPSASGTPGQRVTISC BCMA-13, -14 VL FR1 (aa) 222 QSVLTQPPSASGTPGQRVTISC BCMA-15, -18, -21 VL FR1 (aa) 223 QSALTQPPSASGTPGQRVTISC BCMA-16 VL FR1 (aa) 224 QPVLTQPPSVSVAPGKTAMITC BCMA-17, -33 VL FR1 (aa) 225 QAVLTQPASVSGSPGQSITISC BCMA-19 VL FR1 (aa) 226 QPVLTQPPSASGTPGQRVTISC BCMA-20, -27 VL FR1 (aa) 227 QSALTQPASVSGSPGQSITISC BCMA-22, -23, -40 VL FR1 (aa) 228 WYQQIPGTAPKLLIY BCMA-13, -14, -15, -16, -18, -21 VL FR2 (aa) 229 WYQQKTGQAPVLVVY BCMA-17, -33 VL FR2 (aa) 230 WYQQHPGKDPKLMIF BCMA-19 VL FR2 (aa) 231 WFRQVPGTAPQLLIY BCMA-20, -27 VL FR2 (aa) 232 WYQQPPGKAPKLIIY BCMA-22, -23, -40 VL FR2 (aa) 233 GVPDRFSASKSGTSASLAISGLRSEDEADYYC BCMA-13 VL FR3 (aa) 234 GVPDRFSGSKSGASASLAISGLQSEDEADYYC BCMA-14 VL FR3 (aa) 235 GVPDRFSGSKSGTSASLVISGLRSEDEADYYC BCMA-15 VL FR3 (aa) 236 GVPDRFSGSKSGTSASLAISGLQSEDEADYYC BCMA-16 VL FR3 (aa) 237 GIPERFSGSNSGNTATLTISRVEAGDEADYYC BCMA-17, -33 VL FR3 (aa) 238 GVPDRFSGSKSGTSASLAISGLRSEDEADYYC BCMA-18 VL FR3 (aa) 239 GVSDRFSGSKSGNTASLDISGLQPEDEADYYC BCMA-19 VL FR3 (aa) 240 GVPDRFSGSKSGSSASLDISGLQSEDEAYYYC BCMA-20, -27 VL FR3 (aa) 241 GVPDRFSGSKSGISASLAISGLRSEDEADYYC BCMA-21 VL FR3 (aa) 242 GVSNRFSGSKSGNTATLTISGLQGDDEADYYC BCMA-22, -23, -40 VL FR3 (aa) 243 FGGGTKVTVL BCMA-13 VL FR4 (aa) 244 IGTGTKVTVL BCMA-19 VL FR4 (aa) 245 FGGETKLTVL BCMA-20, -27 VL FR4 (aa) 246 FGTGTKVTVL BCMA-21, -22, -23 VL FR4 (aa) 247 QMQLVQYGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGRGLEWVAVISYDGSNKYY BCMA-13 V.sub.H Chain ADSVKGRFTISRDNSKNTLYLQMNSLKAEDTAVYYCATLPGRDGYPGAFDYRGQGTLVTV (aa) SS 248 EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGRGLEWVAVISYDGSNKYY BCMA-14 V.sub.H Chain ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCATLPGRDGYPGAFDYRGPGTLVTV (aa) SS 249 QVQLLESGGGLVKPGGSLRLSCAASGFTFSSYGMHWVRQAPGRGLEWVAVISYDGSNKYY BCMA-15 V.sub.H Chain ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQYSSSAQRADFDYWGQGTLVT (aa) VSS 250 EVQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAMQWVRQARGQRLEWIGWIVVGSGNTNY BCMA-16 V.sub.H Chain AQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAAPYYDILTGYYLWGQGTLVTVS (aa) S 251 QVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRLAPGRGLEWVSYISSSGSTIYY BCMA-17 V.sub.H Chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREADSSADYWGQGTLVNVSS (aa) 252 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMSWHRQAPGKGPEWVAHINQDGSEKYY BCMA-18 V.sub.H Chain VDSVKGRFTISRDNAESSLYLQMNSLRAEDTAVYYCARWLAVTNWGQGTLVTVSS (aa) 253 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGWINPNSGGTNY BCMA-19 V.sub.H Chain AQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDGGDVWGQGTTVTVSS (aa) 254 EVQLLESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGRGLEWVSGISWNSGSIGY BCMA-20 V.sub.H Chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGGLGITPYYFDYWGQGTLVTVS (aa) S 255 EVQLVESGGGLVKPGGSLKLSCAASGFTFSDYYMSWIRQAPGRGLEWVSYISSSGSTIYY BCMA-21 V.sub.H Chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGGYTEDYWGQGTLVTVSS (aa) 256 EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGRGLEWVSYISSSGSTIYY BCMA-22, -23, -40 V.sub.H ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGDYTEDYWGQGTLVTVSS Chain (aa) 257 QAVLTQPPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGTAPKLLIYWNDQRPSGVP BCMA-13 V.sub.L Chain DRFSASKSGTSASLAISGLRSEDEADYYCAAWDDSLGGSWVFGGGTKVTVL (aa) 258 QAVLTQPPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGTAPKLLIYWNDQRPSGVP BCMA-14 V.sub.L Chain DRFSGSKSGASASLAISGLQSEDEADYYCAAWDDRLNGFWVFGGGTKLTVL (aa) 259 QSVLTQPPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGTAPKLLIYWNDQRPSGVP BCMA-15 V.sub.L Chain DRFSGSKSGTSASLVISGLRSEDEADYYCAAWDDSLSGWVFGGGTKLTVL (aa) 260 QSALTQPPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGTAPKLLIYWNDQRPSGVP BCMA-16 V.sub.L Chain DRFSGSKSGTSASLAISGLQSEDEADYYCASWDDSLSGWVFGGGTKLTVL (aa) 261 QPVLTQPPSVSVAPGKTAMITCGGNNIGFKGVQWYQQKTGQAPVLVVYDDSDRPSGIPER BCMA-17, -33 V.sub.L FSGSNSGNTATLTISRVEAGDEADYYCQVWDSASDHWVFGGGTKLTVL Chain (aa) 262 QSVLTQPPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGTAPKLLIYWNDQRPSGVP BCMA-18 V.sub.L Chain DRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLNGWVFGGGTKLTVL (aa) 263 QAVLTQPASVSGSPGQSITISCTGTSSDVGDYNYVAWYQQHPGKDPKLMIFEVINRPSGV BCMA-19 V.sub.L Chain SDRFSGSKSGNTASLDISGLQPEDEADYYCISYSRGSTPYVIGTGTKVTVL (aa) 264 QPVLTQPPSASGTPGQRVTISCSGGKTVNWFRQVPGTAPQLLIYSNDQRPSGVPDRFSGS BCMA-20, -27 V.sub.L KSGSSASLDISGLQSEDEAYYYCGSWDDSLNAWVFGGETKLTVL Chain (aa) 265 QSVLTQPPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGTAPKLLIYWNDQRPSGVP BCMA-21 V.sub.L Chain DRFSGSKSGISASLAISGLRSEDEADYYCAAWDDSLNGYVFGTGTKVTVL (aa) 266 QSALTQPASVSGSPGQSITISCTGSSSDVGKYNLVSWYQQPPGKAPKLIIYDVNKRPSGV BCMA-22 V.sub.L Chain SNRFSGSKSGNTATLTISGLQGDDEADYYCCSYGGSRSYVFGTGTKVTVL (aa) 267 QSALTQPASVSGSPGQSITISCTGSSSDVGKYNLVSWYQQPPGKAPKLIIYDVNKRPSGV BCMA-23 V.sub.L Chain SNRFSGSKSGNTATLTISGLQGDDEADYYCSSYGGSRSYVFGTGTKVTVL (aa) 268 QMQLVQYGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGRGLEWVAVISYDGSNKYY BCMA-13 scFv (aa) ADSVKGRFTISRDNSKNTLYLQMNSLKAEDTAVYYCATLPGRDGYPGAFDYRGQGTLVTV SSGGGGSGGGGSGGGGSQAVLTQFPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGT APKLLIYWNDQRPSGVPDRFSASKSGTSASLAISGLRSEDEADYYCAAWDDSLGGSWVFG GGTKVTVL 269 EVQLLESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGRGLEWVAVISYDGSNKYY BCMA-14 scFv (aa) ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCATLPGRDGYPGAFDYRGPGTLVTV SSGGGGSGGGGSGGGGSQAVLTQFPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGT APKLLIYWNDQRPSGVPDRFSGSKSGASASLAISGLQSEDEADYYCAAWDDRLNGFWVFG GGTKLTVL 270 QVQLLESGGGLVKPGGSLRLSCAASGFTFSSYGMHWVRQAPGRGLEWVAVISYDGSNKYY BCMA-15 scFv (aa) ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQYSSSAQRADFDYWGQGTLVT VSSGGGGSGGGGSGGGGSQSVLTQPPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPG TAPKLLIYWNDQRPSGVPDRFSGSKSGTSASLVISGLRSEDEADYYCAAWDDSLSGWVFG GGTKLTVL 271 EVQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAMQWVRQARGQRLEWIGWIVVGSGNTNY BCMA-16 scFv (aa) AQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAAPYYDILTGYYLWGQGTLVTVS SGGGGSGGGGSGGGGSQSALTQPPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGTA PKLLIYWNDQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCASWDDSLSGWVFGGG TKLTVL 272 QVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRLAPGKGLEWVSYISSSGSTIYY BCMA-17 scFv (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREADSSADYWGQGTLVNVSSGGG GSGGGGSGGGGSQPVLTQPPSVSVAPGKTAMITCGGNNIGFKGVQWYQQKTGQAPVLVVY DDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSASDHWVFGGGTKLTVL 273 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMSWHRQAPGKGPEWVAHINQDGSEKYY BCMA-18 scFv (aa) VDSVKGRFTISRDNAESSLYLQMNSLRAEDTAVYYCARWLAVTNWGQGTLVTVSSGGGGS GGGGSGGGGSQSVLTQPPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGTAPKLLIY WNDQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLNGWVFGGGTKLTVL 274 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGWINPNSGGTNY BCMA-19 scFv (aa) AQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDGGDVWGQGTTVTVSSGGGGSG GGGSGGGGSQAVLTQPASVSGSPGQSITISCTGTSSDVGDYNYVAWYQQHPGKDPKLMIF EVINRPSGVSDRFSGSKSGNTASLDISGLQPEDEADYYCISYSRGSTPYVIGTGTKVTVL 275 EVQLLESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGY BCMA-20 scFv (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGGLGITPYYFDYWGQGTLVTVS SGGGGSGGGGSGGGGSQPVLTQPPSASGTPGQRVTISCSGGKTVNWFRQVPGTAPQLLIY SNDQRPSGVPDRFSGSKSGSSASLDISGLQSEDEAYYYCGSWDDSLNAWVFGGETKLTVL 276 EVQLVESGGGLVKPGGSLKLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-21 scFv (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGGYTEDYWGQGTLVTVSSGG GGSGGGGSGGGGSQSVLTQPPSASGTPGQRVTISCSGSGSNIGSNDVSWYQQIPGTAPKL LIYWNDQRPSGVPDRFSGSKSGISASLAISGLRSEDEADYYCAAWDDSLNGYVFGTGTKV TVL 277 EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-22 scFv (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGDYTEDYWGQGTLVTVSSGG GGSGGGGSGGGGSQSALTQPASVSGSPGQSITISCTGSSSDVGKYNLVSWYQQPPGKAPK LIIYDVNKRPSGVSNRFSGSKSGNTATLTISGLQGDDEADYYCCSYGGSRSYVFGTGTKV TVL 278 EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-23 scFv (aa) ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGDYTEDYWGQGTLVTVSSGG GGSGGGGSGGGGSQSALTQPASVSGSPGQSITISCTGSSSDVGKYNLVSWYQQPPGKAPK LIIYDVNKRPSGVSNRFSGSKSGNTATLTISGLQGDDEADYYCSSYGGSRSYVFGTGTKV TVL 279 VDGDDAFDI V.sub.H-3 CDR-H3 (aa) 280 DPLSWDSSGKGPR V.sub.H-4 CDR-H3 (aa) 281 ENYDFWSWRYYYDMDV V.sub.H-5 CDR-H3 (aa) 282 VDGPPSYDI V.sub.H-6 CDR-H3 (aa) 283 GDWDDAFDI V.sub.H-7 CDR-H3 (aa) 284 VDGDYEDY V.sub.H-9 CDR-H3 (aa) 285 DVPSSGDDAFDI V.sub.H-10 CDR-H3 (aa) 286 VDGDDVFDI V.sub.H-11 CDR-H3 (aa) 287 VDGDAFDI V.sub.H-12 CDR-H3 (aa) 288 DYSIN Reference Antibody 1 V.sub.H CDR-H1 (aa) 289 NFGMN Reference Antibody 2 V.sub.H CDR-H1 (aa) 290 WINTETREPAYAYDFRG Reference Antibody 1 V.sub.H CDR-H2 (aa) 291 WINTYTGESYFADDFKG Reference Antibody 2 V.sub.H CDR-H2 (aa) 292 DYSYAMDY Reference Antibody 1 V.sub.H CDR-H3 (aa) 293 GEIYYGYDGGFAY Reference Antibody 2 V.sub.H CDR-H3 (aa) 294 GYTFTDY Reference Antibody 1 V.sub.H CDR-H1 (aa) Chothia numbering 295 GYTFTNF Reference Antibody 2 V.sub.H CDR-H1 (aa) Chothia numbering 296 NTETRE Reference Antibody 1 V.sub.H CDR-H2 (aa) Chothia numbering 297 NTYTGE Reference Antibody 2 V.sub.H CDR-H2 (aa) Chothia numbering 298 GYTFTDYSIN Reference Antibody 1 V.sub.H CDR-H1 (aa) AbM numbering 299 GYTFTNFGMN Reference Antibody 2 V.sub.H CDR-H1 (aa) AbM numbering 300 WINTETREPA Reference Antibody 1 V.sub.H CDR-H2 (aa) AbM numbering 301 WINTYTGESY Reference Antibody 2 V.sub.H CDR-H2 (aa) AbM numbering 302 RASESVTILGSHLIH Reference Antibody 1 VL CDR-L1 (aa) 303 RASQDVNTAVS Reference Antibody 2 VL CDR-L1 (aa) 304 LASNVQT Reference Antibody 1 VL CDR-L2 (aa) 305 SASYRYT Reference Antibody 2 VL CDR-L2 (aa) 306 LQSRTIPRT Reference Antibody 1 VL CDR-L3 (aa) 307 QQHYSTPWT Reference Antibody 2 VL CDR-L3 (aa) 308 QIQLVQSGPELKKPGETVKISCKASGYTFT Reference Antibody 1 V.sub.H FR1 (aa) 309 QIQLVQSGPDLKKPGETVKLSCKASGYTFT Reference Antibody 2 V.sub.H FR1 (aa) 310 WVKRAPGKGLKWMG Reference Antibody 1 V.sub.H FR2 (aa) 311 WVKQAPGKGFKWMA Reference Antibody 2 V.sub.H FR2 (aa) 312 RFAFSLETSASTAYLQINNLKYEDTATYFCAL Reference Antibody 1 V.sub.H FR3 (aa) 313 RFAFSVETSATTAYLQINNLKTEDTATYFCAR Reference Antibody 2 V.sub.H FR3 (aa) 314 WGQGTSVTVSS Reference Antibody 1 V.sub.H FR4 (aa) 315 WGQGTLVTVSA Reference Antibody 2 V.sub.H FR4 (aa) 316 DIVLTQSPPSLAMSLGKRATISC Reference Antibody 1 V.sub.L FR1 (aa) 317 DVVMTQSHRFMSTSVGDRVSITC Reference Antibody 2 V.sub.L FR1 (aa) 318 WYQQKPGQPPTLLIQ Reference Antibody 1 V.sub.L FR2 (aa) 319 WYQQKPGQSPKLLIF Reference Antibody 2 V.sub.L FR2 (aa) 320 GVPARFSGSGSRTDFTLTIDPVEEDDVAVYYC Reference Antibody 1 V.sub.L FR3 (aa) 321 GVPDRFTGSGSGADFTLTISSVQAEDLAVYYC Reference Antibody 2 V.sub.L FR3 (aa) 322 FGGGTKLEIK Reference Antibody 1 V.sub.L FR4 (aa) 323 FGGGTKLDIK Reference Antibody 2 V.sub.L FR4 (aa) 324 QIQLVQSGPELKKPGETVKISCKASGYTFTDYSINWVKRAPGKGLKWMGWINTETREPAY Reference Antibody 1 AYDFRGRFAFSLETSASTAYLQINNLKYEDTATYFCALDYSYAMDYWGQGTSVTVSS V.sub.H Chain (aa) 325 QIQLVQSGPDLKKPGETVKLSCKASGYTFTNFGMNWVKQAPGKGFKWMAWINTYTGES YF ADDFKGRFAFSVETSATTAYLQINNLKTEDTATYFCARGEIYYGYDGGFAYWGQGTLVTV Reference Antibody 2 SA V.sub.H Chain (aa) 326 DIVLTQSPPSLAMSLGKRATISCRASESVTILGSHLIHWYQQKPGQPPTLLIQLASNVQT Reference Antibody 1 GVPARFSGSGSRTDFTLTIDPVEEDDVAVYYCLQSRTIPRTFGGGTKLEIK V.sub.L Chain (aa) 327 DVVMTQSHRFMSTSVGDRVSITCRASQDVNTAVSWYQQKPGQSPKLLIFSASYRYTGVPD Reference Antibody 2 RFTGSGSGADFTLTISSVQAEDLAVYYCQQHYSTPWTFGGGTKLDIK V.sub.L Chain (aa) 328 DIVLTQSPPSLAMSLGKRATISCRASESVTILGSHLIHWYQQKPGQPPTLLIQLASNVQT Reference 1 VL-VH GVPARFSGSGSRTDFTLTIDPVEEDDVAVYYCLQSRTIPRTFGGGTKLEIKGGGGSGGGG scFv (aa) SGGGGSQIQLVQSGPELKKPGETVKISCKASGYTFTDYSINWVKRAPGKGLKWMGWINTE TREPAYAYDFRGRFAFSLETSASTAYLQINNLKYEDTATYFCALDYSYAMDYWGQGTSVT VSS 329 QIQLVQSGPDLKKPGETVKLSCKASGYTFTNFGMNWVKQAPGKGFKWMAWINTYTGESYF Reference 2 VH-VL ADDFKGRFAFSVETSATTAYLQINNLKTEDTATYFCARGEIYYGYDGGFAYWGQGTLVTV scFv (aa) SAGGGGSGGGGSGGGGSDVVMTQSHRFMSTSVGDRVSITCRASQDVNTAVSWYQQKPGQS PKLLIFSASYRYTGVPDRFTGSGSGADFTLTISSVQAEDLAVYYCQQHYSTPWTFGGGTK LDIK 330 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCAGGGCGGTCCCTGAGACTC BCMA-1 scFv (nt) TCCTGTACAGCTTCTGGATTCACCTTTGGTGATTATGCTATGAGCTGGTTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTAGGTTTCATTAGAAGCAAAGCTTATGGTGGGACAACA GAATACGCCGCGTCTGTGAAAGGCAGATTCACCATCTCAAGAGATGATTCCAAAAGCATC GCCTATCTGCAAATGAACAGCCTGAAAACCGAGGACACAGCCGTGTATTACTGTGCGGCC TGGAGTGCCCCGACTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGGATATTGTGATGACCCAGTCT CCAGACTCCCTGTCTGTGTCTCCGGGCGAGAGGGCCACCATCAGCTGCAAGTCCAGCCAG AGTGTTTTATCCACCTCCAACAATAAGAACTATTTAGCTTGGTATCAGCAGAAACCAGGA CAGCCCCCTAGGCTGCTCCTTTACTGGGCATCTACCCGGGAGGCCGGGGTCCCTGACCGA TTCAGTGGCAGCGGGTCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGGCTGAA GATGTGGCGGTTTATTACTGTCAACAATATTTCAGTTCTCCGTACACTTTTGGCCACGGG ACCAAGCTGGAAATCAAA 331 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCAAGCCTGGAGGGTCCCTGAGACTC BCMA-2 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTCAGTGACTACTACATGAGCTGGATCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTAC GCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGGGACAACGCCAAGAACTCACTGTAT CTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGTGGAT GGCCCTCCTTCTTCTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGGAAATAGTGATGACGCAGTCT CCAGCCACCCTGTCTGTGTCTCCAGGGGAAACAGCCACCCTCTCCTGCAGGGCCAGTCAG AGTATTAAGACCAACTTGGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTC ATCTATGCTGCATCCACCAGGGCCACTGGCATCCCAGACAGATTCAGTGGCAGTGGGTCT GGGACAGACTTCACTCTCACCATCACCAGACTGGAGCCTGAAGATTTTGCAGTGTATTAC TGTCAGCAATATGGTAGCTCACCCACTTTTGGCCGGGGGACCAAGCTGGAAATCAAA 332 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCAGGGCGGTCCCTGAGACTC BCMA-3 scFv (nt) TCCTGTACAGCTTCTGGATTCACCTTTGGTGATTATGCTATGAGCTGGTTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTAGGTTTCATTAGAAGCAAAGCTTATGGTGGGACAACA GAATACGCCGCGTCTGTGAAAGGCAGATTCACCATCTCAAGAGATGATTCCAAAAGCATC GCCTATCTGCAAATGAACAGCCTGAAAACCGAGGACACAGCCGTGTATTACTGTGCGGCC TGGAGTGCCCCGACTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGGATATTGTGATGACCCAGTCT CCAGACTCCCTGGTTGTGTCTCTGGGCGAGAGGGCCACCATCAACTGCAAGTCCAGCCAG AGTGTTTTACACAGCTCCAACAATAAGAATTACTTAGCTTGGTACCAGCAGAAACCAGGA CAGCCTCCTAAGCTGCTCATTTACTGGGCATCTACCCGGGAATCCGGGGTCCCTGACCGG TTCAGTGGCAGCGGGTCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGGCTGAA GATGTGGCAGTTTATTACTGTCAGCAGTATTATACTACTCCGCTCACTTTCGGCGGAGGG ACCAAGGTGGAAATCAAA 333 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCAGGGCGGTCCCTGAGACTC BCMA-4 scFv (nt) TCCTGTACAGCTTCTGGATTCACCTTTGGTGATTATGCTATGAGCTGGTTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTAGGTTTCATTAGAAGCAAAGCTTATGGTGGGACAACA GAATACGCCGCGTCTGTGAAAGGCAGATTCACCATCTCAAGAGATGATTCCAAAAGCATC GCCTATCTGCAAATGAACAGCCTGAAAACCGAGGACACAGCCGTGTATTACTGTGCGGCC TGGAGTGCCCCGACTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGGCCATCCGGATGACCCAGTCT CCATCCTCCCTGTCCGCGTCTCTGGGGGACAGAGTCACCATCACTTGCCGGGCGAGTCAG GACATTAGGAATTCTTTGGCCTGGTATCAGCAGAGGCCAGGGAAAGCCCCTAAACTCCTG CTTTCTGCTGCATCCAGATTGGAAAGTGGGGTCCCTTCTAGGTTCAGTGGCACTACTTCT GGGGCGGAGTATGCTCTCAGCATCAGCAGCCTGCAGCCTGAAGATGTCGCATCTTATTTC TGTCAGCAGTATTATAGTCTCCCTCTCTCCTTCGGCGGAGGGACCAAGGTGGAAATCAAA 334 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCAGGGCGGTCCCTGAGACTC BCMA-5 scFv (nt) TCCTGTACAGCTTCTGGATTCACCTTTGGTGATTATGCTATGAGCTGGTTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTAGGTTTCATTAGAAGCAAAGCTTATGGTGGGACAACA GAATACGCCGCGTCTGTGAAAGGCAGATTCACCATCTCAAGAGATGATTCCAAAAGCATC GCCTATCTGCAAATGAACAGCCTGAAAACCGAGGACACAGCCGTGTATTACTGTGCGGCC TGGAGTGCCCCGACTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGGACATCGTGATGACCCAGTCT