VARIANT RNA-GUIDED CAS12F4 NUCLEASES AND DNA BINDING PROTEINS
20250327095 ยท 2025-10-23
Inventors
- Thomas Dubois (Somerville, MA, US)
- Rohan Jonnalagadda (Boston, MA, US)
- Adam Patrick Joyce (Stow, MA, US)
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N9/0071
CHEMISTRY; METALLURGY
C12N9/226
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N15/90
CHEMISTRY; METALLURGY
C12N15/88
CHEMISTRY; METALLURGY
International classification
C12N15/90
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
Abstract
Provided are variant Cas12f4 polypeptides, fusion proteins containing variant Cas12f4 polypeptides, nucleic acids encoding variant Cas12f4 polypeptides and fusion proteins, compositions and methods related to those variant Cas12f4 polypeptides and fusion proteins, and modified host cells comprising the variant Cas12f4 polypeptides and/or encoding nucleic acids. The variant Cas12f4 polypeptides disclosed herein exhibit improved functionality, stability, and/or other desirable properties and may be used in combination with guide Cas12f4 RNAs that can be used in a variety of applications ex vivo, in vitro, and in vivo.
Claims
1. A variant Cas12f4 polypeptide comprising: (i) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 1 through 14 of the Cas12f4 sequence of SEQ ID NO: 1; (ii) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 15 through 178 of the Cas12f4 sequence of SEQ ID NO: 1; (iii) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 179 through 271 of the Cas12f4 sequence of SEQ ID NO: 1; (iv) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 272 through 328 of the Cas12f4 sequence of SEQ ID NO: 1; (v) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 329 through 449 of the Cas12f4 sequence of SEQ ID NO: 1; (vi) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 450 through 605 of the Cas12f4 sequence of SEQ ID NO: 1; (vii) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 606 through 656 of the Cas12f4 sequence of SEQ ID NO: 1; (viii) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 657 through 794 of the Cas12f4 sequence of SEQ ID NO: 1; (ix) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 795 through 836 of the Cas12f4 sequence of SEQ ID NO: 1; (x) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 837 through 911 of the Cas12f4 sequence of SEQ ID NO: 1; (xi) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 912 through 1014 of the Cas12f4 sequence of SEQ ID NO: 1; and/or (xii) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 1015 through 1045 of the Cas12f4 sequence of SEQ ID NO: 1; wherein the variant Cas12f4 polypeptide exhibits altered functionality relative to a wild-type Cas12f4 polypeptide and wherein the variant Cas12f4 polypeptide has an amino acid sequence that is at least 60%,70%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the Cas12f4 polypeptide comprising an amino acid sequence of SEQ ID NO: 1.
2. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is an R (Arg) at position 8 of SEQ ID NO: 1.
3. The variant Cas12f4 polypeptide of claim 2, comprising an amino acid substitution R8L (SEQ ID NO: 2).
4. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 1 through 14 comprise at least a portion of the Cas12f4 WED-I domain (SEQ ID NO. 163).
5. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide.
6. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of an H (His) at position 39, an R (Arg) at position 40, an F (Phe) at position 51, a D (Asp) at position 62, a V (Val) at position 67, an F (Phe) at position 70, an S (Ser) at position 84, an N (Asn) at position 110, an M (Met) at position 125, an S (Ser) at position 145, a Y (Tyr) at position 150, a W (Trp) at position 159, a D (Asp) at position 166, a W (Trp) at position 170, and a G (Gly) at position 171 of SEQ ID NO: 1.
7. The variant Cas12f4 polypeptide of claim 6, comprising an amino acid substitution selected from the group consisting of H39F (SEQ ID NO: 3), R40H (SEQ ID NO: 4), F51Y (SEQ ID NO: 5), D62P (SEQ ID NO: 6), V67I (SEQ ID NO: 7), F70Y (SEQ ID NO: 8), S84R (SEQ ID NO: 9), N110I (SEQ ID NO: 10), M125K (SEQ ID NO: 11), S145E (SEQ ID NO: 12, Y150F (SEQ ID NO: 13), W159V (SEQ ID NO: 14), D166P (SEQ ID NO: 15), W170Y (SEQ ID NO: 16), W170N (SEQ ID NO: 17), W170K (SEQ ID NO: 18), G171R (SEQ ID NO: 19, G171K (SEQ ID NO: 20), G171A (SEQ ID NO: 21), and G17 IN (SEQ ID NO: 22).
8. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 15 through 178 comprise at least a portion of the Cas12f4 Helical-I domain (SEQ ID NO. 164).
9. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered genome editing functionality as compared to the wild-type Cas12f4 polypeptide.
10. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of an E (Glu) at position 179, an E (Glu) at position 183, a K (Lys) at position 188, a Y (Tyr) at position 207, an H (His) at position 223, a D (Asp) at position 233, an S (Ser) at position 234, a T (Thr) at position 235, a G (Gly) at position 236, an R (Arg) at position 237, a Y (Tyr) at position 241, a K (Lys) at position 245, a L (Leu) at position 252, and an M (Met) at position 253 of SEQ ID NO: 1.
11. The variant Cas12f4 polypeptide of claim 10, comprising an amino acid substitution selected from the group consisting of E179R (SEQ ID NO: 23), E179K (SEQ ID NO: 24, E179H (SEQ ID NO: 25), E183Q (SEQ ID NO: 26), E183K (SEQ ID NO: 27), E183R (SEQ ID NO: 28), K188R (SEQ ID NO: 29), Y207W (SEQ ID NO: 30), H223W (SEQ ID NO: 31), H223L (SEQ ID NO: 32), H223Q (SEQ ID NO: 33), K228R (SEQ ID NO: 176), K228X (SEQ ID NO: 177), D233X (SEQ ID NO: 34), S234X (SEQ ID NO: 35), T235X (SEQ ID NO: 36), G236X (SEQ ID NO: 37), R237X (SEQ ID NO: 38), Y241F (SEQ ID NO: 39), K245R (SEQ ID NO: 40), L252E (SEQ ID NO: 41), and M253E (SEQ ID NO: 42), wherein X designates any amino acid other than the wild-type amino acid.
12. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 179 through 271 comprise at least a portion of the Cas12f4 PI domain (SEQ ID NO. 165).
13. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered DNA-binding affinity, an altered DNA-binding specificity, an altered R-loop lifetime, and/or an altered protein stability as compared to the wild-type Cas12f4 polypeptide.
14. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a Y (Tyr) at position 283, an N (Asn) at position 295, an A (Ala) at position 305, and an F (Phe) at position 323 of SEQ ID NO: 1.
15. The variant Cas12f4 polypeptide of claim 14, comprising an amino acid substitution selected from the group consisting of Y283W (SEQ ID NO: 43), N295X (SEQ ID NO: 44), A305M (SEQ ID NO: 45), and F323Y (SEQ ID NO: 46), wherein X designates any amino acid other than the wild-type amino acid.
16. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 272 through 328 comprise at least a portion of the Cas12f4 Helical-I domain (SEQ ID NO. 166).
17. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered DNA-binding affinity and/or an altered DNA-binding specificity as compared to the wild-type Cas12f4 polypeptide.
18. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a F (Phe) at position 347, an H (His) at position 352, a K (Lys) at position 353, a V (Val) at position 359, an E (Glu) at position 363, an F (Phe) at position 367, an N (Asn) at position 368, an N (Asn) at position 369, an A (Ala) at position 375, an A (Ala) at position 384, a V (Val) at position 394, an I (Ile) at position 403, a K (Lys) at position 404, an E (Glu) at position 412, a V (Val) at position 419, a V (Val) at position 427, an S (Ser) at position 433, a T (Thr) at position 445, a E (Glu) at position 447, and a C (Cys) at position 448 of SEQ ID NO: 1.
19. The variant Cas12f4 polypeptide of claim 18, comprising an amino acid substitution selected from the group consisting of F347Y (SEQ ID NO: 47), F347L (SEQ ID NO: 48, H352Y (SEQ ID NO: 49), K353W (SEQ ID NO: 50), V359T (SEQ ID NO: 51), E363R (SEQ ID NO: 52), F367V (SEQ ID NO: 53), N368T (SEQ ID NO: 54), N369P (SEQ ID NO: 55), A375E (SEQ ID NO: 56), A384G (SEQ ID NO: 57), V394I (SEQ ID NO: 58), I403L (SEQ ID NO: 59), K404X (SEQ ID NO: 60), E412K (SEQ ID NO: 61), V419I (SEQ ID NO: 62), V427M (SEQ ID NO: 63), V427C (SEQ ID NO: 64), S433V (SEQ ID NO: 65), T445V (SEQ ID NO: 66), T445Y (SEQ ID NO: 67), E447L (SEQ ID NO: 68), C448K (SEQ ID NO: 69), C448R (SEQ ID NO: 70), and C448X (SEQ ID NO: 71) wherein X designates any amino acid other than the wild-type amino acid.
20. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 329 through 449 comprise at least a portion of the Cas12f4 Helical-II domain.
21. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered interaction with crRNA within a Cas12f4 heteroduplex.
22. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of an S (Ser) at position 470, a K (Lys) at position 471, a K (Lys) at position 472, an A (Ala) at position 474, a V (Val) at position 476, an E (Glu) at position 479, a G (Gly) at position 481, an E (Glu) at position 494, an E (Glu) at position 504, a T (Thr) at position 505, an H (His) at position 507, a K (Lys) at position 514, a E (Glu) at position 517, a V (Val) at position 532, an L (Leu) at position 536, a C (Cys) at position 567, and an N (Asn) at position 586 of SEQ ID NO: 1.
23. The variant Cas12f4 polypeptide of claim 22, comprising an amino acid substitution selected from the group consisting of S470D (SEQ ID NO: 72), K471X (SEQ ID NO: 73, K472X (SEQ ID NO: 74), A474K (SEQ ID NO: 75), V476K (SEQ ID NO: 76), E479T (SEQ ID NO: 77), G481K (SEQ ID NO: 78), G481N (SEQ ID NO: 79), E494T (SEQ ID NO: 80), E494Q (SEQ ID NO: 81), E494N (SEQ ID NO: 82), E504K (SEQ ID NO: 83), E504R (SEQ ID NO: 84), T505K (SEQ ID NO: 85), H507R (SEQ ID NO: 86), K514R (SEQ ID NO: 87), E517R (SEQ ID NO: 88), E517Q (SEQ ID NO: 89), V532I (SEQ ID NO: 90), L536F (SEQ ID NO: 91), L536K (SEQ ID NO: 92), L536R (SEQ ID NO: 93), C567R (SEQ ID NO: 94), and N586R (SEQ ID NO: 95), wherein X designates any amino acid other than the wild-type amino acid.
24. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 450 through 605 comprise at least a portion of the Cas12f4 WED-II domain.
25. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 DNA-binding affinity, Cas12f4 DNA presentation, Cas12f4 nonspecific DNA recognition, Cas12f4 interaction with the PAM minor groove, Cas12f4 DNA contact adjacent to PAM, and/or Cas12f4 interactions with BPs and BB.
26. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a D (Asp) at position 619, an F (Phe) at position 644, and an F (Phe) at position 651 of SEQ ID NO: 1.
27. The variant Cas12f4 polypeptide of claim 26, comprising an amino acid substitution D619A (SEQ ID NO: 96), F644Y (SEQ ID NO: 97), and F651M (SEQ ID NO: 98).
28. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 606 through 656 comprise at least a portion of the Cas12f4 RuvC-I domain.
29. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 RuvC catalytic activity.
30. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of an L (Leu) at position 662, an N (Asn) at position 673, an H (His) at position 674, an I (Ile) at position 682, an F (Phe) at position 695, an H (His) at position 702, an A (Ala) at position 717, a W (Trp) at position 764, a T (Thr) at position 766, a G (Gly) at position 771, and an E (Glu) at position 788 of SEQ ID NO: 1.
31. The variant Cas12f4 polypeptide of claim 30, comprising an amino acid substitution selected from the group consisting of L662R (SEQ ID NO: 99), L662K (SEQ ID NO: 100, L662H (SEQ ID NO: 101), N673S (SEQ ID NO: 102), H674Y (SEQ ID NO: 103), I682S (SEQ ID NO: 104), F695L (SEQ ID NO: 105), H702N (SEQ ID NO: 106), H702K (SEQ ID NO: 107, H702R (SEQ ID NO: 108), A717V (SEQ ID NO: 110), A717L (SEQ ID NO: 111), W764R (SEQ ID NO: 112), T766H (SEQ ID NO: 113), G771E (SEQ ID NO: 114), and E788T (SEQ ID NO: 115).
32. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 657 through 794 comprise at least a portion of the Cas12f4 Helical-III domain.
33. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 crRNA interactions and/or RuvC catalytic activity.
34. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of an F (Phe) at position 800, an A (Ala) at position 805, an S (Ser) at position 811, a K (Lys) at position 813, an R (Arg) at position 814, an E (Glu) at position 815, an L (Leu) at position 825 of SEQ ID NO: 1, a T (Thr) at position 827, and a Q (Gln) at position 830.
35. The variant Cas12f4 polypeptide of claim 34, comprising an amino acid substitution selected from the group consisting of F800Y (SEQ ID NO: 116), A805E (SEQ ID NO: 117), S811R (SEQ ID NO: 118), K813R (SEQ ID NO: 119), R814K (SEQ ID NO: 120), E815K (SEQ ID NO: 121), L825V (SEQ ID NO: 122), L825I (SEQ ID NO: 123), L825A (SEQ ID NO: 124), L825F (SEQ ID NO: 125), T827K (SEQ ID NO: 126), T827R (SEQ ID NO: 127), and Q830L (SEQ ID NO: 128).
36. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 795 through 836 comprise at least a portion of the Cas12f4 BH domain.
37. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 crRNA interaction and/or RuvC catalytic activity.
38. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a V (Val) at position 841, a V (Val) at position 843, an E (Glu) at position 844, an S (Ser) at position 853, a C (Cys) at position 866, as S (Ser) at position 867, an M (Met) at position 877, an I (Ile) at position 885, an A (Ala) at position 890, an S (Ser) at position 894, and an L (Leu) at position 899 of SEQ ID NO: 1.