CCAGACTCCCTGGCTGTGTCTCTGGGCGAGAGGGCCACCATCAACTGCAAGTCCAGCCAG AGTGTTTTATACAGCTCCAACAATAAGAACTACTTAGCTTGGTACCAGCAGAAACCAGGA CAGCCTCCTAAGCTGCTCATTTACTGGGCATCTACCCGGGAATCCGGGGTCCCTGACCGA TTCAGTGGCAGCGGGTCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGGCTGAA GATGTGGCAGTTTATTACTGTCAGCAATATTATAGTACTCCGTGGACGTTCGGCCAAGGG ACCAAGGTGGATATCAAA 335 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCAGGGCGGTCCCTGAGACTC BCMA-6 scFv (nt) TCCTGTACAGCTTCTGGATTCACCTTTGGTGATTATGCTATGAGCTGGTTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTAGGTTTCATTAGAAGCAAAGCTTATGGTGGGACAACA GAATACGCCGCGTCTGTGAAAGGCAGATTCACCATCTCAAGAGATGATTCCAAAAGCATC GCCTATCTGCAAATGAACAGCCTGAAAACCGAGGACACAGCCGTGTATTACTGTGCGGCC TGGAGTGCCCCGACTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGGATATTGTGATGACCCAGTCT CCATCGTCCCTGTCTGTGTCTGTAGGAGAGAGAGTCACCATCACTTGTCGGGCGAGTCAG TCTATAAGTAATTCCTTAGCCTGGTATAAACAGAGACCGGGAGAAGCCCCTAAACTCCTG ATACATGCTGCATCCAATGTGGAAGATGGGGTCCCTTCGAGGTTCAGCGGCAGGGGATCT GGGACAGTTTTCACTCTCGCCATCAGCAATGTACAGCCTGAAGATTTCGCAACTTACTAC TGTCAGCAGAGTCACATGTACCCTCCGACTTTCGGCGGGGGGACCAAGGTGGAAATCAAA 336 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCAGGGCGGTCCCTGAGACTC BCMA-7 scFv (nt) TCCTGTACAGCTTCTGGATTCACCTTTGGTGATTATGCTATGAGCTGGTTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTAGGTTTCATTAGAAGCAAAGCTTATGGTGGGACAACA GAATACGCCGCGTCTGTGAAAGGCAGATTCACCATCTCAAGAGATGATTCCAAAAGCATC GCCTATCTGCAAATGAACAGCCTGAAAACCGAGGACACAGCCGTGTATTACTGTGCGGCC TGGAGTGCCCCGACTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGGTCATCCAGTTGACCCAGTCT CCCTCCTCACTGTCTGCATCTGTAGGGGACAGAGTCACCATCACTTGTCGGGCGAGTCAG GACATTGGCGATTATTTAGCCTGGTTTCAGCAGAGACCAGGGAAAGCCCCTAAGTCCCTG ATCTATGTTGCGTCCACTTTGCAGAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCT GGGACACACTTCACTCTCACCATCAACAGCCTGCAGCCTGAAGATTTTGCAACTTATTAC TGCCAACAGTATCATAGTCACCCGTGGACGTTCGGCCCAGGGACCAAGGTGGATATCAAA 337 CAGGTCCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCAGGGCGGTCCCTGAGACTC BCMA-8 scFv (nt) TCCTGTACAGCTTCTGGATTCACCTTTGGTGATTATGCTATGAGCTGGTTCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTAGGTTTCATTAGAAGCAAAGCTTATGGTGGGACAACA GAATACGCCGCGTCTGTGAAAGGCAGATTCACCATCTCAAGAGATGATTCCAAAAGCATC GCCTATCTGCAAATGAACAGCCTGAAAACCGAGGACACAGCCGTGTATTACTGTGCGGCC TGGAGTGCCCCGACTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGGATATTGTGATGACCCAGTCT CCAGACTCCCTGGCTGTGTCTCTGGGCGAGAGGGCCACCATCAACTGCAAGTCCAGCCAG AGTGTTTTATACAGCTCCAACAATAAGAACTACTTAGCTTGGTACCAGCAGAAACCAGGA CAGCCTCCTAAGCTGCTCATTTACTGGGCATCTACCCGGGAATCCGGGGTCCCTGACCGA TTCAGTGGCAGCGGGTCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGGCTGAA GATGTGGCAGTTTATTACTGTCAGCAATATTATAGTACTCCGTACACTTTTGGCCAGGGG ACCAAGCTGGAAATCAAA 338 GAAGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTCAAGCCTGGAGGGTCCCTGAGACTC BCMA-9 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTCAGTGACTACTACATGAGCTGGATCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTAC GCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGGGACAACGCCAAGAACTCACTGTAT CTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAGAGTGGAC GGTGACTACGTCGATGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGTCCTATGAGCTGACTCAGCCG CCCTCGGTGTCTGTGGCCCCAGGACAGACGGCCAGGGTTACCTGTGGGGCAAATAATATT GGAAGCAAAAGTGTCCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCCATGCTGGTCGTC TATGATGATGACGACCGGCCCTCCGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGG AACACGGCCACCCTGACCATCAGCGGGGTCGAGGCCGGGGATGAGGCCGACTACTTCTGT CACGTGTGGGATAGAAGTCGTGATCATTATGTCTTCGGAACTGGGACCAAGCTGACCGTC CTA 339 GAAGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTCAAGCCTGGAGGGTCCCTGAGACTC BCMA-10 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTCAGTGACTACTACATGAGCTGGATCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTAC GCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGGGACAACGCCAAGAACTCACTGTAT CTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAGAGTGGAC GGTGACTACGTCGATGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGTCCTATGAGCTGACTCAGCCG CCCTCGGTGTCTGTGGCCCCAGGACAGACGGCCAGGGTTACCTGTGGGGCAAATAATATT GGAAGCAAAAGTGTCCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCCATGCTGGTCGTC TATGATGATGACGACCGGCCCTCCGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGG AACACGGCCACCCTGACCATCAGCGGGGTCGAGGCCGGGGATGAGGCCGACTACTTCTGT CACGTGTGGGATAGAAGTCGTGATCATTATGTCTTCGGAACTGGGACCAAGCTGACCGTC CTA 340 CAGGTGCAGCTGGTACAGTCTGGGGGAGGCTTGGTACAGCCTGGCAGGTCCCTGAGACTC BCMA-11 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCGAGCT CCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTAGCATAGGCTAT GCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTAT CTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCGTGTATTACTGTGCGAGAGATCTG GGGCCCGACTACGATCCCGATGCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTT TCCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGCTTGTG CTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCT GGAAGCAGCTCCAACATCGGAAGTAATGCTGTAAACTGGTACCAGCAGCTCCCAGGAACG GCCCCCGAAGTCCTCATCTATAATAGTCATCAGCGGCCCTCAGGGGTCCCTGACCGATTC TCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAATGGGCTCCAGTCTGAGGAC GAGGCTGATTATTACTGTGCAGCATGGGATGACAGCCTGAGAGGTTACGTCTTCGGAACT GGGACCAAGCTCACCGTCCTA 341 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCAAGCCTGGAGGGTCCCTGAGACTC BCMA-12 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTCAGTGACTACTACATGAGCTGGATCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTAC GCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGGGACAACGCCAAGAACTCACTGTAT CTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGTGGAT GGCCCTCCTTCTTTTGATATCTGGGGCCAAGGGACAATGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGTCTGCCCTGACGCAGCCG CCCTCAGTGTCTGCGGCCCCAGGACAGAAGGTCACCATCTCCTGCTCTGGAAGCCGCTCC AACATTGGGAATAATTATGTATCCTGGTACCAACAGCTCCCAGGAACAGCCCCCAAACTC CTCATTTATGACAATGCTAAGCGACCCTCAGGAATTCCTGACCGATTCTCTGGCTCCAAG TCTGGCACGTCAGCCACCCTGGACATCGCCGGACTCCAGACTGGGGATGAGGCCGACTAT TACTGTCAGGTGTGGGATAGTAGTAGTGATCATTGGGTATTCGGCGGAGGGACCAAGCTC ACCGTCCTA 342 CAGATGCAGCTGGTGCAGTATGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTC BCMA-13 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTATGCTATGCACTGGGTCCGCCAGGCT CCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATCATATGATGGAAGTAATAAATACTAC GCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTAT CTGCAAATGAACAGCCTGAAAGCTGAGGACACGGCTGTGTATTACTGTGCTACCCTACCC GGTAGAGATGGCTACCCCGGAGCCTTTGACTACAGGGGCCAGGGAACCCTGGTCACCGTC TCCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGGCTGTG CTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCT GGAAGCGGCTCCAACATCGGAAGTAATGATGTCTCCTGGTATCAGCAGATCCCAGGAACG GCCCCCAAACTCCTCATCTACTGGAATGATCAGCGGCCCTCAGGGGTCCCTGACCGATTC TCTGCCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGAT GAGGCTGATTATTACTGTGCAGCATGGGATGACAGCCTGGGTGGTTCTTGGGTGTTCGGC GGAGGGACCAAGGTCACCGTCCTA 343 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTC BCMA-14 scFv (nt) TCCTGTGCAGCGTCTGGATTCACCTTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCT CCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATCATATGATGGAAGTAATAAATACTAC GCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTAT CTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCTACCCTACCC GGTAGAGATGGCTACCCCGGAGCCTTTGACTACAGGGGCCCGGGAACCCTGGTCACCGTC TCCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGGCTGTG CTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCT GGAAGCGGCTCCAACATCGGAAGTAATGATGTCTCCTGGTATCAGCAGATCCCAGGAACG GCCCCCAAACTCCTCATCTACTGGAATGATCAGCGGCCCTCAGGGGTCCCTGACCGATTC TCTGGCTCCAAGTCTGGCGCCTCAGCCTCTCTGGCCATCAGTGGGCTCCAGTCTGAGGAT GAGGCTGATTATTATTGTGCAGCATGGGATGACAGGTTGAACGGTTTTTGGGTGTTCGGC GGAGGGACCAAGCTCACCGTCCTA 344 CAGGTGCAGCTGTTGGAGTCTGGGGGAGGCCTGGTCAAGCCTGGGGGGTCCCTGAGACTC BCMA-15 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCT CCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATCATATGATGGAAGTAATAAATACTAT GCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTAT CTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAAAGATCAG TATAGCAGTAGCGCACAAAGGGCCGACTTTGACTACTGGGGCCAGGGAACCCTGGTCACC GTCTCCTCAGGTGGAGGCGGTTCAGGCGGAGGTGGTTCTGGCGGTGGCGGATCGCAGTCT GTGCTGACGCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGT TCTGGAAGCGGCTCCAACATCGGAAGTAATGATGTCTCCTGGTATCAGCAGATCCCAGGA ACGGCCCCCAAACTCCTCATCTACTGGAATGATCAGCGGCCCTCAGGGGTCCCTGACCGG TTCTCAGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGTCATCAGTGGGCTCCGGTCCGAG GATGAGGCTGATTATTACTGTGCAGCATGGGATGACAGCCTGAGTGGTTGGGTGTTCGGC GGAGGGACCAAGCTGACCGTCCTA 345 GAGGTCCAGCTGGTACAGTCTGGGCCTGAGGTGAAGAAGCCTGGGACCTCAGTGAAGGTC BCMA-16 scFv (nt) TCCTGCAAGGCTTCTGGATTCACCTTTACTAGCTCTGCTATGCAGTGGGTGCGACAGGCT CGTGGACAACGCCTTGAGTGGATAGGATGGATCGTCGTTGGCAGTGGTAACACAAACTAC GCACAGAAGTTCCAGGAAAGAGTCACCATTACCAGGGACATGTCCACAAGCACAGCCTAC ATGGAGCTGAGCAGCCTGAGATCCGAGGACACGGCCGTGTATTACTGTGCGGCAGCTCCG TATTACGATATTTTGACTGGTTATTATTTATGGGGCCAGGGAACGCTGGTCACCGTCTCC TCAGGTGGAGGCGGTTCTGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGTCTGCCCTG ACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGA AGCGGCTCCAACATCGGAAGTAATGATGTCTCCTGGTATCAGCAGATCCCAGGAACGGCC CCCAAACTCCTCATCTACTGGAATGATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCT GGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAG GCTGATTATTACTGTGCATCATGGGATGACAGCCTGAGTGGTTGGGTGTTCGGCGGAGGG ACCAAGCTGACCGTCCTA 346 CAGGTTCAGCTGGTGCAGTCTGGGGGAGGCTTGGTCAAGCCTGGAGGGTCCCTGAGACTC BCMA-17 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTCAGTGACTACTACATGAGCTGGATCCGCCTGGCT CCAGGGAAGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTAC GCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGGGACAACGCCAAGAACTCACTGTAT CTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAGAGAGGCC GATAGTAGCGCTGACTACTGGGGCCAGGGAACCCTGGTCAACGTCTCCTCAGGTGGAGGC GGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGCCTGTGCTGACTCAGCCACCC TCGGTGTCAGTGGCCCCAGGAAAGACGGCCATGATTACCTGTGGGGGAAACAACATTGGA TTTAAAGGTGTGCAGTGGTACCAGCAGAAGACAGGCCAGGCCCCTGTGCTGGTCGTCTAT GATGATAGCGACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAAC ACGGCCACCCTGACCATCAGCAGGGTCGAAGCCGGGGATGAGGCCGATTATTACTGTCAG GTGTGGGATAGTGCTAGTGATCATTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTA 347 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCTGAGACTC BCMA-18 scFv (nt) TCCTGTGCAGCCTCTGGATTCACGTTTAGTAGCTATTGGATGAGCTGGCACCGCCAGGCT CCAGGGAAGGGGCCGGAGTGGGTGGCCCACATAAACCAAGACGGAAGTGAGAAGTACTAT GTGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCGAGAGTTCACTGTAT CTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGGTGGCTG GCGGTTACTAACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGAGGCGGTTCA GGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGTCTGTGTTGACTCAGCCACCCTCAGCG TCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCGGCTCCAACATCGGA AGTAATGATGTCTCCTGGTATCAGCAGATCCCAGGGACGGCCCCCAAACTCCTCATCTAC TGGAATGATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACC TCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGCA GCATGGGATGACAGCCTGAATGGTTGGGTGTTCGGCGGAGGGACCAAGCTGACCGTCCTA 348 CAGGTCCAGCTGGTACAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTC BCMA-19 scFv (nt) TCCTGCAAGGCTTCTGGATACACCTTCACCAGCTACTATATGCACTGGGTGCGACAGGCC CCTGGACAAGGGCTTGAGTGGATGGGATGGATCAACCCTAACAGTGGTGGCACAAACTAT GCACAGAAGTTTCAGGGCAGGGTCACCATGACCAGGGACACGTCCATCAGCACAGCCTAC ATGGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGATGGT GGGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGTGGAGGCGGTTCAGGC GGAGGTGGCTCTGGCGGTGGCGGATCGCAGGCTGTGCTGACTCAGCCTGCCTCCGTGTCT GGGTCTCCTGGACAGTCGATCACCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTGAT TATAACTATGTCGCCTGGTATCAACAACACCCAGGCAAAGACCCCAAACTCATGATTTTT GAGGTCATTAATCGGCCCTCAGGGGTTTCTGATCGCTTCTCTGGCTCCAAGTCTGGCAAC ACGGCCTCCCTGGACATCTCTGGGCTCCAGCCTGAGGACGAGGCTGATTATTACTGCATC TCATATTCACGAGGCAGCACTCCTTATGTCATCGGAACTGGGACCAAGGTGACCGTCCTA 349 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAGGTCCCTGAGACTC BCMA-20 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCT CCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTAGCATAGGCTAT GCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTAT CTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTTGTATTACTGTGCAAAGGGGGGC CTAGGAATAACCCCATACTACTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCC TCAGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGCCTGTGCTG ACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCGGGA GGCAAGACTGTAAACTGGTTCCGGCAGGTCCCAGGAACGGCCCCCCAACTCCTCATCTAT AGTAATGATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCTCC TCAGCCTCCCTGGACATCAGTGGGCTCCAGTCTGAGGATGAGGCTTATTATTACTGTGGA TCATGGGATGACAGCCTCAATGCTTGGGTGTTCGGCGGAGAGACCAAGCTGACCGTCCTA 350 GAAGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCAAGCCTGGAGGGTCCCTGAAACTC BCMA-21 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTCAGTGACTACTACATGAGCTGGATCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTAC GCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGGGACAACGCCAAGAACTCACTGTAT CTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGTAGAC GGAGGCTACACAGAGGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGTCTGTGCTGACTCAGCCA CCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGAAGCGGCTCC AACATCGGAAGTAATGATGTCTCCTGGTATCAGCAGATCCCAGGAACGGCCCCCAAACTC CTCATCTACTGGAATGATCAGCGGCCCTCAGGGGTCCCTGACCGGTTCTCAGGCTCCAAG TCTGGCATCTCAGCCTCCCTGGCCATCAGCGGGCTCCGGTCCGAGGATGAGGCTGATTAT TACTGTGCAGCATGGGATGACAGCCTGAATGGTTATGTCTTCGGAACTGGGACCAAGGTC ACCGTCCTA 351 GAAGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCAAGCCTGGAGGGTCCCTGAGACTC BCMA-22 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTCAGTGACTACTACATGAGCTGGATCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTAC GCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGGGACAACGCCAAGAACTCACTGTAT CTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGTAGAC GGAGACTACACAGAGGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGTCTGCCCTGACTCAGCCT GCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACTATCTCCTGCACTGGAAGCAGCAGT GATGTTGGCAAATATAATCTTGTCTCCTGGTACCAACAGCCCCCAGGCAAAGCCCCCAAG CTCATAATTTATGACGTCAATAAGCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGGCTCC AAGTCTGGCAACACGGCCACCCTGACAATCTCTGGGCTCCAGGGTGACGACGAGGCTGAT TATTATTGTTGCTCATATGGAGGTAGTAGGTCTTATGTCTTCGGAACTGGGACCAAGGTG ACCGTCCTA 352 GAAGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCAAGCCTGGAGGGTCCCTGAGACTC BCMA-23 scFv (nt) TCCTGTGCAGCCTCTGGATTCACCTTCAGTGACTACTACATGAGCTGGATCCGCCAGGCT CCAGGGAAGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTAC GCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGGGACAACGCCAAGAACTCACTGTAT CTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGTAGAC GGAGACTACACAGAGGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGTCTGCCCTGACTCAGCCT GCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACTATCTCCTGCACTGGAAGCAGCAGT GATGTTGGCAAATATAATCTTGTCTCCTGGTACCAACAGCCCCCAGGCAAAGCCCCCAAG CTCATAATTTATGACGTCAATAAGCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGGCTCC AAGTCTGGCAACACGGCCACCCTGACAATCTCTGGGCTCCAGGGTGACGACGAGGCTGAT TATTATTGTAGCTCATATGGAGGTAGTAGGTCTTATGTCTTCGGAACTGGGACCAAGGTG ACCGTCCTA 353 X.sub.1X.sub.2X.sub.3MX.sub.4 Consensus CDR-H1 x.sub.1 = D or S; X.sub.2 = Y or S; X.sub.3 = A, G, W, or Y; X.sub.4 = H, Q, or S 354 X.sub.1IX.