39. The variant Cas12f4 polypeptide of claim 38, comprising an amino acid substitution selected from the group consisting of V841I (SEQ ID NO: 129), V843G (SEQ ID NO: 130), V843C (SEQ ID NO: 131), E844A (SEQ ID NO: 132), E844V (SEQ ID NO: 133), S853W (SEQ ID NO: 134), C866I (SEQ ID NO: 135), C866V (SEQ ID NO: 136), S867A (SEQ ID NO: 137), M877L (SEQ ID NO: 138), 1885L (SEQ ID NO: 139), 1885F (SEQ ID NO: 140), A890P (SEQ ID NO: 141), S894A (SEQ ID NO: 142), and L899F (SEQ ID NO: 143).
40. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 834 through 908 comprise at least a portion of the Cas12f4 RuvC-II domain.
41. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 crRNA interaction and/or RuvC catalytic activity.
42. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a C (Cys) at position 914, a Y (Tyr) at position 916, an S (Ser) at position 917, a Q (Gln) at position 929, an A (Ala) at position 933, a V (Val) at position 936, a W (Trp) at position 938, a C (Cys) at position 947, a G (Gly) at position 951, an H (His) at position 959, an L (Leu) at position 967, a V (Val) at position 990, a T (Thr) at position 993, and a C (Cys) at position 1014 of SEQ ID NO: 1.
43. The variant Cas12f4 polypeptide of claim 42, comprising an amino acid substitution selected from the group consisting of C914A (SEQ ID NO: 144), Y916F (SEQ ID NO: 145), S917K (SEQ ID NO: 146), Q929L (SEQ ID NO: 147), A933K (SEQ ID NO: 148), A933R (SEQ ID NO: 149), V936L (SEQ ID NO: 150), W938L (SEQ ID NO: 151), C947A (SEQ ID NO: 152), C947Y (SEQ ID NO: 153), G951A (SEQ ID NO: 154), H959Y (SEQ ID NO: 155), L967Y (SEQ ID NO: 156), V990K (SEQ ID NO: 157), T993S (SEQ ID NO: 158), C1014E (SEQ ID NO: 159), and C1014N (SEQ ID NO: 160).
44. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 912 through 1014 comprise at least a portion of the Cas12f4 Nuc domain.
45. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 RuvC catalytic activity.
46. The variant Cas12f4 polypeptide of claim 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a D (Asp) at position 1017 and a C (Cys) at position 1025 of SEQ ID NO: 1.
47. The variant Cas12f4 polypeptide of claim 1, comprising an amino acid substitution selected from the group consisting of D1017A (SEQ ID NO: 161) and C1025A (SEQ ID NO: 162).
48. The variant Cas12f4 polypeptide of claim 1, wherein Cas12f4 amino acids 1015 through 1045 comprise at least a portion of the Cas12f4 RuvC-III domain.
49. The variant Cas12f4 polypeptide of claim 1, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 RuvC catalytic activity.
50. A composition comprising: a) a variant Cas12f4 polypeptide of claim 1 or a nucleic acid molecule encoding a variant Cas12f4 polypeptide of claim 1 and b) a Cas12f4 guide RNA or one or more nucleic acids encoding a Cas12f4 guide RNA.
51. The composition of claim 50, wherein said Cas12f4 guide RNA is a single guide RNA.
52. The composition of claim 50, wherein said Cas12f4 guide RNA comprises: (i) a targeting sequence of a variable RNA of about 20 or 21 to about 23 or 24 nucleotides at the 5 end that is complementary to editing/cleavage target; and (ii) a crRNA of about 16, 17, or 18 to about 20 or 21 nucleotides at the 3 end that can be bound by the Cas12 polypeptide, optionally wherein the crRNA molecule comprises the polyribonucleotide sequence of SEQ ID NO: 175.
53. The composition of claim 50, wherein the composition comprises a lipid.
54. The composition of claim 50, wherein said variant Cas12f4 polypeptide or nucleic acid encoding said variant Cas12f4 polypeptide and said Cas12f4 guide RNA or nucleic acid(s) encoding said Cas12f4 guide RNA are within a liposome.
55. The composition of claim 50, wherein said variant Cas12f4 polypeptide or nucleic acid encoding said variant Cas12f4 polypeptide and said Cas12f4 guide RNA or nucleic acid(s) encoding said Cas12f4 guide RNA are within and/or at least partially coat a particle.
56. The composition of claim 50, comprising a buffer, a nuclease inhibitor, and/or a protease inhibitor.
57. The composition of claim 50, wherein said variant Cas12f4 polypeptide is a nickase that cleaves only one strand of a double-stranded target nucleic acid molecule.
58. The composition of claim 50, wherein the mutant Cas12f4 polypeptide is a catalytically inactive mutant Cas12f4 polypeptide.
59. The composition of claim 50, further comprising a DNA donor template.
60. A variant Cas12f4 fusion polypeptide comprising a variant Cas12f4 polypeptide of claim 1 fused to a heterologous polypeptide.
61. The variant Cas12f4 fusion polypeptide of claim 60, wherein the variant Cas12f4 polypeptide is a nickase that cleaves only one strand of a double-stranded target nucleic acid molecule.
62. The variant Cas12f4 fusion polypeptide of claim 60, wherein the variant Cas12f4 polypeptide is a catalytically inactive mutant Cas12f4 polypeptide.
63. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide is operably linked to the N-terminus and/or the C-terminus of the variant Cas12f4 polypeptide.
64. The variant Cas12f4 fusion polypeptide of claim 60, comprising a nuclear localization signal (NLS).
65. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide is a targeting polypeptide that binds to a cell surface moiety on a target cell or target cell type.
66. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide exhibits an enzymatic activity that modifies a target DNA.
67. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a nuclease activity, a methyltransferase activity, a demethylase activity, a DNA repair activity, a DNA damage activity, a deamination activity, a dismutase activity, an alkylation activity, a depurination activity, an oxidation activity, a pyrimidine dimer forming activity, an integrase activity, a transposase activity, a recombinase activity, a polymerase activity, a ligase activity, a helicase activity, a photolyase activity, and a glycosylase activity.
68. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a nuclease activity, a methyltransferase activity, a demethylase activity, a deamination activity, a depurination activity, an integrase activity, a transposase activity, and a recombinase activity.
69. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide exhibits an enzymatic activity that modifies a target polypeptide associated with a target nucleic acid.
70. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide exhibits histone modification activity.
71. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide exhibits an enzymatic activities selected from the group consisting of a methyltransferase activity, a demethylase activity, an acetyltransferase activity, a deacetylase activity, a kinase activity, a phosphatase activity, a ubiquitin ligase activity, a deubiquitinating activity, an adenylation activity, a deadenylation activity, a SUMOylating activity, a deSUMOylating activity, a ribosylation activity, a deribosylation activity, a myristoylation activity, a demyristoylation activity, a glycosylation activity (e.g., from O-GlcNAc transferase), and a deglycosylation activity.
72. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a methyltransferase activity, a demethylase activity, an acetyltransferase activity, and a deacetylase activity.
73. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide is an endosomal escape polypeptide.
74. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide is a chloroplast transit peptide.
75. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide increases or decreases transcription of a gene when the variant Cas12f4 fusion polypeptide is bound to said gene and a guide RNA.
76. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide is a transcriptional repressor domain.
77. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide is a transcriptional activation domain.
78. The variant Cas12f4 fusion polypeptide of claim 60, wherein said heterologous polypeptide comprises a protein binding domain.
79. A nucleic acid molecule encoding the variant Cas12f4 fusion polypeptide of claim 60.
80. The nucleic acid molecule of claim 79, wherein the nucleotide sequence encoding the mutant Cas12f4 fusion polypeptide is operably linked to a promoter.
81. The nucleic acid molecule of claim 80, wherein the promoter is functional in a eukaryotic cell.
82. The nucleic acid molecule of claim 81, wherein said eukaryotic cell is selected from the group consisting of a plant cell, a fungal cell, an animal cell, cell of an invertebrate, a fly cell, a cell of a vertebrate, a mammalian cell, a primate cell, a non-human primate cell, and a human cell.
83. The nucleic acid molecule of claim 80, wherein said promoter is selected from the group consisting of a constitutive promoter, an inducible promoter, a cell type-specific promoter, and a tissue-specific promoter.
84. The nucleic acid molecule of claim 79, wherein said nucleic acid molecule is a DNA molecule.
85. The nucleic acid molecule of claim 84, wherein said DNA molecule is an expression vector.
86. The nucleic acid molecule of claim 85, wherein said expression vector is selected from the group consisting of an adeno-associated viral vector, a retroviral vector, and a lentiviral vector.
87. The nucleic acid molecule of claim 80, wherein said promoter is functional in a prokaryotic cell.
88. The nucleic acid molecule of claim 79, wherein said nucleic acid molecule is an mRNA.
89. A nucleic acid molecule encoding: (a) a Cas12f4 guide RNA, which comprises a crRNA and a spacer RNA; and (b) a variant Cas12f4 polypeptide of claim 1.
90. The nucleic acid molecule of claim 89, wherein said variant Cas12f4 polypeptide is catalytically inactive.
91. The nucleic acid molecule of claim 89, wherein the crRNA molecule comprises the polyribonucleotide sequence of SEQ ID NO: 175.
92. The nucleic acid molecule of claim 90, wherein said catalytically inactive variant Cas12f4 polypeptide comprises an amino acid substitution within a nuclease (NUC) lobe that decreases or inactivates a Cas12f4 nuclease activity.
93. The nucleic acid molecule of claim 89, wherein the Cas12f4 guide RNA is a single guide RNA.
94. The nucleic acid molecule of claim 89, wherein said nucleic acid molecule comprises a nucleotide sequence encoding an crRNA and a nucleotide sequence encoding a spacer, and wherein said nucleotide sequence encoding the crRNA and the nucleotide sequence encoding the spacer are on different DNA molecules.
95. The nucleic acid molecule of claim 89, wherein said nucleic acid molecule comprises a nucleotide sequence that (a) encodes the variant Cas12f4 and (2) is operably linked to a promoter.
96. The nucleic acid molecule of claim 95, wherein said promoter is functional in a eukaryotic cell.
97. The nucleic acid molecule of claim 96, wherein said eukaryotic cell is selected from the group consisting of a plant cell, a fungal cell, an animal cell, a cell of an invertebrate, a fly cell, a cell of a vertebrate, a mammalian cell, a primate cell, a non-human primate cell, and a human cell.
98. The nucleic acid molecule of claim 95, wherein said promoter is selected from the group consisting of a constitutive promoter, an inducible promoter, a cell type-specific promoter, and a tissue-specific promoter.
99. The nucleic acid molecule of claim 89, wherein said nucleic acid molecules is an expression vector.
100. The nucleic acid molecule of claim 99, wherein said expression vector is selected from the group consisting of an adeno-associated viral vector, a retroviral vector, and a lentiviral vector.
101. The nucleic acid molecule of claim 95, wherein said promoter is functional in a prokaryotic cell.
102. A cell comprising: a variant Cas12f4 polypeptide of claim 1, a variant Cas12f4 fusion polypeptide of claim 60, a nucleic acid molecule encoding a variant Cas12f4 polypeptide, or a nucleic acid encoding a variant Cas12f4 fusion polypeptide.
103. The cell of claim 102, further comprising a Cas12f4 guide RNA or a nucleic acid molecule encoding a Cas12f4 guide RNA, optionally wherein the Cas12f4 guide RNA comprises a crRNA molecule comprising the polyribonucleotide sequence of SEQ ID NO: 175.
104. The cell of claim 102, wherein said cell comprises a nucleic acid molecule encoding a variant Cas12f4 polypeptide or a variant Cas12f4 fusion polypeptide, wherein said nucleic acid molecule is integrated into the genomic DNA of the cell.
105. The cell of claim 102, wherein said cell is a eukaryotic cell.
106. The cell of claim 105, wherein said eukaryotic cell is selected from the group consisting of a plant cell, a mammalian cell, an insect cell, an arachnid cell, a fungal cell, a bird cell, a reptile cell, an amphibian cell, an invertebrate cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, and a human cell.
107. The cell of claim 102, wherein said cell is a prokaryotic cell.
108. A method for modifying a target nucleic acid, the method comprising: contacting a target nucleic acid with: (a) a variant Cas12f4 polypeptide of claim 1 or a variant Cas12f4 fusion polypeptide of claim 60 and (b) a Cas12f4 guide RNA comprising a guide sequence that hybridizes to a target sequence of the target nucleic acid, wherein said contacting results in modification of the target nucleic acid by the variant Cas12f4 polypeptide or variant Cas12f4 fusion polypeptide.
109. The method of claim 108, wherein said modification comprises cleavage of the target nucleic acid.
110. The method of claim 108, wherein the target nucleic acid is selected from the group consisting of a double-stranded DNA, a single-stranded DNA, an RNA, a genomic DNA, and an extrachromosomal DNA.
111. The method of claim 108, wherein said contacting takes place in vitro outside of a cell.
112. The method of claim 108, wherein said contacting takes place inside of a cell in culture.
113. The method of claim 108, wherein said contacting takes place inside of a cell in vivo.
114. The method of claim 112, wherein the cell is a eukaryotic cell.
115. The method of claim 114, wherein the eukaryotic cell is selected from the group consisting of a plant cell, a fungal cell, a mammalian cell, a reptile cell, an insect cell, an avian cell, a fish cell, a parasite cell, an arthropod cell, a cell of an invertebrate, a cell of a vertebrate, a rodent cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, and a human cell.
116. The method of claim 112, wherein the cell is a prokaryotic cell.
117. The method of claim 108, wherein said contacting results in genome editing.
118. The method of claim 108, wherein said contacting comprises introducing into a cell: (a) a variant Cas12f4 polypeptide, a variant Cas12f4 fusion polypeptide, a nucleic acid molecule encoding a variant Cas12f4 polypeptide, or a nucleic acid molecule encoding a variant Cas12f4 fusion polypeptide; and (b) a Cas12f4 guide RNA or a nucleic acid molecule encoding a Cas12f4 guide RNA.