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11YX.sub.12X.sub.13X.sub.14X.sub.15X.sub.16X.sub.17 Consensus CDR-H2 X.sub.1 = F, G, H, V, W or Y; X.sub.2 = N, R, S or V; X.sub.3 = P, Q, S, V, W or Y; X.sub.4 = K or null; X.sub.5 = A or null; X.sub.6 = D, G, N, S, or Y; X.sub.7 = G or S; x.sub.8 = G or S; X.sub.9 = E, G, N, T or S; X.sub.10 = I, K, or T; X.sub.11 = E, G, N or Y; X.sub.12 = A or V; X.sub.13 = A, D or Q; X.sub.14 = K or S; X.sub.15 = F or V; X.sub.16 = K or Q; X.sub.17 = E or G 355 X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13X.sub.14 Consensus CDR-H3 X.sub.1 = A, D, E, G, L, V or W; X.sub.2 = A, D, G, L, P, Q or S; X.sub.3 = A, D, G, L or Y; X.sub.4 = D, G, P, R, S, V, Y or null; X.sub.5 = D, I, P, S, T, Y or null; X.sub.6 = A, G, I, S, T, V, Y or null; X.sub.7 = A, D, E, F, L, P, S, Y or null; X.sub.8 = P, Q, T, Y or null; X.sub.9 = D, G, R, Y or null; X.sub.10 = A, F, Y or null; X.sub.11 = D, F or null; X.sub.12 = F or null; X.sub.13 = D, T or Y; X.sub.14 = I, L, N, V or Y 356 X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13X.sub.14X.sub.15X.sub.16X.sub.17 Consensus CDR-L1 X.sub.1 = G, K, R, S or T; X.sub.2 = A, G or S; X.sub.3 = G, N, S or T; X.sub.4 = G, K, N, Q, R or S; X.sub.5 = S or null; X.sub.6 = D, N, V or null; X.sub.7 = L, V or null; x.sub.8 = H, S, Y or null; X.sub.9 = S, T or null; X.sub.10 = S or null; X.sub.11 = D, G, I, N, S or null; X.sub.12 = D, E, G, K, I, N or null; X.sub.13 = F, G, K, N, R, S, Y or null; X.sub.14 = D, K, N, T or null; X.sub.15 = A, D, G, L, N, S, T or Y; X.sub.16 = L or V; X.sub.17 = A, H, N, Q or S 357 X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7 Consensus CDR-L2 X.sub.1 = A, D, E, N, S, V or W; X.sub.2 = A, D, N, S or V; X.sub.3 = A, D, H, I, N or S; X.sub.4 = D, K, N, Q, R or T; X.sub.5 = L, R or V; X.sub.6 = A, E, P or Q; X.sub.7 = A, D, S or T 358 X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12 Consensus CDR-L3 X.sub.1 = A, C, G, H, I, Q or S; X.sub.2 = A, Q, S or V; X.sub.3 = S, W or Y; X.sub.4 = D, F, G, H or Y; X.sub.5 = D, G, M, R, S or T; X.sub.6 = A, G, H, L, R, S, T or Y; X.sub.7 = L, P, R, S or null; X.sub.8 = D, G, N, R, S, T or null; X.sub.9 = A, G, H, L, P or null; X.sub.10 = F, S or null; X.sub.11 = L, P, W or Y; X.sub.12 = S, T or V 359 GGGGS 4GS linker (aa) 360 GGGS 3GS linker (aa) 361 GGGGSGGGGSGGGGS (4GS).sub.3 linker (aa) 362 GSTSGSGKPGSGEGSTKG Linker (aa) 363 ESKYGPPCPPCP Spacer (IgG4hinge) (aa) 364 gaatctaagtacggaccgccctgccccccttgccct Spacer (IgG4hinge) (nt) 365 ESKYGPPCPPCPGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE Hinge-CH3 spacer (aa) NNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 366 ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY Hinge-CH2-CH3 spacer VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISK (aa) AKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 367 MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL Human BCMA; GLSLIISLAVFVLMFLLRKISSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE GenBank No. YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS BAB60895.1 ISAR 368 MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL Human BCMA; NCBI GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE No. NP_001183.2 YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS ISAR 369 MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNARSGLLGMANIDLEKSRT Human BCMA Variant; GDEIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLP GenBank No. AALSATEIEKSISAR ABN42510.1 370 MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTVLWIFLGLTLV Mouse BCMA; NCBI LSLALFTISFLLRKMNPEALKDEPQSPGQLDGSAQLDKADTELTRIRAGDDRIFPRSLEY No. NP_035738.1 TVEECTCEDCVKSKPKGDSDHFFPLPAMEEGATILVTTKTGDYGKSSVPTALQSVMGMEK PTHTR 371 MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNAILWTCLG Cynomolgus BCMA; LSLIISLAVFVLTFLLRKMSSEPLKDEFKNTGSGLLGMANIDLEKGRTGDEIVLPRGLEY GenBank No. TVEECTCEDCIKNKPKVDSDHCFPLPAMEEGATILVTTKTNDYCNSLSAALSVTEIEKSI EHH60172.1 SAR 372 GISWNSGSIXYADSVKG BCMA-28 CDR-H2 (aa) Kabat numbering 373 YISGSGSTIYYADSVKG BCMA-33 CDR-H2 (aa) Kabat numbering 374 YISSSGNTIYYADSVKG BCMA-41 CDR-H2 Kabat numbering 375 CIPCQLR human BCMA epitope (residues 21-27) 376 DLGPPYGDDAFDI BCMA-24, -28, -29, -39 CDR-H3 (aa) 377 DLDPDDAFDI BCMA-30 CDR-H3 (aa) 378 VDGDYDDY BCMA-35 CDR-H3 (aa) 379 SNTPPLTCQR human BCMA epitope (residues 30-39) 380 RASQGISNYLA BCMA-25 CDR-L1 (aa) 381 RSSQSLLHSNGYNYLD BCMA-28 CDR-L1 (aa) 382 TGTSSDVGSYNLVS BCMA-29 CDR-L1 (aa) 383 RASQPIRSNLA BCMA-30 CDR-L1 (aa) 384 KSSQSVLNSSNNKNYVA BCMA-31 CDR-L1 (aa) 385 GGNNIGSKGVH BCMA-32 CDR-L1 (aa) 386 RASQSISNYLA BCMA-34 CDR-L1 (aa) 387 GSSTGPVTSAHSPS BCMA-36 CDR-L1 (aa) 388 GSSTGAVTNGHSPY BCMA-37, -38 CDR-L1 (aa) 389 RASQGIRYELX BCMA-39 CDR-L1 (aa) 390 TGSSSDVSKYNLVS BCMA-40 CDR-L1 (aa) 391 SGSSSNIGGNSVD BCMA-41 CDR-L1 (aa) 392 RASQGIGNGLA BCMA-42 CDR-L1 (aa) 393 SVTNSVK human BCMA epitope (residues 44-50) 394 KSSQNLLYSSNNKNYLA BCMA-44 CDR-L1 (aa) 395 RASQGIGRSLA BCMA-45 CDR-L1 (aa) 396 GGNNIGSKSVH BCMA-47, -48 CDR-L1 (aa) 397 GGDQIGRKSVH BCMA-49 CDR-L1 (aa) 398 RASQNIGDWLA BCMA-51 CDR-L1 (aa) 399 WGSTRES BCMA-24 CDR-L2 (aa) 400 SASTLQS BCMA-25 CDR-L2 (aa) 401 LGSNRAS BCMA-28 CDR-L2 (aa) 402 EVSKRPS BCMA-29 CDR-L2 (aa) 403 SASTRAT BCMA-30 CDR-L2 (aa) 404 DASNRAT BCMA-34 CDR-L2 (aa) 405 ETTNRRS BCMA-36 CDR-L2 (aa) 406 DTTNRHS BCMA-37 CDR-L2 (aa) 407 DTNNRHS BCMA-38 CDR-L2 (aa) 408 AASTLQS BCMA-39 CDR-L2 (aa) 409 ANDRRPS BCMA-41 CDR-L2 (aa) 410 CSQNEYF human BCMA epitope (residues 8-14) 411 DASSLRS BCMA-45 CDR-L2 (aa) 412 YDTDRPS BCMA-47, -48 CDR-L2 (aa) 413 YDSDRPS BCMA-49 CDR-L2 (aa) 414 GASILES BCMA-51 CDR-L2 (aa) 415 QQYISLPWT BCMA-24 CDR-L3 (aa) 416 QQSYTSRQT BCMA-25 CDR-L3 (aa) 417 MQALQTPPWT BCMA-28 CDR-L3 (aa) 418 CSYAGSSTSRDV BCMA-29 CDR-L3 (aa) 419 RHYAPLT BCMA-30 CDR-L3 (aa) 420 QQRSNWPPYT BCMA-34 CDR-L3 (aa) 421 HLWDRSRDHYV BCMA-26, -35 CDR-L3 (aa) 422 LLSSGDARMV BCMA-36 CDR-L3 (aa) 423 SLSHAGDRVF BCMA-37 CDR-L3 (aa) 424 LLSYSDARLA BCMA-38 CDR-L3 (aa) 425 LQHNSYPLT BCMA-39 CDR-L3 (aa) 426 ESWDDALNGHV BCMA-41 CDR-L3 (aa) 427 QQYVEDALT BCMA-42 CDR-L3 (aa) 428 LLHACIPCQLR human BCMA epitope (residues 17-27) 429 QQYYSSPYT BCMA-44 CDR-L3 (aa) 430 QQLNSYPWT BCMA-45 CDR-L3 (aa) 431 QLWDSDSDDFA BCMA-47 CDR-L3 (aa) 432 QVWDSSTGQYW BCMA-49 CDR-L3 (aa) 433 QKYDGAPPWT BCMA-51 CDR-L3 (aa) 434 EVQLLESGGGLVQPGRSLRLSCVASGFTFD BCMA-27 VH FR1 (aa) 435 QVQLVQSGGGLVQPGRSLRLSCAASGFTFG BCMA-30 VH FR1 (aa) 436 EVQLVQSGGGLVQPGRSLRLSCTASGFTFG BCMA-25, -31, -44, -51 VH FR1 (aa) 437 QVQLVESGGGLVKPGGSLRLSCAASGFTFS BCMA-32, -49 VH FR1 (aa) 438 TGQLVQSGGGLVQPGRSLRLSCAASGFTFD BCMA-34 VH FR1 (aa) 439 EVQLLESGGGLVQPGRSLRLSCTASGFTFG BCMA-42 VH FR1 (aa) 440 tcctatgagctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatg BCMA-52 scFv (nt) tcttgttctggaaccagctccaacatcggaagtcactctgtaaactggtaccagcagctc ccaggaacggcccccaaactcctcatctatactaataatcagcggccctcaggggtccct gaccgattctctggctccaagtctggcacctcagcctccctggccatcagtggcctccag tctgaggatgaggctgattattactgtgcagcatgggatggcagcctgaatggtctggta ttcggcggagggaccaagctgaccgtcctaggttctagaggtggtggtggtagcggcggc ggcggctctggtggtggtggatccctcgagatggccgaggtgcagctggtgcagtctgga gcagaggtgaaaaagcccggggagtctctgaagatctcctgtaagggttctggatacagc tttaccagctactggatcggctgggtgcgccagatgcccgggaaaggcctggagtggatg gggatcatctatcctggtgactctgataccagatacagcccgtccttccaaggccacgtc accatctcagctgacaagtccatcagcactgcctacctgcagtggagcagcctgaaggcc tcggacaccgccatgtattactgtgcgcgctactctggttctttcgataactggggtcaa ggtactctggtgaccgtctcctcagc 441 RFTISRDNAKSSLYLQMNSLRAEDTAVYYCAR BCMA-37 VH FR3 (aa) 442 SYELTQPPSASGTPGQRVTMSCSGTSSNIGSHSVNWYQQLPGTAPKLLIYTNNQRPSGVP BCMA-52 scFv (aa) DRFSGSKSGTSASLAISGLQSEDEADYYCAAWDGSLNGLVFGGGTKLTVLGSRGGGGSGG GGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWM GIIYPGDSDTRYSPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCARYSGSFDNWGQ GTLVTVSS 443 DSPSPGTTPKNSLYLQMNSLRAEDTAVYYCAK BCMA-47 VH FR3 (aa) 444 GGQGTMVTVSS BCMA-28 VH FR4 (aa) 445 WRQGTMVTVSS BCMA-47 VH FR4 (aa) 446 DIQMTQSPAFLSASVGDRVTVTC BCMA-25 VL FR1 (aa) 447 DIVMTQSPLSLSVTPGEPASISC BCMA-28 VL FR1 (aa) 448 QPVLTQPASVSGSPGQSITISC BCMA-29 VL FR1 (aa) 449 EIVLTQSPATLSVSPGERATLSC BCMA-30 VL FR1 (aa) 450 DVVMTQSPDSLAVSLGERATISC BCMA-31 VL FR1 (aa) 