119. The method of claim 108, wherein the Cas12f4 guide RNA comprises a crRNA molecule comprising the polyribonucleotide sequence of SEQ ID NO: 175.
120. The method of claim 112, wherein said contacting further comprises introducing a DNA donor template into said cell.
121. The method of claim 108, wherein the Cas12f4 guide RNA is a single guide RNA.
122. The method of claim 108, wherein the Cas12f4 guide RNA comprises: (i) a targeting sequence of a variable RNA of about 20 or 21 to about 23 or 24 nucleotides at the 5 end that is complementary to an editing/cleavage target; and (ii) a crRNA of about 16, 17, or 18 to about 20 or 21 nucleotides at the 3 end that is bound by the Cas12f4 polypeptide.
123. A method for modulating transcription from a target DNA, modifying a target nucleic acid, or modifying a protein associated with a target nucleic acid, the method comprising contacting the target nucleic acid with (a) a variant Cas12f4 fusion polypeptide, which fusion polypeptide comprises a variant Cas12f4 polypeptide of any one of claims 1 to 49 fused to a heterologous polypeptide; and (b) a Cas12f4 guide RNA comprising a guide sequence that hybridizes to a target sequence of said target nucleic acid.
124. The method of claim 123, wherein the Cas12f4 guide RNA comprises a crRNA molecule comprising the polyribonucleotide sequence of SEQ ID NO: 175.
125. The method of claim 123, wherein the Cas12f4 guide RNA is a single guide RNA.
126. The method of claim 123, wherein said Cas12f4 guide RNA comprises: (i) a targeting sequence comprising a variable RNA of about 20 or 21 to about 23 or 24 nucleotides at the 5 end that is complementary to an editing/cleavage target; and (ii) a crRNA of about 16, 17, or 18 to about 20 or 21 nucleotides at the 3 end that is bound by the Cas12f4 polypeptide.
127. The method of claim 126, wherein the crRNA comprises an RNA molecule comprising the polyribonucleotide sequence of SEQ ID NO: 175.
128. The method of claim 123, wherein said modification is not cleavage of the target nucleic acid.
129. The method of claim 123, wherein the target nucleic acid is selected from the group consisting of a double stranded DNA, a single stranded DNA, an RNA, a genomic DNA, and an extrachromosomal DNA.
130. The method of claim 123, wherein said contacting takes place in vitro outside of a cell.
131. The method of claim 123, wherein said contacting takes place inside of a cell in culture.
132. The method of claim 123, wherein said contacting takes place inside of a cell in vivo.
133. The method of claim 131, wherein the cell is a eukaryotic cell.
134. The method of claim 133, wherein said eukaryotic cell is selected from the group consisting of a plant cell, a fungal cell, a mammalian cell, a reptile cell, an insect cell, an avian cell, a fish cell, a parasite cell, an arthropod cell, a cell of an invertebrate, a cell of a vertebrate, a rodent cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, or a human cell.
135. The method of claim 131, wherein the cell is a prokaryotic cell.
136. The method of claim 123, wherein said contacting comprises: introducing into a cell (a) the variant Cas12f4 fusion polypeptide or a nucleic acid molecule encoding the mutant Cas12f4 fusion polypeptide and (b) the Cas12f4 guide RNA or a nucleic acid molecule encoding the Cas12f4 guide RNA.
137. The method of claim 123, wherein the variant Cas12f4 polypeptide is catalytically inactive.
138. The method of claim 123, wherein said catalytically inactive variant Cas12f4 polypeptide comprises an amino acid substitution that decreases or inactivates the nuclease activity.
139. The method of claim 123, wherein said heterologous polypeptide exhibits an enzymatic activity that modifies a target DNA.
140. The method of claim 123, wherein said heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a nuclease activity, a methyltransferase activity, a demethylase activity, a DNA repair activity, a DNA damage activity, a deamination activity, a dismutase activity, an alkylation activity, a depurination activity, an oxidation activity, a pyrimidine dimer forming activity, an integrase activity, a transposase activity, a recombinase activity, a polymerase activity, a ligase activity, a helicase activity, a photolyase activity, and a glycosylase activity.
141. The method of claim 123, wherein said heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a nuclease activity, a methyltransferase activity, a demethylase activity, a deamination activity, a depurination activity, an integrase activity, a transposase activity, and a recombinase activity.
142. The method of claim 123, wherein said heterologous polypeptide exhibits an enzymatic activity that modifies a target polypeptide associated with a target nucleic acid.
143. The method of claim 123, wherein said heterologous polypeptide exhibits histone modification activity.
144. The method of claim 123, wherein the heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a methyltransferase activity, a demethylase activity, an acetyltransferase activity, a deacetylase activity, a kinase activity, a phosphatase activity, a ubiquitin ligase activity, a deubiquitinating activity, an adenylation activity, a deadenylation activity, a SUMOylating activity, a deSUMOylating activity, a ribosylation activity, a deribosylation activity, a myristoylation activity, a demyristoylation activity, a glycosylation activity (e.g., from O-GlcNAc transferase), and a deglycosylation activity.
145. The method of claim 123, wherein said heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a methyltransferase activity, a demethylase activity, an acetyltransferase activity, and a deacetylase activity.
146. The method of claim 123, wherein said heterologous polypeptide is a protein that increases or decreases transcription of a gene when the mutant Cas12f4 fusion polypeptide is bound to the gene and a guide RNA.
147. The method of claim 123, wherein said heterologous polypeptide comprises a transcriptional repressor domain.
148. The method of claim 123, wherein said heterologous polypeptide comprises a transcriptional activation domain.
149. The method of claim 123, wherein said heterologous polypeptide comprises a protein binding domain.
150. A transgenic, multicellular, non-human organism comprising a transgene comprising a nucleotide sequence encoding: (a) a variant Cas12f4 polypeptide of claim 1 or a variant Cas12f4 fusion polypeptide of claim 60 and, optionally, (b) a Cas12f4 guide RNA.
151. The transgenic, multicellular, non-human organism of claim 150, wherein the variant Cas12f4 polypeptide is catalytically inactive or wherein the variant Cas12f4 fusion polypeptide comprises a dCas12f4 polypeptide.
152. The transgenic, multicellular, non-human organism of claim 150, wherein the variant Cas12f4 polypeptide comprises an amino acid substitution that decreases or inactivates the Cas12f4 nuclease activity.
153. The transgenic, multicellular, non-human organism of claim 150, wherein the organism is selected from the group consisting of a plant, a monocotyledon plant, a dicotyledon plant, an invertebrate animal, an insect, an arthropod, an arachnid, a parasite, a worm, a cnidarian, a vertebrate animal, a fish, a reptile, an amphibian, an ungulate, a bird, a pig, a horse, a sheep, a rodent, a mouse, a rat, and a non-human primate.
154. A system comprising a combination of components selected from the group consisting of (a) a variant Cas12f4 polypeptide of claim 1 and a Cas12f4 single guide RNA; (b) a variant Cas12f4 polypeptide of claim 1, a Cas12f4 guide RNA, and a DNA donor template; (c) a variant Cas12f4 fusion polypeptide of claim 60 and a Cas12f4 guide RNA; (d) a variant Cas12f4 fusion polypeptide of claim 60, a Cas12f4 guide RNA, and a DNA donor template; (e) an mRNA encoding a variant Cas12f4 polypeptide of claim 1 and a Cas12f4 single guide RNA; (d) an mRNA encoding a variant Cas12f4 polypeptide of claim 1, a Cas12f4 guide RNA, and a DNA donor template; (g) an mRNA encoding a variant Cas12f4 fusion polypeptide of any one of claims 60 to 78 and a Cas12f4 guide RNA; (h) an mRNA encoding the mutant Cas12f4 fusion polypeptide of any one of claims 60 to 78, a Cas12f4 guide RNA, and a DNA donor template; (i) an expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of claim land a nucleotide sequence encoding a Cas12f4 guide RNA; (f) an expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of claim 1, a nucleotide sequence encoding a Cas12f4 guide RNA, and a DNA donor template; (k) an expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of claim 60 and a nucleotide sequence encoding a Cas12f4 guide RNA; and (l) an expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of claim 60, a nucleotide sequence encoding a Cas12f4 guide RNA, and a DNA donor template.
155. The system of claim 154, wherein the Cas12f4 guide RNA or Cas12f4 single gRNA comprises a crRNA and a spacer RNA; optionally wherein the crRNA molecule comprises the polyribonucleotide sequence of SEQ ID NO: 175.
156. The composition of claim 50, wherein the DNA donor template has a length of 8 nucleotides to 1000 nucleotides or 8 base pairs to 1000 base pairs; or wherein the DNA donor template has a length of 25 nucleotides to 500 nucleotides or 25 base pairs to 500 base pairs.
Description
DETAILED DESCRIPTION
[0015] In certain embodiments, the present disclosure provides variant Cas12f4 polypeptides and proteins and variant Cas12f4 fusion proteins comprising variant Cas12f4 polypeptides and proteins that include one or more amino acid substitution and/or insertion in the wild-type Cas12f4 polypeptide or protein, which desirably exhibit altered and/or improved functionality relative to the wild-type Cas12f4 polypeptide or protein.
[0016] This disclosure will be better understood in view of the following definitions, which are provided for clarification and are not intended to limit the scope of the subject matter that is disclosed herein.
Definitions
[0017] As used herein, the term CRISPR refers to Clustered Regularly Interspaced Short Palindromic Repeats. CRISPR and CRISPR-associated (Cas) genes, are collectively referred to as CRISPR-Cas or CRISPR/Cas systems, which are adaptive immune systems in archaea and bacteria that defend particular species against foreign genetic elements.
[0018] As used herein, the terms RNA guide, gRNA, or RNA guide sequence refer to any RNA molecule that facilitates the targeting of a polypeptide described herein to a target nucleic acid. For example, an RNA guide can be a molecule that recognizes (e.g., binds to) a target nucleic acid. An RNA guide may be designed to be complementary to a specific nucleic acid sequence. An RNA guide comprises a DNA targeting sequence (also referred to herein as a spacer sequence), and a crRNA sequence (also referred to as a direct repeat (DR) sequence) that facilitates binding of the RNA guide to a Cas12f4 polypeptide or a Cas12f4 variant polypeptide provided herein. An example of a crRNA sequence recognized (e.g., bound) by a Cas12f4 polypeptide or a Cas12f4 variant polypeptide is AGAAAAUGUGUCAUACUACGACAC (SEQ ID NO: 175).
[0019] As used herein, the terms target nucleic acid, target sequence, and target substrate refer to a nucleic acid to which an RNA guide specifically binds. In some embodiments, the DNA targeting sequence (i.e. a spacer sequence) of an RNA guide binds to a target nucleic acid.
[0020] As used herein, the term protospacer adjacent motif or PAM refers to a DNA sequence adjacent to a target sequence to which a complex comprising an effector (e.g., a CRISPR nuclease) and an RNA guide binds. In some embodiments, a PAM is required for enzyme activity. As used herein, the term adjacent includes instances in which an RNA guide of the complex specifically binds, interacts, or associates with a target sequence that is immediately adjacent to a PAM. In such instances, there are no nucleotides between the target sequence and the PAM. The term adjacent also includes instances in which there are a small number (e.g., 1, 2, 3, 4, or 5) of nucleotides between the target sequence, to which the RNA guide binds, and the PAM.
[0021] As used herein, the term complex refers to a grouping of two or more molecules. In some embodiments, the complex comprises a polypeptide and a nucleic acid molecule interacting with (e.g., binding to, coming into contact with, adhering to) one another.
[0022] As used herein, the term binary complex refers to a grouping of two molecules (e.g., a polypeptide and a nucleic acid molecule). In some embodiments, a binary complex refers to a grouping of a polypeptide and a targeting moiety (e.g., an RNA guide). In some embodiments, a binary complex refers to a ribonucleoprotein (RNP). As used herein, the term variant binary complex refers to the grouping of a variant polypeptide and RNA guide. As used herein, the term parent binary complex refers to the grouping of a parent polypeptide and RNA guide or a reference polypeptide and RNA guide.
[0023] As used herein, the term ternary complex refers to a grouping of three molecules (e.g., a polypeptide and two nucleic acid molecules). In some embodiments, a ternary complex refers to a grouping of a polypeptide, an RNA molecule, and a DNA molecule. In some embodiments, a ternary complex refers to a grouping of a polypeptide, a targeting moiety (e.g., an RNA guide), and a target nucleic acid (e.g., a target DNA molecule). In some embodiments, a ternary complex refers to a grouping of a binary complex (e.g., a ribonucleoprotein) and a third molecule (e.g., a target nucleic acid).
[0024] As used herein, the phrase DNA donor template refers to a DNA molecule having homology to the target editing site. DNA donor template molecules can be used to edit a target editing site in a genome by homology-directed repair.
[0025] The terms polynucleotide and nucleic acid, used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxynucleotides. Thus, this term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases. The terms polynucleotide and nucleic acid should be understood to include, as applicable to the embodiment being described, single-stranded (such as sense or antisense) and double-stranded polynucleotides.
[0026] As used herein, the terms polypeptide, peptide, and protein are used interchangeably and refer to a polymeric form of amino acids of any length, which can include genetically coded and non-genetically coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones. The term includes fusion proteins, including, but not limited to, fusion proteins with a heterologous amino acid sequence, fusions with heterologous and homologous leader sequences, with or without N-terminal methionine residues; immunologically tagged proteins; and the like.
[0027] As used herein, the term conservative amino acid substitution refers to the interchangeability in proteins of amino acid residues having similar side chains. For example, a group of amino acids having aliphatic side chains consists of glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains consists of serine and threonine; a group of amino acids having amide-containing side chains consists of asparagine and glutamine; a group of amino acids having aromatic side chains consists of phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains consists of lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains consists of cysteine and methionine. Exemplary conservative amino acid substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine.