451 QTVVTQPPSVSVAPGQTARITC BCMA-32 VL FR1 (aa) 452 EIVMTQSPATLSLSPGDRATLSC BCMA-34 VL FR1 (aa) 453 NFMLTQPPSVSVAPGQTARITC BCMA-35 VL FR1 (aa) 454 QSVLTQEPSLTVSPGETVTLTC BCMA-36 VL FR1 (aa) 455 QLVLTQEPSLTVSPGGTVTLTC BCMA-37 VL FR1 (aa) 456 QAVLTQEPSLTVSPGGTVTLTC BCMA-38 VL FR1 (aa) 457 DIQXTQSPSSLSASVGDRVTITC BCMA-39 VL FR1 (aa) 458 QPVLTQPPSVSGTPGQRVTIPC BCMA-41 VL FR1 (aa) 459 DIQMTQSPSLVSASVGDRVTITC BCMA-42 VL FR1 (aa) 460 cagtctgccctgacacagcctgccagcgttagtgctagtcccggacagtctatcgccatc BCMA-55 scFv (nt) agctgtaccggcaccagctctgacgttggctggtatcagcagcaccctggcaaggcccct aagctgatgatctacgaggacagcaagaggcccagcggcgtgtccaatagattcagcggc agcaagagcggcaacaccgccagcctgacaattagcggactgcaggccgaggacgaggcc gattactactgcagcagcaacacccggtccagcacactggtttttggcggaggcaccaag ctgacagtgctgggatctagaggtggcggaggatctggcggcggaggaagcggaggcggc ggatctcttgaaatggctgaagtgcagctggtgcagtctggcgccgagatgaagaaacct ggcgcctctctgaagctgagctgcaaggccagcggctacaccttcatcgactactacgtg tactggatgcggcaggcccctggacagggactcgaatctatgggctggatcaaccccaat agcggcggcaccaattacgcccagaaattccagggcagagtgaccatgaccagagacacc agcatcagcaccgcctacatggaactgagccggctgagatccgacgacaccgccatgtac tactgcgccagatctcagcgcgacggctacatggattattggggccagggaaccctggtc accgtgtccagc 461 DVVMTQSPDSLAVSLGERATINC BCMA-44 VL FR1 (aa) 462 AIRMTQSPSSLSASVGDRVTITC BCMA-45 VL FR1 (aa) 463 QAVLTQPPSVSVAPGKTATITC BCMA-47 VL FR1 (aa) 464 QPVLTQPPSVSVAPGKTATITC BCMA-48 VL FR1 (aa) 465 LPVLTQPPSVSVAPGKTARITC BCMA-49 VL FR1 (aa) 466 AIQLTQSPSTLSASVGDRVAITC BCMA-51 VL FR1 (aa) 467 WYQQKPGNAPRLLIY BCMA-25 VL FR2 (aa) 468 WYLQKPGQSPQLLIY BCMA-28 VL FR2 (aa) 469 WYQQHPGKAPKLMIY BCMA-29 VL FR2 (aa) 470 WYQQKPGQAPKLLIY BCMA-30 VL FR2 (aa) 471 WYKQKPGQPPKLVIS BCMA-31 VL FR2 (aa) 472 WYRQRPGQAPEVVIY BCMA-32 VL FR2 (aa) 473 WFQKKPGQAPTTLIY BCMA-36 VL FR2 (aa) 474 WFQQKPGQAPRTLIY BCMA-37, -38 VL FR2 (aa) 475 WYQQKPGKAPKLLIY BCMA-39 VL FR2 (aa) 476 WFQEVPGTAPKLLIY BCMA-41 VL FR2 (aa) 477 WYQQKPGKAPKLLLF BCMA-42 VL FR2 (aa) 478 QSALTQPASVSASPGQSIAISCTGTSSDVGWYQQHPGKAPKLMIYEDSKRPSGVSNRFSG BCMA-55 scFv (aa) SKSGNTASLTISGLQAEDEADYYCSSNTRSSTLVFGGGTKLTVLGSRGGGGSGGGGSGGG GSLEMAEVQLVQSGAEMKKPGASLKLSCKASGYTFIDYYVYWMRQAPGQGLESMGWINPN SGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAMYYCARSQRDGYMDYWGQGTLV TVSS 479 WYKQKPGGVPQLLIH BCMA-45 VL FR2 (aa) CMA-47, -48 VL FR2 480 WYQRKPGQGPVVVIQ BCMA-47, -48 VL-FR2 (aa) 481 WYQQKPGQAPVLVMS BCMA-49 VL FR2 (aa) 482 WYQQKPGKAPKLLIF BCMA-51 VL FR2 (aa) 483 GVPDRFSGSGSGTDFTLTISSLQAEDVAIYHC BCMA-24 VL FR3 (aa) 484 GVPSRFRGTGYGTEFSLTIDSLQPEDFATYYC BCMA-25 VL FR3 (aa) 485 GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC BCMA-28 VL FR3 (aa) 486 GVSNRFSGSKSGNTASPTISGLQAEDEADYYC BCMA-29 VL FR3 (aa) 487 GIPDRFSGSGSGTDFTLTISRLEHEDFAVYYR BCMA-30 VL FR3 (aa) 488 GVPDRFSGSNSGNTATLTVRGVEAGDEADYYC BCMA-32 VL FR3 (aa) 489 GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC BCMA-34 VL FR3 (aa) 490 WTPARFSGSLLGGKAALTLSGAQPEDEADYYC BCMA-36 VL FR3 (aa) 491 WTPARFSGSLLGGKAALTLSGAQPEDEAEYYC BCMA-37 VL FR3 (aa) 492 WTPARFSGSLLGGKAALTLSGAQPEDEADYFC BCMA-38 VL FR3 (aa) 493 GVPSRFSGSGSGTDFALTIRSLQPEDFATYYC BCMA-39 VL FR3 (aa) 494 GVPDRFSGTKSGTSASLAIRGLQSDDDAHYYC BCMA-41 VL FR3 (aa) 495 GVPSRFSGSRSGTDYTLTISSLQPEDVATYYC BCMA-42 VL FR3 (aa) 496 GYSFTSYW BCMA-52 CDR-H1 (aa) 497 GVPSRFSGSGSGTEFTLTISGVQSEDSATYHC BCMA-45 VL FR3 (aa) 498 GIPERFSGSKSGDTASLTISGVEAGDEADYYC BCMA-47 VL FR3 (aa) 499 GIPERFSGSNSGNTATLTISRVEAGDEGDYYC BCMA-48 VL FR3 (aa) 500 GIPERFSGSNSGNTATLTISRVEAGDEAAYYC BCMA-49 VL FR3 (aa) 501 GVPSRFSGSGSGTDFTLTISSLQPEDVAVYYC BCMA-51 VL FR3 (aa) 502 FGPGTRLDIK BCMA-25 VL FR4 (aa) 503 FGXGTKLTVL BCMA-29 VL FR4 (aa) 504 FGQGTKLDIK BCMA-31, -34 VL FR4 (aa) 505 FGTGTKLDIK BCMA-35 VL FR4 (aa) 506 FGGGTKVDIK BCMA-42 VL FR4 (aa) 507 IYPGDSDT BCMA-52 CDR-H2 (aa) 508 FGQGTKVEIK BCMA-24, -28, -51 VL FR4 (aa) 509 GFTFGDYAMH BCMA-30 CDR-H1 (aa) AbM numbering 510 GISWNSGSIX BCMA-28 CDR-H2 (aa) AbM numbering 511 YISGSGSTIY BCMA-33 CDR-H2 (aa) AbM numbering 512 YISSSGNTIY BCMA-41 CDR-H2 AbM numbering 513 ARYSGSFDN BCMA-52 CDR-H3 (aa) 514 SWNSG BCMA-28 CDR-H2 (aa) Chothia numbering 515 SGSGST BCMA-33 CDR-H2 (aa) Chothia numbering 516 SSSGNT BCMA-41 CDR-H2 Chothia numbering 517 SSNIGSHS BCMA-52 CDR-L1 (aa) 518 EVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSGISWNSGSIGY BCMA-24 VH chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPPYGDDAFDIWGQGTMVTV (aa) SS 519 EVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-25, -31, -44, -51 EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSS VH chain (aa) 520 EVQLLESGGGLVQPGRSLRLSCVASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGY BCMA-27 VH chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGGLGITPYYFDYWGQGTLVTVS (aa) S 521 QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIXY BCMA-28 VH chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPPYGDDAFDIGGQGTMVTV (aa) SS 522 QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGY BCMA-29, -39 VH ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPPYGDDAFDIWGQGTMVTV chain (aa) SS 523 QVQLVQSGGGLVQPGRSLRLSCAASGFTFGDYAMHWVRQAPGKGLEWVSGISWNSGSIGY BCMA-30 VH chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLDPDDAFDIWGQGTMVTVSS (aa) 524 QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-32, -49 VH ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWGQGTMVTVSS chain (aa) 525 QVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISGSGSTIYY BCMA-33 VH chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREADSSADYWGQGTLVNVSS (aa) 526 TGQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGY BCMA-34 VH chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPDYDPDAFDIWGQGTMVTV (aa) SS 527 EVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-35 VH chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVDGDYDDYWGQGTLVTVSS (aa) 528 QVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-36, 38 VH chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVDGDYVDDYWGQGTLVTVSS (aa) 529 EVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-37 VH chain ADSVKGRFTISRDNAKSSLYLQMNSLRAEDTAVYYCARVDGDYVDDYWGQGTLVTVSS (aa) 530 QVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGNTIYY BCMA-41 VH chain ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGDYVDDYWGQGTLVTVSS (aa) 531 EVQLLESGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-42 VH chain EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSS (aa) 532 TNN BCMA-52 CDR-L2 (aa) 533 QVQLLESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-47 VH chain ADSVKGDSPSPGTTPKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWRQGTMVTVSS (aa) 534 DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWGSTR BCMA-24 VL chain ESGVPDRFSGSGSGTDFTLTISSLQAEDVAIYHCQQYISLPWTFGQGTKVEIK (aa) 535 DIQMTQSPAFLSASVGDRVTVTCRASQGISNYLAWYQQKPGNAPRLLIYSASTLQSGVPS BCMA-25 VL chain RFRGTGYGTEFSLTIDSLQPEDFATYYCQQSYTSRQTFGPGTRLDIK (aa) 536 SYVLTQPPSVSVAPGQTARITCGANNIGSKSVHWYQQKPGQAPMLVVYDDDDRPSGIPER BCMA-26 VL chain FSGSNSGNTATLTISGVEAGDEADYFCHLWDRSRDHYVFGTGTKLTVL (aa) 537 DIVMTQSPLSLSVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRA BCMA-28 VL chain SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPPWTFGQGTKVEIK (aa) 538 QPVLTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQQHPGKAPKLMIYEVSKRPSGV BCMA-29 VL chain SNRFSGSKSGNTASPTISGLQAEDEADYYCCSYAGSSTSRDVFGXGTKLTVL (aa) 539 EIVLTQSPATLSVSPGERATLSCRASQPIRSNLAWYQQKPGQAPKLLIYSASTRATGIPD BCMA-30 VL chain RFSGSGSGTDFTLTISRLEHEDFAVYYRRHYAPLTFGGGTKVEIK (aa) 540 DVVMTQSPDSLAVSLGERATISCKSSQSVLNSSNNKNYVAWYKQKPGQPPKLVISWASTR BCMA-31 VL chain ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYTFGQGTKLDIK (aa) 541 QTVVTQPPSVSVAPGQTARITCGGNNIGSKGVHWYRQRPGQAPEVVIYDDSDRPSGVPDR BCMA-32 VL chain FSGSNSGNTATLTVRGVEAGDEADYYCQVWDSSSDHWVFGGGTKLTVL (aa) 542 EIVMTQSPATLSLSPGDRATLSCRASQSISNYLAWYQQKPGQAPRLLIYDASNRATGIPA BCMA-34 