[0028] As used herein, the terms variant polypeptide, variant effector polypeptide, and variant CRISPR nuclease polypeptide refer to polypeptides comprising a substitution, insertion, deletion, addition, and/or fusion, at one or more residue positions, compared to a parent polypeptide, in particular to the wild-type Cas12f4 polypeptide of SEQ ID NO: 1.
[0029] As used herein, the terms reference composition, reference molecule, reference sequence, and reference refer to a control, such as a negative control or a parent (e.g., a parent sequence, a parent protein, or a wild-type protein). For example, a reference molecule refers to a polypeptide to which a variant polypeptide is compared. Likewise, a reference RNA guide refers to a targeting moiety to which a modified RNA guide is compared. The variant or modified molecule may be compared to the reference molecule on the basis of sequence (e.g., the variant or modified molecule may have X % sequence identity or homology with the reference molecule), thermostability, or activity (e.g., the variant or modified molecule may have X % of the activity of the reference molecule). For example, a variant or modified molecule may be characterized as having no more than 10% of an activity of the reference polypeptide or may be characterized as having at least 10% greater of an activity of the reference polypeptide. Examples of reference polypeptides include naturally occurring unmodified polypeptides, e.g., naturally occurring polypeptides from archaea or bacterial species. In certain embodiments, the reference polypeptide is a naturally occurring polypeptide having the closest sequence identity or homology with the variant polypeptide to which it is being compared. In certain embodiments, the reference polypeptide is a parental molecule having a naturally occurring or known sequence on which a mutation has been made to arrive at the variant polypeptide.
[0030] For purposes of this disclosure, the correspondence of an amino acid residue of a candidate Cas12f4 sequence (i.e. a Cas12f4 other than already disclosed in the representative Cas12f4 polypeptides of SEQ ID NOs: 2-162) to an amino acid position of the Cas12f4 consensus sequence of SEQ ID NO: 1 (i.e. corresponding to) is determined as follows: (i) one sequence from the group of representative Cas12f4 polypeptides (SEQ ID NOs: 2-162) is identified as the closest match to the candidate Cas12f4 sequence (e.g., giving the lowest e-value of a BLAST search of the group using the candidate sequence as a query); and (ii) this closest matched identified sequence is aligned to the candidate sequence using a pairwise alignment algorithm (e.g., CLUSTAL O 1.2.4 with default parameters), thus matching the candidate Cas12f4 amino acid residue positions to the closest match sequence positions. An amino acid residue of the candidate Cas12f4 polypeptide corresponds to the SEQ ID NO: 1 consensus sequence position to which its closest matched identified Cas12f4 polypeptide sequence position aligns to SEQ ID NO: 1
[0031] As used herein, the term domain refers to a distinct functional and/or structural unit of a polypeptide. In some embodiments, a domain may comprise a conserved amino acid sequence.
[0032] As used herein, the term enzymatic activity refers to the catalytic ability of a polypeptide, e.g., a variant polypeptide relative to a parent polypeptide. In some embodiments, enzymatic activity refers to nuclease activity, e.g., the ability of a polypeptide to cleave a nucleic acid such as a target nucleic acid. In some embodiments, enzymatic activity refers to the ability of a polypeptide to introduce an alteration (e.g., an insertion, substitution, and/or deletion) into a nucleic acid such as a target nucleic acid.
[0033] Heterologous, as used herein, means a nucleotide or polypeptide sequence that is not found in the native nucleic acid or protein, respectively. For example, relative to a Cas12f4 polypeptide, a heterologous polypeptide comprises an amino acid sequence from a protein other than the Cas12f4 polypeptide. In some embodiments, a portion of a Cas12f4 polypeptide from one species is fused to a portion of a Cas polypeptide from a different species. The Cas sequence from each species could therefore be considered to be heterologous relative to one another. As another example, a Cas12f4 polypeptide (e.g., a dCas12f4 polypeptide) can be fused to an active domain from a non-Cas12f4 polypeptide (e.g., a histone deacetylase), and the sequence of the active domain could be considered a heterologous polypeptide (it is heterologous to the Cas12f4 polypeptide).
[0034] The phrase Cas12f4 fusion polypeptide and variant Cas12f4 fusion polypeptide as used herein refers to a polypeptide comprising a Cas12f4 polypeptide or a variant Cas12f4 polypeptide fused to a heterologous polypeptide. In certain embodiments, the Cas12f4 polypeptide or the variant Cas12f4 polypeptide is operably linked to the heterologous polypeptide in the Cas12f4 or variant Cas12f4 fusion polypeptide.
[0035] A polynucleotide or polypeptide has a certain percent sequence identity to another polynucleotide or polypeptide, meaning that, when aligned, that percentage of bases or amino acids are the same, and in the same relative position, when comparing the two sequences. Sequence similarity can be determined in a number of different manners. To determine sequence identity, sequences can be aligned using the methods and computer programs, including BLAST, available over the world wide web at ncbi.nlm.nih.gov/BLAST. See, e.g., Altschul et al. (1990),/. Mol. Biol. 215:403-10. Another alignment algorithm is FASTA, available in the Genetics Computing Group (GCG) package, from Madison, Wisconsin, USA, a wholly owned subsidiary of Oxford Molecular Group, Inc. Other techniques for alignment are described in Methods in Enzymology, vol. 266: Computer Methods for Macromolecular Sequence Analysis (1996), ed. Doolittle, Academic Press, Inc., a division of Harcourt Brace & Co., San Diego, California, USA. Of particular interest are alignment programs that permit gaps in the sequence. The Smith-Waterman is one type of algorithm that permits gaps in sequence alignments. See Meth. Mol. Biol. 70:173-187 (1997). Also, the GAP program using the Needleman and Wunsch alignment method can be utilized to align sequences. See/. Mol. Biol. 48:443-453 (1970).
[0036] The term naturally-occurring as used herein as applied to a nucleic acid, a protein, a cell, or an organism, refers to a nucleic acid, cell, protein, or organism that is found in nature.
[0037] As used herein the term isolated is meant to describe a polynucleotide, a polypeptide, or a cell that is in an environment different from that in which the polynucleotide, the polypeptide, or the cell naturally occurs. An isolated genetically modified host cell may be present in a mixed population of genetically modified host cells.
[0038] As used herein, the term exogenous nucleic acid refers to a nucleic acid that is not normally or naturally found in and/or produced by a given bacterium, organism, or cell in nature. As used herein, the term endogenous nucleic acid refers to a nucleic acid that is normally found in and/or produced by a given bacterium, organism, or cell in nature. An endogenous nucleic acid is also referred to as a native nucleic acid or a nucleic acid that is native to a given bacterium, organism, or cell.
[0039] Recombinant, as used herein, means that a particular nucleic acid (DNA or RNA) is the product of various combinations of cloning, restriction, and/or ligation steps resulting in a construct having a structural coding or non-coding sequence distinguishable from endogenous nucleic acids found in natural systems. Generally, DNA sequences encoding the structural coding sequence can be assembled from cDNA fragments and short oligonucleotide linkers, or from a series of synthetic oligonucleotides, to provide a synthetic nucleic acid which is capable of being expressed from a recombinant transcriptional unit contained in a cell or in a cell-free transcription and translation system. Such sequences can be provided in the form of an open reading frame uninterrupted by internal non-translated sequences, or introns, which are typically present in eukaryotic genes. Genomic DNA comprising the relevant sequences can also be used in the formation of a recombinant gene or transcriptional unit. Sequences of non-translated DNA may be present 5 or 3 from the open reading frame, where such sequences do not interfere with manipulation or expression of the coding regions, and may indeed act to modulate production of a desired product by various mechanisms (see DNA regulatory sequences, below).
[0040] Thus, e.g., the term recombinant polynucleotide or recombinant nucleic acid refers to one which is not naturally-occurring, e.g., is made by the artificial combination of two otherwise separated segments of sequence through human intervention. This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques. Such is usually done to replace a codon with a redundant codon encoding the same or a conservative amino acid, while typically introducing or removing a sequence recognition site. Alternatively, it is performed to join together nucleic acid segments of desired functions to generate a desired combination of functions.
[0041] Similarly, the term recombinant polypeptide refers to a polypeptide which is not naturally-occurring, e.g., is made by the artificial combination of two otherwise separated segments of amino sequence through human intervention. Thus, e.g., a polypeptide that comprises a heterologous amino acid sequence is recombinant.
[0042] By construct or vector is meant a recombinant nucleic acid, generally recombinant DNA, which has been generated for the purpose of the expression and/or propagation of a specific nucleotide sequence(s), or is to be used in the construction of other recombinant nucleotide sequences.
[0043] The terms DNA regulatory sequences, control elements, and regulatory elements, used interchangeably herein, refer to transcriptional and translational control sequences, such as promoters, enhancers, polyadenylation signals, terminators, protein degradation signals, and the like, that provide for and/or regulate expression of a coding sequence and/or production of an encoded polypeptide in a host cell.
[0044] The term transformation is used interchangeably herein with genetic modification and refers to a permanent or transient genetic change induced in a cell following introduction of new nucleic acid (e.g., DNA exogenous to the cell) into the cell. Genetic change (modification) can be accomplished either by incorporation of the new nucleic acid into the genome of the host cell, or by transient or stable maintenance of the new nucleic acid as an episomal element. Where the cell is a eukaryotic cell, a permanent genetic change is generally achieved by introduction of new DNA into the genome of the cell. In prokaryotic cells, permanent changes can be introduced into the chromosome or via extrachromosomal elements such as plasmids and expression vectors, which may contain one or more selectable markers to aid in their maintenance in the recombinant host cell. Suitable methods of genetic modification include viral infection, transfection, conjugation, protoplast fusion, electroporation, particle gun technology, calcium phosphate precipitation, direct microinjection, and the like. The choice of method is generally dependent on the type of cell being transformed and the circumstances under which the transformation is taking place (e.g., in vitro, ex vivo, or in vivo). A general discussion of these methods can be found in Ausubel, et al, Short Protocols in Molecular Biology, 3rd ed., Wiley & Sons, 1995.
[0045] Operably linked refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner. For instance, a promoter is operably linked to a coding sequence if the promoter affects its transcription or expression. As used herein, the terms heterologous promoter and heterologous control regions refer to promoters and other control regions that are not normally associated with a particular nucleic acid in nature. For example, a transcriptional control region heterologous to a coding region is a transcriptional control region that is not normally associated with the coding region in nature.
[0046] A host cell, as used herein, denotes an in vivo or in vitro eukaryotic cell, a prokaryotic cell, or a cell from a multicellular organism (e.g., a cell line) cultured as a unicellular entity, which eukaryotic or prokaryotic cells can be, or have been, used as recipients for a nucleic acid (e.g., an expression vector), and include the progeny of the original cell which has been genetically modified by the nucleic acid. It is understood that the progeny of a single cell may not necessarily be completely identical in morphology or in genomic or total DNA complement as the original parent, due to natural, accidental, or deliberate mutation. A recombinant host cell (also referred to as a genetically modified host cell) is a host cell into which has been introduced a heterologous nucleic acid, e.g., an expression vector. For example, a subject prokaryotic host cell is a genetically modified prokaryotic host cell (e.g., a bacterium), by virtue of introduction into a suitable prokaryotic host cell of a heterologous nucleic acid, e.g., an exogenous nucleic acid that is foreign to (not normally found in nature in) the prokaryotic host cell, or a recombinant nucleic acid that is not normally found in the prokaryotic host cell; and a subject eukaryotic host cell is a genetically modified eukaryotic host cell, by virtue of introduction into a suitable eukaryotic host cell of a heterologous nucleic acid, e.g., an exogenous nucleic acid that is foreign to the eukaryotic host cell, or a recombinant nucleic acid that is not normally found in the eukaryotic host cell.
[0047] As used herein, the terms treatment, treating, and the like, refer to obtaining a desired trait, pharmacologic and/or physiologic effect. The effect can be to confer a desired trait (e.g., improved yield, resistance to insects, fungi, bacterial pathogens, and/or nematodes, herbicide tolerance, abiotic stress tolerance (e.g., drought, cold, salt, and/or heat tolerance)), protein quantity and/or quality, starch quantity and/or quality, lipid quantity and/or quality, secondary metabolite quantity and/or quality, and the like, all in comparison to a control plant that lacks the modification. The effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease. Treatment, as used herein, covers any treatment of a disease in a plant or mammal, e.g., in a human, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, e.g., arresting its development; and (c) relieving the disease, e.g., causing regression of the disease.
[0048] The terms individual, subject, host, and patient, used interchangeably herein, refer to an individual organism, e.g., a mammal, including, but not limited to, murines, simians, humans, mammalian farm animals, mammalian sport animals, and mammalian pets.
[0049] Unless specifically defined otherwise herein, each term used in this disclosure has the same meaning as it would to those having skill in the relevant art. It will be understood that this disclosure is not limited to the exemplary embodiments described herein and that the scope of the present disclosure is reflected in the appended claims.
Variant Cas12f4 RNA-Guided Endonuclease Polypeptides and Proteins
[0050] Provided herein are variant RNA-guided endonuclease polypeptides and proteins that exhibit unexpected and surprising advantages over variant RNA-guided endonuclease polypeptides and variant RNA-guided DNA binding proteins that are currently available in the art. Variant RNA-guided endonuclease polypeptides and proteins disclosed herein include variant Cas12f4 polypeptides and proteins as well as fusion proteins comprising variant Cas12f4 polypeptides and proteins. In certain embodiments, variant Cas12f4 polypeptides comprise an amino acid substitution of the wild-type amino acid residue at the position of the variant Cas12f4 polypeptide corresponding to an amino acid position of the Cas12f4 wild-type sequence of SEQ ID NO: 1. In certain embodiments, the variant Cas12f4 polypeptide has at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, or 99% sequence identity to any one of SEQ ID NOs: 1-162.
[0051] Also provided herein are nucleic acids encoding variant Cas12f4 polypeptides and modified host cells that express variant Cas12f4 polypeptides and/or nucleic acids, guide RNAs (referred to herein as Cas12f4 guide RNAs) that bind to and provide sequence specificity to the wild-type and variant Cas12f4 proteins; nucleic acids encoding Cas12f4 guide RNAs; and modified host cells comprising the Cas12f4 guide RNAs and/or nucleic acids encoding same.
[0052] A CRISPR/Cas endonuclease (e.g., a Cas12f4 polypeptide, wild-type or a mutant disclosed herein) interacts with (binds to) a corresponding guide RNA (e.g., a Cas12f4 guide RNA) to form a ribonucleoprotein (RNP) complex that is targeted to a particular site in a target nucleic acid via base pairing between the guide RNA and a target sequence within the target nucleic acid molecule. A guide RNA includes a nucleotide sequence (a guide sequence) that is complementary to a sequence (the target site) of a target nucleic acid. Thus, a Cas12f4 polypeptide forms a complex with a Cas12f4 guide RNA and the guide RNA provides sequence specificity to the RNP complex via the guide sequence. The Cas12f4 polypeptide of the complex provides the site-specific activity. Thus, the Cas12f4 polypeptide is guided to a target site (e.g., stabilized at a target site) within a target nucleic acid sequence (e.g., a chromosomal sequence or an extrachromosomal sequence, e.g., an episomal sequence, a minicircle sequence, a mitochondrial sequence, a chloroplast sequence, etc.) by virtue of its association with the guide RNA.
[0053] Exemplary variant Cas12f4 RNA-guided endonuclease polypeptides and proteins are presented in Table 1, which shows amino acid substitutions or insertions relative to the wild-type Cas12f4 amino acid sequence (SEQ ID NO: 1), identifies amino acid residues that are substituted into the position in place of the wild-type residue, and describes altered functionalities of the variant Cas12f4 polypeptides that are attributable to modifications in the activities of the various Cas12f4 functional domains.
TABLE-US-00001 TABLE 1 Cas12f4 Variant Polypeptides Sequence Identifier Amino Acid Substitution Description.sup.1 SEQ ID NO: 1 Wild-type Cas12f4 variants disclosed herein comprise one or more amino acid substitutions, insertions, and/or deletions relative to the wild-type Cas12f4 amino acid sequence (SEQ ID NO: 1) Cas12f4 WED-I Domain Variants at Amino Acids 1-14 SEQ ID NO: 2 R8L Cas12f4 WED-I domain variants at amino acids 1-14 include Cas12f4 variants at R8 that, individually or in various combination with other Cas12f4 variants, can alter Cas12f4 functionality Cas12f4 Helical-I Domain Variants at Amino Acids 15-178 SEQ ID NO: 3 H39F Cas12f4 Helical-I domain variants at SEQ ID NO: 4 R40H amino acids 15-178 include Cas12f4 SEQ ID NO: 5 F51Y variants at H39, R40, F51, D62, V67, F70, SEQ ID NO: 6 D62P S84, N110, M125, S145, Y150, W159, SEQ ID NO: 7 V67I D166, W170, and G171 that, individually SEQ ID NO: 8 F70Y or in various combination with other SEQ ID NO: 9 S84R Cas12f4 variants, can alter genome editing SEQ ID NO: 10 N110I by, in some aspects, affecting delivery SEQ ID NO: 11 M125K vector packing SEQ ID NO: 12 S145E SEQ ID NO: 13 Y150F SEQ ID NO: 14 W159V SEQ ID NO: 15 D166P SEQ ID NO: 16 W170Y SEQ ID NO: 17 W170N SEQ ID NO: 18 W170K SEQ ID NO: 19 G171R SEQ ID NO: 20 G171K SEQ ID NO: 21 G171A SEQ ID NO: 22 G171N Cas12f4 PI Domain Variants at Amino Acids 179-271 SEQ ID NO: 23 E179R Cas12f4 PI domain variants at amino SEQ ID NO: 24 E179K acids 179-271 include Cas12f4 variants at SEQ ID NO: 25 E179H E179 that can alter DNA-binding affinity and/or specificity, and, in some aspects, can alter R-loop lifetime by, for example, substituting an anionic nucleotide- contacting amino acid with a cationic amino acid SEQ ID NO: 26 E183Q Cas12f4 PI domain variants at amino SEQ ID NO: 27 E183K acids 179-271 include Cas12f4 variants at SEQ ID NO: 28 E183R E183 that can alter substrate affinity and/or protein stability by, in some aspects, substituting a sterically and/or chemically similar amino acid SEQ ID NO: 29 K188R Cas12f4 PI domain variants at amino SEQ ID NO: 30 Y207W acids 179-271 include Cas12f4 variants at SEQ ID NO: 31 H223W K188, Y207, and/or H223 that, SEQ ID NO: 32 H223L individually or in various combination SEQ ID NO: 33 H223Q with other Cas12f4 variants, can alter DNA-binding affinity and/or specificity SEQ ID NO: 176 K228R Cas 12f4 PI domain variants at amino SEQ ID NO: 34 D233X acids 179-271 include Cas12f4 variants at SEQ ID NO: 35 S234X one or more of amino acids K228, D233, SEQ ID NO: 36 T235X S234, T235, G236, and/or R237, which SEQ ID NO: 37 G236X amino acids comprise or constitute a SEQ ID NO: 38 R237X DSTGR loop that projects into the PAM-adjacent major groove, to alter DNA-binding affinity and/or specificity SEQ ID NO: 39 Y241F Cas12f4 PI domain variants at amino SEQ ID NO: 40 K245R acids 179-271 include Cas12f4 variants at SEQ ID NO: 41 L252E Y241, K245, L252, and/or M253 that, SEQ ID NO: 42 M253E individually or in various combination with other Cas12f4 variants, can alter DNA-binding affinity and/or specificity Cas12f4 Helical-I Domain Variants at Amino Acids 272-328 SEQ ID NO: 43 Y283W Cas12f4 Helical-I domain variants at amino acids 272-328 include Cas12f4 variants at Y283 that, individually or in various combination with other Cas12f4 variants, can alter DNA-binding affinity and/or specificity SEQ ID NO: 44 N295X Cas12f4 Helical-I domain variants at amino acids 272-328 include Cas12f4 variants at N295 that, individually or in various combination with other Cas12f4 variants, can alter DNA-binding affinity and/or specificity by, for example, affecting interactions with the PAM- adjacent major groove SEQ ID NO: 45 A305M Cas12f4 Helical-I domain variants at amino acids 272-328 include Cas12f4 variants at N295 that, individually or in various combination with other Cas12f4 variants, can alter DNA-binding affinity and/or specificity by, for example, affecting interactions with the adjacent BB and, thereby, alleviate clash SEQ ID NO: 46 F323Y Cas12f4 Helical-I domain variants at amino acids 272-328 include Cas12f4 variants at F323 that, individually or in various combination with other Cas12f4 variants, can alter DNA-binding affinity and/or specificity Cas12f4 Helical-II Domain Variants at Amino Acids 329-449 SEQ ID NO: 47 F347Y Cas12f4 Helical-II domain variants at SEQ ID NO: 48 F347L amino acids 329-449 include Cas12f4 SEQ ID NO: 49 H352Y variants at F347, H352, K353, and/or SEQ ID NO: 50 K353W V359 that, individually or in various SEQ ID NO: 51 V359T combination with other Cas12f4 variants, can alter interactions with the crRNA within the Cas12f4 heteroduplex SEQ ID NO: 52 E363R Cas12f4 Helical-II domain variants at amino acids 329-449 include Cas12f4 variants at E363 that, individually or in various combination with other Cas12f4 variants, can alter interactions with the crRNA within the Cas12f4 heteroduplex and, in certain aspects, can alleviate clashes with K404 SEQ ID NO: 53 F367V Cas12f4 Helical-II domain variants at SEQ ID NO: 54 N368T amino acids 329-449 include Cas12f4 SEQ ID NO: 55 N369P variants at F367, N368, and N369 that, individually or in various combination with other Cas12f4 variants, can alter interactions with the crRNA within the Cas12f4 heteroduplex and, in certain aspects, can affect Cas12f4 conformation by eliminating a polar contact SEQ ID NO: 56 A375E Cas12f4 Helical-II domain variants at SEQ ID NO: 57 A384G amino acids 329-449 include Cas12f4 SEQ ID NO: 58 V394I variants at A375, A384, V394, and I403 SEQ ID NO: 59 I403L that, individually or in various combination with other Cas12f4 variants, can alter interactions with the crRNA within the Cas12f4 heteroduplex SEQ ID NO: 60 K404X Cas12f4 Helical-II domain variants at amino acids 329-449 include Cas12f4 variants at K404 that, individually or in various combination with other Cas12f4 variants, can alter interactions with the crRNA within the Cas12f4 heteroduplex and, in certain aspects, can alleviate clashes with E363 SEQ ID NO: 61 E412K Cas12f4 Helical-II domain variants at SEQ ID NO: 62 V419I amino acids 329-449 include Cas12f4 SEQ ID NO: 63 V427M variants at E412, V419, V427, and/or SEQ ID NO: 64 V427C S433 that, individually or in various SEQ ID NO: 65 S433V combination with other Cas12f4 variants, can alter interactions with the crRNA within the Cas12f4 heteroduplex SEQ ID NO: 66 T445V Cas12f4 Helical-II domain variants at SEQ ID NO: 67 T445Y amino acids 329-449 include Cas12f4 SEQ ID NO: 68 E447L variants at T445 and/or E447 that, individually or in various combination with other Cas12f4 variants, can reduce Cas12f4 DNA-binding affinity by, for example, altering Cas12f4 DNA presentation and/or interaction with the PAM minor groove SEQ ID NO: 69 C448K Cas12f4 Helical-II domain variants at SEQ ID NO: 70 C448R amino acids 329-449 include Cas12f4 SEQ ID NO: 71 C448X variants at C448 that, individually or in various combination with other Cas12f4 variants, can provide productive interactions with BPs and BB to, thereby, reduce Cas12f4 DNA-binding affinity, Cas12f4 DNA presentation and/or Cas12f4 interaction with the PAM minor groove Cas12f4 WED-II Domain Variants at Amino Acids 450-605 SEQ ID NO: 72 S470D Cas12f4 WED-II domain variants at amino acids 450-605 include Cas12f4 variants at S470 that, individually or in various combination with other Cas12f4 variants, which in some aspects are Cas12f4 variants at K471 and K472, can reduce Cas12f4 DNA-binding affinity and nonspecific DNA recognition by altering Cas12f4 DNA presentation and, in certain aspects, placing a negative charge at the DNA backbone and/or altering a DNA contact adjacent to PAM SEQ ID NO: 73 K471X Cas12f4 WED-II domain variants at SEQ ID NO: 74 K472X amino acids 450-605 include Cas12f4 variants at K471 and/or K472 that, individually or in various combination with other Cas12f4 variants, including a Cas12f4 variant at S470, can reduce Cas12f4 DNA-binding affinity and nonspecific DNA recognition by altering Cas12f4 DNA presentation and, in certain aspects, placing a negative charge at the DNA backbone and/or altering a DNA contact adjacent to PAM SEQ ID NO: 75 A474K Cas12f4 WED-II domain variants at SEQ ID NO: 76 V476K amino acids 450-605 include Cas12f4 variants at A474 and/or V476 that, individually or in various combination with other Cas12f4 variants, can reduce Cas12f4 DNA-binding affinity and/or nonspecific DNA recognition by altering a nonspecific DNA contact SEQ ID NO: 77 E479T Cas12f4 WED-II domain variants at amino acids 450-605 include Cas12f4 variants at E479 that, in some aspects, replace a negative charge near DNA with a polar uncharged amino acid to, thereby, affect nonspecific DNA recognition and/or alter a nonspecific DNA contact SEQ ID NO: 78 G481K Cas12f4 WED-II domain variants at SEQ ID NO: 79 G481N amino acids 450-605 include Cas12f4 SEQ ID NO: 80 E494T variants at G481 and/or E494 that, SEQ ID NO: 81 E494Q individually or in various combination SEQ ID NO: 82 E494N with other Cas12f4 variants, can alter Cas12f4 DNA-binding affinity and/or nonspecific DNA recognition by, in some aspects, affecting a nonspecific DNA contact SEQ ID NO: 83 E504K Cas12f4 WED-II domain variants at SEQ ID NO: 84 E504R amino acids 450-605 include Cas12f4 variants at E504 that, individually or in various combination with other Cas12f4 variants, can alter Cas12f4 DNA-binding affinity and/or nonspecific DNA recognition and, in some aspects, stabilize interaction during cleavage or complexing SEQ ID NO: 85 T505K Cas12f4 WED-II domain variants at amino acids 450-605 include Cas12f4 variants at T505 that, individually or in various combination with other Cas12f4 variants, can alter Cas12f4 DNA-binding affinity and/or nonspecific DNA recognition by affecting a PAM contact SEQ ID NO: 86 H507R Cas12f4 WED-II domain variants at SEQ ID NO: 87 K514R amino acids 450-605 include Cas12f4 SEQ ID NO: 88 E517R variants at H507, K514, E517, V532, SEQ ID NO: 89 E517Q L536, C567, and/or N586 that, SEQ ID NO: 90 V532I individually or in various combination SEQ ID NO: 91 L536F with other Cas12f4 variants, can alter SEQ ID NO: 92 L536K Cas12f4 DNA-binding affinity and/or SEQ ID NO: 93 L536R nonspecific DNA recognition by altering a SEQ ID NO: 94 C567R nonspecific DNA contact SEQ ID NO: 95 N586R Cas12f4 RuvC-I Domain Variants at Amino Acids 606-656 SEQ ID NO: 96 D619A Cas12f4 RuvC-I domain variants at amino SEQ ID NO: 97 F644Y acids 606-656 include Cas12f4 variants at SEQ ID NO: 98 F651M D619, F644, and/or F651 that, individually or in various combination with other Cas12f4 variants, can alter RuvC catalytic activity (e.g., cleavage of a DNA target by the Cas12f4 variant) Cas12f4 Helical-III Domain Variants at Amino Acids 657-794 SEQ ID NO: 99 L662R Cas12f4 Helical-III domain variants at SEQ ID NO: 100 L662K amino acids 657-794 include Cas12f4 SEQ ID NO: 101 L662H variants at L662, H674, N673, 1682, F695, SEQ ID NO: 102 N673S H702, A717, W764, T766, G771, and/or SEQ ID NO: 103 H674Y E788 