VL chain RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPYTFGQGTKLDIK (aa) 543 NFMLTQPPSVSVAPGQTARITCGANNIGSKSVHWYQQKPGQAPMLVVYDDDDRPSGIPER BCMA-35 VL chain FSGSNSGNTATLTISGVEAGDEADYFCHLWDRSRDHYVFGTGTKLDIK (aa) 544 QSVLTQEPSLTVSPGETVTLTCGSSTGPVTSAHSPSWFQKKPGQAPTTLIYETTNRHSWT BCMA-36 VL chain PARFSGSLLGGKAALTLSGAQPEDEADYYCLLSSGDARMVFGGGTKLTVL (aa) 545 QLVLTQEPSLTVSPGGTVTLTCGSSTGAVTNGHSPYWFQQKPGQAPRTLIYDTTNRHSWT BCMA-37 VL chain PARFSGSLLGGKAALTLSGAQPEDEAEYYCSLSHAGDRVFFGGGTKLTVL (aa) 546 QAVLTQEPSLTVSPGGTVTLTCGSSTGAVTNGHSPYWFQQKPGQAPRTLIYDTNNRHSWT BCMA-38 VL chain PARFSGSLLGGKAALTLSGAQPEDEADYFCLLSYSDARLAFGGGTKLTVL (aa) 547 DIQXTQSPSSLSASVGDRVTITCRASQGIRYELXWYQQKPGKAPKLLIYAASTLQSGVPS BCMA-39 VL chain RFSGSGSGTDFALTIRSLQPEDFATYYCLQHNSYPLTFGRGTKLEIK (aa) 548 QSALTQPASVSGSPGQSITISCTGSSSDVSKYNLVSWYQQPPGKAPKLIIYDVNKRPSGV BCMA-40 VL chain SNRFSGSKSGNTATLTISGLQGDDEADYYCCSYGGSRSYVFGTGTKLTVL (aa) 549 QPVLTQPPSVSGTPGQRVTIPCSGSSSNIGGNSVDWFQEVPGTAPKLLIYANDRRPSGVP BCMA-41 VL chain DRFSGTKSGTSASLAIRGLQSDDDAHYYCESWDDALNGHVFGGGTKLTVL (aa) 550 DIQMTQSPSLVSASVGDRVTITCRASQGIGNGLAWYQQKPGKAPKLLLFAASRLESGVPS BCMA-42 VL chain RFSGSRSGTDYTLTISSLQPEDVATYYCQQYVEDALTFGGGTKVDIK (aa) 551 AAWDGSLNGLV BCMA-52 CDR-L3 (aa) 552 DVVMTQSPDSLAVSLGERATINCKSSQNLLYSSNNKNYLAWYQQKPGQPPKLLIYWASTR BCMA-44 VL chain ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSSPYTFGQGTKLEIK (aa) 553 AIRMTQSPSSLSASVGDRVTITCRASQGIGRSLAWYKQKPGGVPQLLIHDASSLRSGVPS BCMA-45 VL chain RFSGSGSGTEFTLTISGVQSEDSATYHCQQLNGYPWTFGQGTKVDIK (aa) 554 QAVLTQPPSVSVAPGKTATITCGGNNIGSKSVHWYQRKPGQGPVVVIQYDTDRPSGIPER BCMA-47 VL chain FSGSKSGDTASLTISGVEAGDEADYYCQLWDSDSDDFAFGTGTKLTVL (aa) 555 QPVLTQPPSVSVAPGKTATITCGGNNIGSKSVHWYQRKPGQGPVVVIQYDTDRPSGIPER BCMA-48 VL chain FSGSNSGNTATLTISRVEAGDEGDYYCQVWDSSSDHWVFGGGTKLTVL (aa) 556 LPVLTQPPSVSVAPGKTARITCGGDQIGRKSVHWYQQKPGQAPVLVMSYDSDRPSGIPER BCMA-49 VL chain FSGSNSGNTATLTISRVEAGDEAAYYCQVWDSSTGQYVVFGGGTKLTVL (aa) 557 AIQLTQSPSTLSASVGDRVAITCRASQNIGDWLAWYQQKPGKAPKLLIFGASILESGVPS BCMA-51 VL chain RFSGSGSGTDFTLTISSLQPEDVAVYYCQKYDGAPPWTFGQGTKVEIK (aa) 558 EVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSGISWNSGSIGY BCMA-24 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPPYGDDAFDIWGQGTMVTV sequence (aa) SSGGGGSGGGGSGGGGSDIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQ QKPGQPPKLLIYWGSTRESGVPDXFSGSGSGTDFTLTISSLQAEDVAIYHCQQYISLPWT FGQGTKVEIK 559 EVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-25 scFv EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSDIQMTQSPAFLSASVGDRVTVTCRASQGISNYLAWYQQKPGNAPRLL IYSASTLQSGVPSRFRGTGYGTEFSLTIDSLQPEDFATYYCQQSYTSRQTFGPGTRLDIK 560 EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-26 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWGQGTMVTVSSGG sequence (aa) GGSGGGGSGGGGSSYVLTQPPSVSVAPGQTARITCGANNIGSKSVHWYQQKPGQAPMLVV YDDDDRPSGIPERFSGSNSGNTATLTISGVEAGDEADYFCHLWDRSRDHYVFGTGTKLTV L 561 EVQLLESGGGLVQPGRSLRLSCVASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGY BCMA-27 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGGLGITPYYFDYWGQGTLVTVS sequence (aa) SGGGGSGGGGSGGGGSQPVLTQPPSASGTPGQRVTISCSGGKTVNWFRQVPGTAPQLLIY SNDQRPSGVPDRFSGSKSGSSASLDISGLQSEDEAYYYCGSWDDSLNAWVFGGETKLTVL 562 QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIXY BCMA-28 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPPYGDDAFDIGGQGTMVTV sequence (aa) SSGGGGSGGGGSGGGGSDIVMTQSPLSLSVTPGEPASISCRSSQSLLHSNGYNYLDWYLQ KPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPPWT FGQGTKVEIK 563 QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGY BCMA-29 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPPYGDDAFDIWGQGTMVTV sequence (aa) SSGGGGSGGGGSGGGGSQPVLTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQQHPG KAPKLMIYEVSKRPSGVSNRFSGSKSGNTASPTISGLQAEDEADYYCCSYAGSSTSRDVF GXGTKLTVL 564 QVQLVQSGGGLVQPGRSLRLSCAASGFTFGDYAMHWVRQAPGKGLEWVSGISWNSGSIGY BCMA-30 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLDPDDAFDIWGQGTMVTVSSG sequence (aa) GGGSGGGGSGGGGSEIVLTQSPATLSVSPGERATLSCRASQPIRSNLAWYQQKPGQAPKL LIYSASTRATGIPDRFSGSGSGTDFTLTISRLEHEDFAVYYRRHYAPLTFGGGTKVEIK 565 EVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-31 scFv EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSDVVMTQSPDSLAVSLGERATISCKSSQSVLNSSNNKNYVAWYKQKPG QPPKLVISWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYTFGQG TKLDIK 566 QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-32 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWGQGTMVTVSSGG sequence (aa) GGSGGGGSGGGGSQTVVTQPPSVSVAPGQTARITCGGNNIGSKGVHWYRQRPGQAPEVVI YDDSDRPSGVPDRFSGSNSGNTATLTVRGVEAGDEADYYCQVWDSSSDHWVFGGGTKLTV L 567 QVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISGSGSTIYY BCMA-33 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREADSSADYWGQGTLVNVSSGGG sequence (aa) GSGGGGSGGGGSQPVLTQPPSVSVAPGKTAMITCGGNNIGFKGVQWYQQKTGQAPVLVVY DDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSASDHWVFGGGTKLTVL 568 TGQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGY BCMA-34 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPDYDPDAFDIWGQGTMVTV sequence (aa) SSGGGGSGGGGSGGGGSEIVMTQSPATLSLSPGDRATLSCRASQSISNYLAWYQQKPGQA PRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPYTFGQGT KLDIK 569 EVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-35 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVDGDYDDYWGQGTLVTVSSGGG sequence (aa) GSGGGGSGGGGSNFMLTQPPSVSVAPGQTARITCGANNIGSKSVHWYQQKPGQAPMLVVY DDDDRPSGIPERFSGSNSGNTATLTISGVEAGDEADYFCHLWDRSRDHYVFGTGTKLDIK 570 QVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-36 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVDGDYVDDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSQSVLTQEPSLTVSPGETVTLTCGSSTGPVTSAHSPSWFQKKPGQAPT TLIYETTNRHSWTPARFSGSLLGGKAALTLSGAQPEDEADYYCLLSSGDARMVFGGGTKL TVL 571 EVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-37 scFv ADSVKGRFTISRDNAKSSLYLQMNSLRAEDTAVYYCARVDGDYVDDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSQLVLTQEPSLTVSPGGTVTLTCGSSTGAVTNGHSPYWFQQKPGQAPR TLIYDTTNRHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCSLSHAGDRVFFGGGTKL TVL 572 QVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-38 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVDGDYVDDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSQAVLTQEPSLTVSPGGTVTLTCGSSTGAVTNGHSPYWFQQKPGQAPR TLIYDTNNRHSWTPARFSGSLLGGKAALTLSGAQPEDEADYFCLLSYSDARLAFGGGTKL TVL 573 QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGY BCMA-39 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDLGPPYGDDAFDIWGQGTMVTV sequence (aa) SSGGGGSGGGGSGGGGSDIQXTQSPSSLSASVGDRVTITCRASQGIRYELXWYQQKPGKA PKLLIYAASTLQSGVPSRFSGSGSGTDFALTIRSLQPEDFATYYCLQHNSYPLTFGRGTK LEIK 574 EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-40 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGDYTEDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSQSALTQPASVSGSPGQSITISCTGSSSDVSKYNLVSWYQQPPGKAPK LIIYDVNKRPSGVSNRFSGSKSGNTATLTISGLQGDDEADYYCCSYGGSRSYVFGTGTKL TVL 575 QVQLVQSGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGNTIYY BCMA-41 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGDYVDDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSQPVLTQPPSVSGTPGQRVTIPCSGSSSNIGGNSVDWFQEVPGTAPKL LIYANDRRPSGVPDRFSGTKSGTSASLAIRGLQSDDDAHYYCESWDDALNGHVFGGGTKL TVL 576 EVQLLESGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-42 scFv EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSDIQMTQSPSLVSASVGDRVTITCRASQGIGNGLAWYQQKPGKAPKLL LFAASRLESGVPSRFSGSRSGTDYTLTISSLQPEDVATYYCQQYVEDALTFGGGTKVDIK 577 EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRY BCMA-52 VH (aa) SPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCARYSGSFDNWGQGTLVTVSS 578 EVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-44 scFv EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSDVVMTQSPDSLAVSLGERATINCKSSQNLLYSSNNKNYLAWYQQKPG QPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSSPYTFGQG TKLEIK 579 QVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-45 scFv EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSAIRMTQSPSSLSASVGDRVTITCRASQGIGRSLAWYKQKPGGVPQLL IHDASSLRSGVPSRFSGSGSGTEFTLTISGVQSEDSATYHCQQLNGYPWTFGQGTKVDIK 580 QVQLLESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-47 scFv ADSVKGDSPSPGTTPKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWRQGTMVTVSSGG sequence (aa) GGSGGGGSGGGGSQAVLTQPPSVSVAPGKTATITCGGNNIGSKSVHWYQRKPGQGPVVVI QYDTDRPSGIPERFSGSKSGDTASLTISGVEAGDEADYYCQLWDSDSDDFAFGTGTKLTV L 581 EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-48 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWGQGTMVTVSSGG sequence (aa) GGSGGGGSGGGGSQPVLTQPPSVSVAPGKTATITCGGNNIGSKSVHWYQRKPGQGPVVVI QYDTDRPSGIPERFSGSNSGNTATLTISRVEAGDEGDYYCQVWDSSSDHWVFGGGTKLTV L 582 QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYY BCMA-49 scFv ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVDGPPSFDIWGQGTMVTVSSGG sequence (aa) GGSGGGGSGGGGSLPVLTQPPSVSVAPGKTARITCGGDQIGRKSVHWYQQKPGQAPVLVM SYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEAAYYCQVWDSSTGQYVVFGGGTKLT VL 583 EVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTT BCMA-51 scFv EYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCAAWSAPTDYWGQGTLVTVSSGG sequence (aa) GGSGGGGSGGGGSAIQLTQSPSTLSASVGDRVAITCRASQNIGDWLAWYQQKPGKAPKLL IFGASILESGVPSRFSGSGSGTDFTLTISSLQPEDVAVYYCQKYDGAPPWTFGQGTKVEI K 584 CAGGTGCAGCTGGTGCAATCTGGGGGAGGCTTGGTCAAGCCTGGAGGGTCCCTGAGACTC BCMA-41 scFv TCCTGTGCAGCCTCTGGATTCACCTTCAGTGACTACTACATGAGCTGGATCCGCCAGGCT sequence (nt) CCAGGGAAGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAATACCATATACTAC GCAGACTCTGTAAAGGGCCGATTCACCATCTCCAGGGACAACGCCAAAAACTCACTGTAT CTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGTGGAC GGTGACTACGTCGATGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGGATCGCAGCCTGTGCTGACTCAGCCA CCCTCAGTGTCTGGGACCCCCGGGCAGAGGGTCACCATCCCTTGTTCTGGAAGCAGCTCC AACATCGGAGGTAACTCTGTAGACTGGTTCCAGGAGGTCCCAGGGACGGCCCCCAAACTC CTCATCTACGCTAATGATCGGCGGCCCTCGGGTGTCCCTGACCGCTTCTCTGGCACCAAG TCGGGCACCTCAGCCTCCCTGGCCATCAGGGGGCTCCAGTCTGACGATGACGCTCATTAT TACTGTGAATCCTGGGACGATGCCCTGAACGGTCACGTGTTCGGCGGAGGGACCAAGCTG ACCGTCCTA 585 QIQLVQSGPELKKPGETVKISCKASGYTFTDYSINWVKRAPGKGLKWMGWINTETREPAY Reference 1 VH-VL AYDFRGRFAFSLETSASTAYLQINNLKYEDTATYFCALDYSYAMDYWGQGTSVTVSSGGG scFv (aa) GSGGGGSGGGGSDIVLTQSPPSLAMSLGKRATISCRASESVTILGSHLIHWYQQKPGQPP TLLIQLASNVQTGVPARFSGSGSRTDFTLTIDPVEEDDVAVYYCLQSRTIPRTFGGGTKL EIK 586 DVVMTQSHRFMSTSVGDRVSITCRASQDVNTAVSWYQQKPGQSPKLLIFSASYRYTGVPD Reference 2 VL-VH RFTGSGSGADFTLTISSVQAEDLAVYYCQQHYSTPWTFGGGTKLDIKGGGGSGGGGSGGG scFv (aa) GSQIQLVQSGPDLKKPGETVKLSCKASGYTFTNFGMNWVKQAPGKGFKWMAWINTYTGES YFADDFKGRFAFSVETSATTAYLQINNLKTEDTATYFCARGEIYYGYDGGFAYWGQGTLV TVSA 587 SYELTQPPSASGTPGQRVTMSCSGTSSNIGSHSVNWYQQLPGTAPKLLIYTNNQRPSGVP BCMA-52 VL (aa) DRFSGSKSGTSASLAISGLQSEDEADYYCAAWDGSLNGLVFGGGTKLTVLG 588 GYTFIDYY BCMA-55 CDR-H1 (aa) 589 INPNSGGT BCMA-55 CDR-H2 (aa) 590 ARSQRDGYMDY BCMA-55 CDR-H3 (aa) 591 ISCTGTSSD BCMA-55 CDR-L1 (aa) 592 EDS BCMA-55 CDR-L2 (aa) 593 SSNTRSSTLV BCMA-55 CDR-L3 (aa) 594 EVQLVQSGAEMKKPGASLKLSCKASGYTFIDYYVYWMRQAPGQGLESMGWINPNSGGTNY BCMA-55 VH (aa) AQKFQGRVTMTRDTSISTAYMELSRLRSDDTAMYYCARSQRDGYMDYWGQGTLVTVSS 595 QSALTQPASVSASPGQSIAISCTGTSSDVGWYQQHPGKAPKLMIYEDSKRPSGVSNRFSG BCMA-55 VL (aa) SKSGNTASLTISGLQAEDEADYYCSSNTRSSTLVFGGGTKLTVLG 596 LEGGGEGRGSLLTCGDVEENPGPR T2A 597 EGRGSLLTCGDVEENPGP T2A 598 GSGATNFSLLKQAGDVEENPGP P2A 599 ATNFSLLKQAGDVEENPGP P2A 600 QCTNYALLKLAGDVESNPGP E2A 601 VKQTLNFDLLKLAGDVESNPGP F2A 602 MLLLVTSLLLCELPHPAFLLIPRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHI EGFRt LPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTK QHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKII SNRGENSCKATGQVCHALCSPEGCWGPEPROCVSCRNVSRGRECVDKCNLLEGEPREFVE NSECIQCHPECLPQAMNITCTGRGPONCIQCARYIDGPHCVKTCPAGVMGENNTLVWKYA DAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFM 603 RKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELD EGFRt ILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSL KEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPE GCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTG RGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGL EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFM 604 GAGGTGCAGCTGGTGCAGAGCGGAGGAGGCCTGGTGCAGCCTGGCAGGTCCCTGCGCCTG BCMA-25 scFv TCTTGCACCGCCAGCGGCTTCACATTTGGCGACTATGCCATGTCCTGGTTCAGGCAGGCA sequence (nt) CCAGGCAAGGGCCTGGAGTGGGTGGGCTTTATCCGCTCTAAGGCCTACGGCGGCACCACA GAGTATGCCGCCAGCGTGAAGGGCCGGTTCACCATCAGCCGGGACGACTCTAAGAGCATC GCCTACCTGCAGATGAACTCTCTGAAGACCGAGGACACAGCCGTGTACTATTGCGCAGCA TGGAGCGCCCCAACCGATTATTGGGGCCAGGGCACCCTGGTGACAGTGAGCTCCGGCGGC GGCGGCTCTGGAGGAGGAGGAAGCGGAGGAGGAGGATCCGACATCCAGATGACACAGTCC CCTGCCTTTCTGTCCGCCTCTGTGGGCGATAGGGTGACCGTGACATGTCGCGCCTCCCAG GGCATCTCTAACTACCTGGCCTGGTATCAGCAGAAGCCCGGCAATGCCCCTCGGCTGCTG ATCTACAGCGCCTCCACCCTGCAGAGCGGAGTGCCCTCCCGGTTCAGAGGAACCGGCTAT GGCACAGAGTTTTCTCTGACCATCGACAGCCTGCAGCCAGAGGATTTCGCCACATACTAT TGTCAGCAGTCTTACACCAGCCGGCAGACATTTGGCCCCGGCACAAGACTGGATATCAAG 605 GAGGTGCAGCTGGTGGAGTCCGGAGGAGGCCTGGTGAAGCCAGGAGGCTCTCTGAGGCTG BCMA-26 scFv AGCTGCGCAGCCTCCGGCTTCACCTTTTCTGACTACTATATGAGCTGGATCAGGCAGGCA sequence (nt) CCAGGCAAGGGCCTGGAGTGGGTGTCTTACATCAGCTCCTCTGGCAGCACAATCTACTAT GCCGACTCCGTGAAGGGCAGGTTCACCATCTCTCGCGATAACGCCAAGAATAGCCTGTAT CTGCAGATGAACTCCCTGCGGGCCGAGGATACAGCCGTGTACTATTGCGCCAAGGTGGAC GGCCCCCCTTCCTTTGATATCTGGGGCCAGGGCACAATGGTGACCGTGAGCTCCGGAGGA GGAGGATCCGGCGGAGGAGGCTCTGGCGGCGGCGGCTCTAGCTATGTGCTGACCCAGCCA CCATCCGTGTCTGTGGCACCTGGACAGACAGCAAGGATCACCTGTGGAGCAAACAATATC GGCAGCAAGTCCGTGCACTGGTACCAGCAGAAGCCTGGCCAGGCCCCAATGCTGGTGGTG TATGACGATGACGATCGGCCCAGCGGCATCCCTGAGAGATTTTCTGGCAGCAACTCCGGC AATACCGCCACACTGACCATCTCTGGAGTGGAGGCAGGCGACGAGGCAGATTACTTCTGT CACCTGTGGGACCGGAGCAGAGATCACTACGTGTTCGGCACAGGCACCAAGCTGACCGTG CTG 606 tcctatgagctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatg BCMA-52 scFv tcttgttctggaaccagctccaacatcggaagtcactctgtaaactggtaccagcagctc sequence (nt) ccaggaacggcccccaaactcctcatctatactaataatcagcggccctcaggggtccct gaccgattctctggctccaagtctggcacctcagcctccctggccatcagtggcctccag tctgaggatgaggctgattattactgtgcagcatgggatggcagcctgaatggtctggta ttcggcggagggaccaagctgaccgtcctaggttctagaggtggtggtggtagcggcggc ggcggctctggtggtggtggatccctcgagatggccgaggtgcagctggtgcagtctgga gcagaggtgaaaaagcccggggagtctctgaagatctcctgtaagggttctggatacagc tttaccagctactggatcggctgggtgcgccagatgcccgggaaaggcctggagtggatg gggatcatctatcctggtgactctgataccagatacagcccgtccttccaaggccacgtc accatctcagctgacaagtccatcagcactgcctacctgcagtggagcagcctgaaggcc tcggacaccgccatgtattactgtgcgcgctactctggttctttcgataactggggtcaa ggtactctggtgaccgtctcctca 607 caatctgccctgactcagcctgcctccgtgtctgcgtctcctggacagtcgatc BCMA-55 scFv gccatctcctgcactggaaccagcagtgacgttggttggtatcaacagcaccca sequence (nt) ggcaaagcccccaaactcatgatttatgaggacagtaagcggccctcaggggtt tctaatcgcttctctggctccaagtctggcaacacggcctccctgaccatctct gggctccaggctgaggacgaggctgattattactgcagctcaaatacaagaagc agcactttggtgttcggcggagggaccaagctgaccgtcctaggttctagaggt ggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcc gaagtgcagctggtgcagtctggggctgagatgaagaagcctggggcctcactg aagctctcctgcaaggcttctggatacaccttcatcgactactatgtatactgg atgcgacaggcccctggacaagggcttgagtccatgggatggatcaaccctaac agtggtggcacaaactatgcacagaagtttcagggcagggtcaccatgaccagg gacacgtccatcagcacagcctacatggagctgagcaggctgagatctgacgac accgccatgtattactgtgcgcgctcccagcgtgacggttacatggattactgg ggtcaaggtactctggtgaccgtctcctca 608 SNTPPLTCQR BCMA epitope 609 CIPCQLR BCMA epitope 610 SVTNSVK BCMA epitope 611 CSQNEYF BCMA epitope 612 LLHACIPCQLR BCMA epitope 613 QNEYF BCMA epitope 614 CIPCQL BCMA epitope 615 CQRYC BCMA epitope 616 MLMAG BCMA epitope 617 QNEYFDSLL BCMA epitope 618 YFDSL BCMA epitope 619 QLRCSSNTPPL BCMA epitope 620 YFDSLL BCMA epitope