that, individually or in various SEQ ID NO: 104 I682S combination with other Cas12f4 variants, SEQ ID NO: 105 F695L can alter crRNA interactions and/or RuvC SEQ ID NO: 106 H702N catalytic activity (e.g., cleavage of a DNA SEQ ID NO: 107 H702K target by the Cas 12f4 variant) SEQ ID NO: 108 H702R SEQ ID NO: 109 701-702 ins SEQ ID NO: 110 A717V SEQ ID NO: 111 A717L SEQ ID NO: 112 W764R SEQ ID NO: 113 T766H SEQ ID NO: 114 G771E SEQ ID NO: 115 E788T Cas12f4 BH Domain Variants at Amino Acids 795-836 SEQ ID NO: 116 F800Y Cas12f4 BH domain variants at amino SEQ ID NO: 117 A805E acids 795-836 include Cas12f4 variants at SEQ ID NO: 118 S811R F800, A805, S811, K813, R814, E815, SEQ ID NO: 119 K813R L825, T827, and/or Q830 that, SEQ ID NO: 120 R814K individually or in various combination SEQ ID NO: 121 E815K with other Cas12f4 variants, can alter SEQ ID NO: 122 L825V crRNA interactions and/or RuvC catalytic SEQ ID NO: 123 L825I activity (e.g., cleavage of a DNA target by SEQ ID NO: 124 L825A the Cas12f4 variant) SEQ ID NO: 125 L825F SEQ ID NO: 126 T827K SEQ ID NO: 127 T827R SEQ ID NO: 128 Q830L Cas12f4 RuvC-II Domain Variants At Amino Acids 837-911 SEQ ID NO: 129 V841I Cas12f4 RuvC-II domain variants at SEQ ID NO: 130 V843G amino acids 837-911 include Cas12f4 SEQ ID NO: 131 V843C variants at, V841, V843, E844, S853, SEQ ID NO: 132 E844A C866, S867, M877, 1885, A890, S894, SEQ ID NO: 133 E844V and/or L899 that, individually or in SEQ ID NO: 134 S853W various combination with other Cas12f4 SEQ ID NO: 135 C866I (+/S867A) variants, can alter crRNA interactions SEQ ID NO: 136 C866V (+/S867A) and/or RuvC catalytic activity (e.g., SEQ ID NO: 137 S867A (+/C866V/I) cleavage of a DNA target by the Cas12f4 SEQ ID NO: 138 M877L variant) SEQ ID NO: 139 I885L SEQ ID NO: 140 I885F SEQ ID NO: 141 A890P SEQ ID NO: 142 S894A SEQ ID NO: 143 L899F Cas12f4 Nuc Domain Variants At Amino Acids 912-1014 SEQ ID NO: 144 C914A Cas12f4 Nuc domain variants at amino SEQ ID NO: 145 Y916F acids 912-1014 include Cas12f4 variants SEQ ID NO: 146 S917K at C914, Y916, S917, Q929, A933, V936, SEQ ID NO: 147 Q929L W938, C947, G951, H959, L967, V990, SEQ ID NO: 148 A933K T993, and/or C1014 that, individually or SEQ ID NO: 149 A933R in various combination with other Cas12f4 SEQ ID NO: 150 V936L variants, can disrupt RuvC catalytic SEQ ID NO: 151 W938L activity SEQ ID NO: 152 C947A SEQ ID NO: 153 C947Y SEQ ID NO: 154 G951A SEQ ID NO: 155 H959Y SEQ ID NO: 156 L967Y SEQ ID NO: 157 V990K SEQ ID NO: 158 T993S SEQ ID NO: 159 C1014E SEQ ID NO: 160 C1014N Cas12f4 RuvC-III Domain Variants At Amino Acids 1015-1045 SEQ ID NO: 161 D1017A Cas12f4 RuvC-III domain variants at SEQ ID NO: 162 C1025A amino acids 1015-1045 include Cas12f4 variants at D1017 and/or C1025 that, individually or in various combination with other Cas12f4 variants, can disrupt RuvC catalytic activity .sup.1Descriptions of various mutants are presented without seeking to be limited by theory.
[0054] In certain embodiments, variant Cas12f4 polypeptides (SEQ ID NOs: 2-162) exhibit improved functionalities as compared to the corresponding wild-type Cas12f4 polypeptide (SEQ ID NO: 1). For example, a substitution may enhance the ability of the variant Cas12f4 polypeptide to bind to, process, and/or stabilize a Cas12f4 guide RNA in comparison to the corresponding wild-type Cas12f4 polypeptide. In certain embodiments, variant Cas12f4 polypeptides comprising one or more amino acid substitution(s) can further comprise one or more additional amino acid substitution(s) that decrease or inactivate the nuclease activity of the variant Cas12f4 polypeptide in comparison to the corresponding wild-type Cas12f4 polypeptide.
[0055] The present disclosure provides variant Cas12f4 polypeptides and compositions comprising a variant Cas12f4 polypeptide (and/or a nucleic acid encoding the variant Cas12f4 polypeptide) (e.g., where the variant Cas12f4 polypeptide is a variant of a naturally-occurring (wild-type) protein, a nickase Cas12f4 protein, a dCas12f4 protein, a chimeric Cas12f4 protein, or Cas12f4 fusion polypeptide, etc.). The present disclosure also provides compositions comprising (a) a variant Cas12f4 polypeptide (and/or a nucleic acid encoding the variant Cas12f4 polypeptide) (e.g., where the variant Cas12f4 polypeptide can be a variant of a naturally-occurring (wild-type) protein, a nickase Cas12f4 protein, a dCas12f4 protein, a chimeric Cas12f4 protein, a Cas12f4 fusion polypeptide, etc.) and (b) a Cas12f4 guide RNA (and/or a nucleic acid encoding the Cas12f4 guide RNA) (e.g., where the Cas12f4 guide RNA can be in dual or single guide format). The present disclosure provides a nucleic acid/protein complex (RNP complex) comprising: (a) a variant Cas12f4 polypeptide of the present disclosure (e.g., where the variant Cas12f4 polypeptide can be a variant of a naturally-occurring (wild-type) protein, a nickase Cas12f4 protein, a dCas12f4 protein, a chimeric Cas12f4 protein, a Cas12f4 fusion polypeptide, etc.); and (b) a Cas12f4 guide RNA (e.g., where the Cas12f4 guide RNA can be in dual or single guide format).
[0056] A variant Cas12f4 polypeptide or protein can bind and/or modify (e.g., cleave, nick, methylate, demethylate, etc.) a target nucleic acid and/or a polypeptide associated with target nucleic acid (e.g., methylation or acetylation of a histone tail) (e.g., in some embodiments the variant Cas12f4 polypeptide includes a fusion partner with an activity, and in some embodiments the variant Cas12f4 polypeptide provides nuclease activity). In some embodiments, the variant Cas12f4 polypeptide is a variant of a naturally-occurring protein (e.g., naturally-occurs in prokaryotic cells).
[0057] Assays to determine or quantitate Cas12f4 protein or variant protein interactions with a Cas12f4 guide RNA or crRNA, including crRNA having the nucleotide sequence AGAGAAUGUGUGCAUAGUCACAC (SEQ ID NO: 175) can be any convenient binding assay that tests for binding between a protein and a nucleic acid. Assays to determine or quantitate DNA target recognition by Cas12f4 variants-gRNA ribonucleoprotein (RNP) complexes to Cas12f4 RNP gRNA complexes or other Cas12f4 variants RNP gRNA complexes can be any convenient binding assay that tests for binding between a ribonucleoprotein and a nucleic acid. Suitable binding assays (e.g., gel shift assays) will be known to one of ordinary skill in the art (e.g., assays that include adding a Cas12f4 guide RNA and a protein to a target nucleic acid). Assays to determine whether a protein has an activity (e.g., to determine if the protein has nuclease activity that cleaves a target nucleic acid and/or some heterologous activity) can be any convenient assay (e.g., any convenient nucleic acid cleavage assay that tests for nucleic acid cleavage). Suitable assays (e.g., cleavage assays) will be known to one of ordinary skill in the art. Quantitive equilibrium binding and kinetic assays can also be used to determine the dissociation constant for binding of crRNAs by Cas12f4 variant proteins in comparison to a Cas12f4 or another Cas12f4 variant. Examples of equilibrium binding assays that can be adapted for determination of such dissociation constants include isothermal titration calorimetry (ITC), fluorescence based assays, filter binding assays, and surface plasmon resonance assays (Jarmoskaite et al. (2020) doi.org/10.7554/eLife.57264). Kinetic measurements can be adapted for determination of such dissociation constants (Pollard and De La Cruz (2013) doi.org/10.1091/mbc.e13-01-0030). Assays to determine RNA-DNA helix (R-loop) formation rates and R-loop lifetime can also be used to compare DNA target recognition by Cas12f4 variants-gRNA ribonucleoprotein (RNP) complexes to Cas12f4 RNP gRNA complexes or other Cas12f4 variants RNP gRNA complexes. Examples of assays to determine R-loop formation rates and R-loop lifetime can be adapted from methods used to determine such rates for Cas12a-gRNA complexes with DNA targets (Strohkendl et al. (2018) doi: 10.1016/j.molcel.2018.06.043). In certain embodiments, R-loop lifetime measurements can be made with Cas12f4 variant-gRNA complexes wherein the Cas12f4 variant comprises one or more mutations that reduce catalytic activity of the RuvC domain (e.g., cleavage of a DNA target by the Cas12f4 variant).
[0058] Naturally-occurring Cas12f4 proteins function as endonucleases that catalyze a strand break (double or single strand) at a specific sequence in a targeted DNA. The sequence specificity is provided by the associated guide RNA, which hybridizes to a target sequence within the target DNA.
[0059] As used herein, Cas12f4 endonuclease activity refers to CRISPR endonuclease activity wherein, a guide RNA associated with a naturally-occurring or variant Cas12f4 polypeptide causes the Cas12f4-guide RNA complex to bind to a pre-determined nucleotide sequence that is complementary to the gRNA; and wherein Cas12f4 endonuclease activity can introduce a strand break at or near the site targeted by the gRNA. In certain embodiments, this is a double-stranded break, and it may be a blunt or a staggered DNA double-stranded break. As used herein a staggered DNA double-stranded break can result in a double strand break with about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, or about 10 nucleotides of overhang on either the 3 or 5 ends following cleavage. The double strand break can occur at or near the sequence to which the guide sequence is targeted.
[0060] In some embodiments, a variant Cas12f4 polypeptide of this disclosure (e.g., of the subject compositions and/or methods) comprises an amino acid sequence having 20% or more sequence identity (e.g., 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, 98% or more, 99% or more, or 100% sequence identity) with a Cas12f4 protein sequence set forth in any of SEQ ID NOs: 2-162 and comprises one or more amino acid substitutions of a wild-type amino acid residue as disclosed herein that enhances Cas12f4 protein function, enhances a Cas12f4 protein's ability to bind to, process, and/or stabilize a Cas12f4 guide RNA, and/or decreases or inactivates (abolishes) nuclease activity. For example, in some embodiments, a variant Cas12f4 polypeptide comprises an amino acid sequence having 50% or more sequence identity (e.g., 60% or more, 70% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, 98% or more, 99% or more, or 100% sequence identity) with the wild-type Cas12f4 protein sequence set forth in SEQ ID NO: 1 and comprises one or more amino acid substitutions of a wild-type amino acid residue that alters a Cas12f4 protein function, including the binding, processing, and/or stabilizing of a Cas12f4 guide RNA. In certain aspects, variant Cas12f4 proteins exhibit a decreased nuclease activity relative to the wild-type Cas12f4 protein of SEQ ID NO. 1.
[0061] In some embodiments, a variant Cas12f4 polypeptide includes an amino acid sequence having 90% or more sequence identity (e.g., 95% or more, 97% or more, 98% or more, 99% or more, 99.5%, 99.8%, 99.9%, or 100% sequence identity) with a Cas12f4 protein sequence set forth in any of SEQ ID NOs: 2-162 and comprises one or more amino acid substitutions of a wild-type amino acid residue as disclosed anywhere herein that enhance Cas12f4 protein function, enhance a Cas12f4 protein's ability to bind, process, and/or stabilize a Cas12f4 guide RNA, and/or decrease or inactivate (abolish) nuclease activity, as described elsewhere herein. A variant Cas12f4 fusion polypeptide can comprise any of the aforementioned variant Cas12f4 polypeptides.
[0062] In certain embodiments, the variant Cas12f4 polypeptide comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 additional amino acid substitutions of the wild-type amino acid sequence. In certain embodiments, the variant Cas12f4 polypeptide comprises between any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21 and 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 additional amino acid substitutions of the wild-type amino acid sequence. In certain embodiments, the variant Cas12f4 polypeptide comprises up to 22 additional amino acid substitutions of the wild-type amino acid sequence.
[0063] Cas12f4 protein includes 3 partial RuvC domains (RuvC-I, RuvC-II, and RuvC-III, also referred to herein as subdomains) that are not contiguous with respect to the primary amino acid sequence of the Cas12f4 protein, but form a RuvC domain once the protein is produced and folds. In some embodiments, a variant Cas12f4 polypeptide includes a split RuvC domain (e.g., 3 partial RuvC domains-RuvC-I, RuvC-II, and RuvC-III) with amino acid sequence having 20% or more sequence identity (e.g., 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, 98% or more, 99% or more, or 100% sequence identity) with the split RuvC domain. The catalytic residues of the RuvC domain of the Cas12f4 consensus sequence of SEQ ID NO: 1 are SEQ ID NO: 169 for RuvC-I, SEQ ID NO: 172 for RuvC-II, and SEQ ID NO: 174 for RuvC-III; other RuvC-I, RuvC-II, and RuvC-III subdomains are found in the corresponding positions of SEQ ID Nos: 2-162.
[0064] In certain embodiments, Cas12f4 proteins provided herein include proteins comprising an amino acid sequence having 20% or more sequence identity (e.g., 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, 98% or more, 99% or more, 99.5% or more, or 100% sequence identity with the Cas12f4 protein sequence set forth as SEQ ID NO: 1, wherein at least one of the RuvC subdomains of SEQ ID NO: 169, SEQ ID NO: 172, and/or SEQ ID NO: 174 are present or wherein at least one of the other RuvC-I, RuvC-II, and RuvC-III subdomains are found in the corresponding positions of SEQ ID Nos: 2-162 are present. A Cas12f4 fusion polypeptide can comprise any of the aforementioned Cas12f4 proteins.
[0065] A mutant or variant Cas12f4 polypeptide has an amino acid sequence that is different by at least one amino acid (e.g., has a deletion, insertion, substitution, fusion) when compared to the amino acid sequence of the corresponding wild-type Cas12f4 polypeptide. That is, for purposes of comparison such as determining enhancement in protein function, a protein's ability to bind, process, and/or stabilize guide RNA, decreased or inactivated nuclease activity, and/or the like, the corresponding wild-type Cas12f4 polypeptide is identical to the mutant or variant Cas12f4 polypeptide, except for the difference. In certain embodiments, the variant Cas12f4 polypeptide is a nuclease and comparison is made to a Cas12f4 nuclease comprising the corresponding wild-type Cas12f4 polypeptide. A Cas12f4 protein that cleaves one strand but not the other of a double stranded target nucleic acid is referred to herein as a nickase (e.g., a nickase Cas12f4). A Cas12f4 protein that has substantially no nuclease activity is referred to herein as a dead Cas12f4 protein (dCas12f4) (with the caveat that nuclease activity can be provided by a heterologous polypeptidea fusion partnerin the case of a chimeric Cas12f4 protein or a Cas12f4 fusion polypeptide, which is described in more detail below). For any of the variant Cas12f4 variant proteins described herein (e.g., nickase Cas12f4, dCas12f4, chimeric Cas12f4, Cas12f4 fusion polypeptide), the Cas12f4 variant can include a variant Cas12f4 polypeptide sequence with the same parameters described above (e.g., domains that are present, percent identity, and the like).
[0066] In certain embodiments, the variant Cas12f4 polypeptide is a variant Cas12f4 polypeptide, e.g., mutated relative to the naturally-occurring catalytically active sequence, and exhibits reduced/decreased cleavage activity (e.g., exhibits 90%, or less, 80% or less, 70% or less, 60% or less, 50% or less, 40% or less, 30% or less, 20% or less, 10% or less, 5% or less, or 1% or less cleavage activity) when compared to the corresponding naturally-occurring sequence. In some embodiments, such a variant Cas12f4 variant polypeptide is a catalytically dead protein (has substantially no cleavage activity) and can be referred to as a dCas12f4. In some embodiments, the variant Cas12f4 polypeptide is a nickase (cleaves only one strand of a double stranded target nucleic acid, e.g., a double stranded target DNA). As described in more detail herein, in some embodiments, a variant Cas12f4 polypeptide (in some case a variant Cas12f4 polypeptide with wild-type cleavage activity and in some embodiments a variant Cas12f4 polypeptide with reduced cleavage activity, e.g., a mutant dCas12f4 or a mutant nickase Cas12f4) is fused (conjugated) to a heterologous polypeptide that has an activity of interest (e.g., a catalytic activity of interest) to form a fusion protein (e.g., a chimeric variant Cas12f4 protein or a variant Cas12f4 fusion polypeptide).
[0067] The Cas12f4 functional domains and amino acid sequences are presented in Table 2.
TABLE-US-00002 TABLE2 Cas12f4 FunctionalDomains Amino Acid Sequence Domain Numbers Identifier AminoAcidSequence WED-I 1-14 SEQIDNO: MKKVEVSRPYQSLL 163 Helical-I 15-178 SEQIDNO: LPNHRKFKYLDETWNAYKSVKSLLHRFLVCAYGAV 164 PFNKFVEVVEKVDNDQLVLAFAVRLFRLVPVESTS FAKVDKANLAKSLANHLPVGTAIPANVQSYFDSNF DPKKYMWIDCAWEADRLAREMGLSASQFSEYATTM LWEDWLPLNKDDVNGWGSVSGLFG PI 179-271 SEQIDNO: EGKKEDRQQKVKMLNNLLNGIKKNPPKDYTQYLKI 165 LLNAFDAKSHKEAVKNYKGDSTGRTASYLSEKSGE ITELMLEQLMSNIQRDIGDKQKE Helical-I 272-328 SEQIDNO: ISLPKKDVVKKYLESESGVPYDQNLWSQAYRNAAS 166 SIKKTDTRNFNSTLEKFKNEVE Helical-II 329-449 SEQIDNO: LRGLLSEGDDVEILRSKFFSSEFHKTPDKFVIKPE 167 HIGFNNKYNVVAELYKLKAEATDFESAFATVKDEF EEKGIKHPIKNILEYIWNNEVPVEKWGRVARFNQS EEKLLRIKANPTVECN WED-II 450-605 SEQIDNO: QGMTFGNSAMVGEVLRSNYVSKKGALVSGEHGGRL 168 IGQNNMIWLEMRLLNKGKWETHHVPTHNMKFFEEV HAYNPSLADSVNVRNRLYRSEDYTQLPSSITDGLK GNPKAKLLKRQHCALNNMTANVLNPKLSFTINKKN DDYTVIIVHSVEVSKP RuvC-I 606-656 SEQIDNO: RREVLVGDYLVGMDQNQTASNTYAVMQVVKPKSTD 169 AIPFRNMWVRFVESGS Helical-III 657-794 SEQIDNO: IESRTLNSRGEYVDQLNHDGVDLFEIGDTEWVDSA 170 RKFFNKLGVKHKDGTLVDLSTAPRKAYAFNNFYFK TMLNHLRSNEVDLTLLRNEILRVANGRFSPMRLGS LSWTTLKALGSFKSLVLSYFDRLGAKEMVDKEA BH 795-836 SEQIDNO: KDKSLFDLLVAINNKRSNKREERTSRIASSLMTVA 171 QKYKVDN RuvC-II 837-911 SEQIDNO: AVVHVVVEGNLSSTDRSASKAHNRNTMDWCSRAVV 172 KKLEDMCNLYGFNIKGVPAFYTSHQDPLVHRADYD DPKPA Nuc 912-1014 SEQIDNO: LRCRYSSYSRADFSKWGQNALAAVVRWASNKKSNT 173 CYKVGAVEFLKQHGLFADKKLTVEQFLSKVKDEEI LIPRRGGRVFLTTHRLLAESTFVYLNGVKYHSC RuvC-III 1015-1045 SEQIDNO: NADEVAAVNICLNDWVIPCKKKMKEESSASG 174
[0068] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 WED-I domain (SEQ ID NO. 163) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 1 through 14 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide.
[0069] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid residue within Cas12f4 is an R (Arg) at position 8 of SEQ ID NO: 1, including variant Cas12f4 polypeptides comprising an amino acid substitution R8L (SEQ ID NO: 2).
[0070] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 Helical-I domain (SEQ ID NO. 164) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 15 through 178 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered genome editing functionality as compared to the wild-type Cas12f4 polypeptide.
[0071] In certain variant Cas12f4 polypeptides the wild-type amino acid residue within the Cas12f4 Helical-I domain is selected from the group consisting of an H (His) at position 39, an R (Arg) at position 40, an F (Phe) at position 51, a D (Asp) at position 62, a V (Val) at position 67, an F (Phe) at position 70, an S (Ser) at position 84, an N (Asn) at position 110, an M (Met) at position 125, an S (Ser) at position 145, a Y (Tyr) at position 150, a W (Trp) at position 159, a D (Asp) at position 166, a W (Trp) at position 170, and a G (Gly) at position 171 of SEQ ID NO: 1.
[0072] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid substitution within the Cas12f4 Helical-I domain is selected from the group consisting of H39F (SEQ ID NO: 3), R40H (SEQ ID NO: 4), F51Y (SEQ ID NO: 5), D62P (SEQ ID NO: 6), V67I (SEQ ID NO: 7), F70Y (SEQ ID NO: 8), S84R (SEQ ID NO: 9), N110I (SEQ ID NO: 10), M125K (SEQ ID NO: 11), S145E (SEQ ID NO: 12), Y150F (SEQ ID NO: 13), W159V (SEQ ID NO: 14), D166P (SEQ ID NO: 15), W170Y (SEQ ID NO: 16), W170N (SEQ ID NO: 17), W170K (SEQ ID NO: 18), G171R (SEQ ID NO: 19), G171K (SEQ ID NO: 20), G171A (SEQ ID NO: 21), and G171N (SEQ ID NO: 22).
[0073] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 PI domain (SEQ ID NO. 165) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 179 through 271 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered DNA-binding affinity, an altered DNA-binding specificity, an altered R-loop lifetime, and/or an altered protein stability as compared to the wild-type Cas12f4 polypeptide.
[0074] In certain variant Cas12f4 polypeptides the wild-type amino acid residue within Cas12f4 PI domain is selected from the group consisting of an E (Glu) at position 179, an E (Glu) at position 183, a K (Lys) at position 188, a Y (Tyr) at position 207, an H (His) at position 223, a D (Asp) at position 233, an S (Ser) at position 234, a T (Thr) at position 235, a G (Gly) at position 236, an R (Arg) at position 237, a Y (Tyr) at position 241, a K (Lys) at position 245, a L (Leu) at position 252, and an M (Met) at position 253 of SEQ ID NO: 1.
[0075] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid residue within Cas12f4 PI domain is selected from the group consisting of E179R (SEQ ID NO: 23), E179K (SEQ ID NO: 24), E179H (SEQ ID NO: 25), E183Q (SEQ ID NO: 26), E183K (SEQ ID NO: 27), E183R (SEQ ID NO: 28), K188R (SEQ ID NO: 29), Y207W (SEQ ID NO: 30), H223W (SEQ ID NO: 31), H223L (SEQ ID NO: 32), H223Q (SEQ ID NO: 33), K228R (SEQ ID NO: 176), K228X (SEQ ID NO: 177), D233X (SEQ ID NO: 34), S234X (SEQ ID NO: 35), T235X (SEQ ID NO: 36), G236X (SEQ ID NO: 37), R237X (SEQ ID NO: 38), Y241F (SEQ ID NO: 39), K245R (SEQ ID NO: 40), L252E (SEQ ID NO: 41), and M253E (SEQ ID NO: 42), wherein X designates any amino acid other than the wild-type amino acid.
[0076] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 Helical-I domain (SEQ ID NO. 166) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 272 through 328 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered DNA-binding affinity and/or an altered DNA-binding specificity as compared to the wild-type Cas12f4 polypeptide.
[0077] In certain variant Cas12f4 polypeptides the wild-type amino acid residue within Cas12f4 Helical-I domain is selected from the group consisting of a Y (Tyr) at position 283, an N (Asn) at position 295, an A (Ala) at position 305, and an F (Phe) at position 323 of SEQ ID NO: 1.
[0078] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid residue within Cas12f4 PI domain is selected from the group consisting of Y283W (SEQ ID NO: 43), N295X (SEQ ID NO: 44), A305M (SEQ ID NO: 45), and F323Y (SEQ ID NO: 46), wherein X designates any amino acid other than the wild-type amino acid.
[0079] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 Helical-II domain (SEQ ID NO. 167) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 329 through 449 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered interaction with crRNA within a Cas12f4 heteroduplex.
[0080] In certain variant Cas12f4 polypeptides the wild-type amino acid residue within Cas12f4 Helical-II domain is selected from the group consisting of a F (Phe) at position 347, an H (His) at position 352, a K (Lys) at position 353, a V (Val) at position 359, an E (Glu) at position 363, an F (Phe) at position 367, an N (Asn) at position 368, an N (Asn) at position 369, an A (Ala) at position 375, an A (Ala) at position 384, a V (Val) at position 394, an I (Ile) at position 403, a K (Lys) at position 404, an E (Glu) at position 412, a V (Val) at position 419, a V (Val) at position 427, an S (Ser) at position 433, a T (Thr) at position 445, a E (Glu) at position 447, and a C (Cys) at position 448 of SEQ ID NO: 1.
[0081] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid residue within Cas12f4 Helical-II domain is selected from the group consisting of F347Y (SEQ ID NO: 47), F347L (SEQ ID NO: 48), H352Y (SEQ ID NO: 49), K353W (SEQ ID NO: 50), V359T (SEQ ID NO: 51), E363R (SEQ ID NO: 52), F367V (SEQ ID NO: 53), N368T (SEQ ID NO: 54), N369P (SEQ ID NO: 55), A375E (SEQ ID NO: 56), A384G (SEQ ID NO: 57), V394I (SEQ ID NO: 58), I403L (SEQ ID NO: 59), K404X (SEQ ID NO: 60), E412K (SEQ ID NO: 61), V419I (SEQ ID NO: 62), V427M (SEQ ID NO: 63), V427C (SEQ ID NO: 64), S433V (SEQ ID NO: 65), T445V (SEQ ID NO: 66), T445Y (SEQ ID NO: 67), E447L (SEQ ID NO: 68), C448K (SEQ ID NO: 69), C448R (SEQ ID NO: 70), and C448X (SEQ ID NO: 71) wherein X designates any amino acid other than the wild-type amino acid.
[0082] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 WED-II domain (SEQ ID NO. 168) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 450 through 605 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered Cas12f4 DNA-binding affinity, Cas12f4 DNA presentation, Cas12f4 nonspecific DNA recognition, Cas12f4 interaction with the PAM minor groove, Cas12f4 DNA contact adjacent to PAM, and/or Cas12f4 interactions with BPs and BB.
[0083] In certain variant Cas12f4 polypeptides the wild-type amino acid residue within Cas12f4 WED-II domain is selected from the group consisting of an S (Ser) at position 470, a K (Lys) at position 471, a K (Lys) at position 472, an A (Ala) at position 474, a V (Val) at position 476, an E (Glu) at position 479, a G (Gly) at position 481, an E (Glu) at position 494, an E (Glu) at position 504, a T (Thr) at position 505, an H (His) at position 507, a K (Lys) at position 514, a E (Glu) at position 517, a V (Val) at position 532, an L (Leu) at position 536, a C (Cys) at position 567, and an N (Asn) at position 586 of SEQ ID NO: 1.
[0084] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid residue within Cas12f4 WED-II domain is selected from the group consisting of S470D (SEQ ID NO: 72), K471X (SEQ ID NO: 73), K472X (SEQ ID NO: 74), A474K (SEQ ID NO: 75), V476K (SEQ ID NO: 76), E479T (SEQ ID NO: 77), G481K (SEQ ID NO: 78), G481N (SEQ ID NO: 79), E494T (SEQ ID NO: 80), E494Q (SEQ ID NO: 81), E494N (SEQ ID NO: 82), E504K (SEQ ID NO: 83), E504R (SEQ ID NO: 84), T505K (SEQ ID NO: 85), H507R (SEQ ID NO: 86), K514R (SEQ ID NO: 87), E517R (SEQ ID NO: 88), E517Q (SEQ ID NO: 89), V532I (SEQ ID NO: 90), L536F (SEQ ID NO: 91), L536K (SEQ ID NO: 92), L536R (SEQ ID NO: 93), C567R (SEQ ID NO: 94), and N586R (SEQ ID NO: 95), wherein X designates any amino acid other than the wild-type amino acid.
[0085] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 RuvC-I domain (SEQ ID NO. 169) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 606 through 656 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered Cas12f4 RuvC catalytic activity.
[0086] In certain variant Cas12f4 polypeptides the wild-type amino acid residue within Cas12f4 RuvC-1 domain is selected from the group consisting of a D (Asp) at position 619, an F (Phe) at position 644, and an F (Phe) at position 651 of SEQ ID NO: 1.
[0087] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid residue within Cas12f4 RuvC-1 domain is selected from the group consisting of D619A (SEQ ID NO: 96), F644Y (SEQ ID NO: 97), and F651M (SEQ ID NO: 98).
[0088] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 Helical-III domain (SEQ ID NO. 170) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 657 through 794 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered Cas12f4 crRNA interactions and/or RuvC catalytic activity.
[0089] In certain variant Cas12f4 polypeptides the wild-type amino acid residue within Cas12f4 Helical-III domain is selected from the group consisting of an L (Leu) at position 662, an N (Asn) at position 673, an H (His) at position 674, an I (Ile) at position 682, an F (Phe) at position 695, an H (His) at position 702, an A (Ala) at position 717, a W (Trp) at position 764, a T (Thr) at position 766, a G (Gly) at position 771, and an E (Glu) at position 788 of SEQ ID NO: 1.
[0090] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid residue within Cas12f4 Helical-III domain is selected from the group consisting of L662R (SEQ ID NO: 99), L662K (SEQ ID NO: 100), L662H (SEQ ID NO: 101), N673S (SEQ ID NO: 102), H674Y (SEQ ID NO: 103), 1682S (SEQ ID NO: 104), F695L (SEQ ID NO: 105), H702N (SEQ ID NO: 106), H702K (SEQ ID NO: 107), H702R (SEQ ID NO: 108), A717V (SEQ ID NO: 110), A717L (SEQ ID NO: 111), W764R (SEQ ID NO: 112), T766H (SEQ ID NO: 113), G771E (SEQ ID NO: 114), and E788T (SEQ ID NO: 115).
[0091] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 BH domain (SEQ ID NO. 171) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 795 through 836 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered Cas12f4 crRNA interaction and/or RuvC catalytic activity.
[0092] In certain variant Cas12f4 polypeptides the wild-type amino acid residue within Cas12f4 BH domain is selected from the group consisting of an F (Phe) at position 800, an A (Ala) at position 805, an S (Ser) at position 811, a K (Lys) at position 813, an R (Arg) at position 814, an E (Glu) at position 815, an L (Leu) at position 825, a T (Thr) at position 827, and a Q (Gln) at position 830, where all positions correspond to those of SEQ ID NO: 1.
[0093] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid residue within Cas12f4 BH domain is selected from the group consisting of F800Y (SEQ ID NO: 116), A805E (SEQ ID NO: 117), S811R (SEQ ID NO: 118), K813R (SEQ ID NO: 119), R814K (SEQ ID NO: 120), E815K (SEQ ID NO: 121), L825V (SEQ ID NO: 122), L825I (SEQ ID NO: 123), L825A (SEQ ID NO: 124), L825F (SEQ ID NO: 125), T827K (SEQ ID NO: 126), T827R (SEQ ID NO: 127), and Q830L (SEQ ID NO: 128).
[0094] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 RuvC-II domain (SEQ ID NO. 172) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 837 through 911 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered Cas12f4 crRNA interaction and/or RuvC catalytic activity.
[0095] In certain variant Cas12f4 polypeptides the wild-type amino acid residue within Cas12f4 RuvC-II domain is selected from the group consisting of a V (Val) at position 841, a V (Val) at position 843, an E (Glu) at position 844, an S (Ser) at position 853, a C (Cys) at position 866, as S (Ser) at position 867, an M (Met) at position 877, an I (Ile) at position 885, an A (Ala) at position 890, an S (Ser) at position 894, and an L (Leu) at position 899 of SEQ ID NO: 1.
[0096] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid residue within Cas12f4 RuvC-II domain is selected from the group consisting of V841I (SEQ ID NO: 129), V843G (SEQ ID NO: 130), V843C (SEQ ID NO: 131), E844A (SEQ ID NO: 132), E844V (SEQ ID NO: 133), S853W (SEQ ID NO: 134), C866I (SEQ ID NO: 135), C866V (SEQ ID NO: 136), S867A (SEQ ID NO: 137), M877L (SEQ ID NO: 138), 1885L (SEQ ID NO: 139), 1885F (SEQ ID NO: 140), A890P (SEQ ID NO: 141), S894A (SEQ ID NO: 142), and L899F (SEQ ID NO: 143).
[0097] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 Nuc domain (SEQ ID NO. 173) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 912 through 1014 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered Cas12f4 RuvC catalytic activity.
[0098] In certain variant Cas12f4 polypeptides the wild-type amino acid residue within Cas12f4 Nuc domain is selected from the group consisting of a C (Cys) at position 914, a Y (Tyr) at position 916, an S (Ser) at position 917, a Q (Gln) at position 929, an A (Ala) at position 933, a V (Val) at position 936, a W (Trp) at position 938, a C (Cys) at position 947, a G (Gly) at position 951, an H (His) at position 959, an L (Leu) at position 967, a V (Val) at position 990, a T (Thr) at position 993, and a C (Cys) at position 1014 of SEQ ID NO: 1.
[0099] Exemplified herein are variant Cas12f4 polypeptides wherein the wild-type amino acid residue within Cas12f4 Nuc domain is selected from the group consisting of C914A (SEQ ID NO: 144), Y916F (SEQ ID NO: 145), S917K (SEQ ID NO: 146), Q929L (SEQ ID NO: 147), A933K (SEQ ID NO: 148), A933R (SEQ ID NO: 149), V936L (SEQ ID NO: 150), W938L (SEQ ID NO: 151), C947A (SEQ ID NO: 152), C947Y (SEQ ID NO: 153), G951A (SEQ ID NO: 154), H959Y (SEQ ID NO: 155), L967Y (SEQ ID NO: 156), V990K (SEQ ID NO: 157), T993S (SEQ ID NO: 158), C1014E (SEQ ID NO: 159), and C1014N (SEQ ID NO: 160).
[0100] Variant Cas12f4 polypeptides may comprise an amino acid substitution of a wild-type amino acid residue within the Cas12f4 RuvC-III domain (SEQ ID NO. 174) at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 1015 through 1045 of the Cas12f4 sequence of SEQ ID NO: 1 and wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide, including an altered Cas12f4 RuvC catalytic activity
[0101] A variant Cas12f4 polypeptide of the present disclosure can include one or more mutations that enhance protein function. In certain embodiments, Cas12f4 protein enhancement mutations alter the level of gene editing by the Cas12f4 scaffold protein polypeptide, as compared to a Cas12f4 polypeptide lacking the mutations. In certain embodiments, the effect of the Cas12f4 enhancement mutations may include: altered translation, folding, and/or stability of the protein or RNP; altered affinity and/or specificity of target binding; altered nuclease efficiency on target and/or non-target strands; altered PAM recognition specificity; altered half-life (for example as it may be measured in vivo and/or in vitro); and altered DNA repair outcomes (e.g., increased frequencies of target gene editing and/or decreased frequencies of non-target gene mutations). In certain embodiments, characteristics altered by the mutations include: higher solubility, longer active lifespan in vivo or in vitro (e.g., increased half-life), or improved enzymatic activity as may be measured by higher Kcat and or/lower Km, or higher substrate specificity.
[0102] A variant Cas12f4 polypeptide can include, but is not limited to, one or more mutations that enhance the polypeptide's ability to bind, process, and/or stabilize guide RNA. In certain embodiments, mutations that confer improved ability to bind/stabilize guide RNA may alter target DNA binding affinity and/or sequence specificity of the mutated Cas12f4 polypeptide, and/or DNA editing outcome (e.g., increased frequencies of target gene editing and/or decreased frequencies of non-target gene mutations) as compared to a Cas12f4 polypeptide lacking the mutation(s). In certain embodiments, the improved binding to the Cas12f4 guide RNA comprises a reduction in the binding affinity constant (Kd) of the variant Cas12f4 polypeptide for the Cas12f4 guide RNA in comparison to the corresponding wild-type Cas12f4 polypeptide. In certain embodiments, the Kd for the Cas12f4 guide RNA is reduced by at least 1.5-, 2-, 3-, 5-, 10-, or 100-fold in comparison to the corresponding wild-type Cas12f4 polypeptide.
[0103] A variant Cas12f4 polypeptide or variant Cas12f4 fusion polypeptide of this disclosure can comprise one or more amino acid substitutions that decreases or inactivates (abolishes) the polypeptide's nuclease activity.
[0104] To initiate DNA cleavage, a Cas12f4 enzyme complexes with one or more RNA molecules (guide RNA) comprising a sequence complementary to the intended target site. To cleave DNA in vitro, a purified wild-type or mutated Cas12f4 polypeptide is pre-complexed to guide RNA and incubated with linear double-stranded DNA (e.g., linearized plasmid DNA) having a sequence region complementary to that of the guide RNA. The extent of the cleavage reaction is monitored at different time points or enzyme concentrations by, for example, polyacrylamide gel electrophoresis (Kleinstiver et al., Nat Biotechnol. 2019, 37 (3): 276-282. doi: 10.1038/s41587-018-0011-0). Compared to the wild-type Cas12f4 protein, digestion by the variant Cas12f4 polypeptide may differ in reaction rate, specificity toward the target sequence, enzymatic turnover, product composition (e.g., nicked dsDNA), and/or temperature optimality. In certain embodiments, a variant Cas12f4 polypeptide may differ from the wild-type Cas12f4 in processing or binding the guide RNA, or may enable non-natural modifications, insertions, 5 or 3 extensions, or 5 or 3 truncations of the guide RNA. In certain embodiments, such variant Cas12f4 polypeptides may demonstrate enhanced efficiency of RNP formation, reduced sensitivity to reaction temperature, or reduced dependence on cofactors for complex assembly in comparison to a Cas12f4 protein lacking the mutations.
[0105] As noted above, in some embodiments, a variant Cas12f4 polypeptide (in some embodiments a variant Cas12f4 polypeptide with wild-type cleavage activity and in some embodiments a mutant with reduced cleavage activity, e.g., a mutant dCas12f4 or a mutant nickase Cas12f4) is fused (conjugated) to a heterologous polypeptide that has an activity of interest (e.g., a catalytic activity of interest) to form a fusion protein (a chimeric variant Cas12f4 protein or variant Cas12f4 fusion polypeptide). A heterologous polypeptide to which a variant Cas12f4 protein can be fused is referred to herein as a fusion partner.
[0106] In some embodiments the fusion partner can modulate transcription (e.g., inhibit transcription, increase transcription) of a target DNA. For example, in some embodiments the fusion partner is a protein (or a domain from a protein) that inhibits transcription (e.g., a transcriptional repressor, a protein that functions via recruitment of transcription inhibitor proteins, modification of target DNA such as methylation, recruitment of a DNA modifier, modulation of histones associated with target DNA, recruitment of a histone modifier such as those that modify acetylation and/or methylation of histones, and the like). In some embodiments the fusion partner is a protein (or a domain from a protein) that increases transcription (e.g., a transcription activator, a protein that acts via recruitment of transcription activator proteins, modification of target DNA such as demethylation, recruitment of a DNA modifier, modulation of histones associated with target DNA, recruitment of a histone modifier such as those that modify acetylation and/or methylation of histones, and the like).
[0107] In some embodiments, a chimeric Cas12f4 protein or Cas12f4 fusion polypeptide includes a heterologous polypeptide that has enzymatic activity that modifies a target nucleic acid (e.g., nuclease activity, methyltransferase activity, demethylase activity, DNA repair activity, DNA damage activity, deamination activity, dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity, transposase activity, recombinase activity, polymerase activity, ligase activity, helicase activity, photolyase activity or glycosylase activity).
[0108] In some embodiments, a chimeric Cas12f4 protein or Cas12f4 fusion polypeptide includes a heterologous polypeptide that has enzymatic activity that modifies a polypeptide (e.g., a histone) associated with a target nucleic acid (e.g., methyltransferase activity, demethylase activity, acetyltransferase activity, deacetylase activity, kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity or demyristoylation activity).
[0109] Examples of proteins (or fragments thereof) that can be used in increase transcription include but are not limited to: transcriptional activators such as VP16, VP64, VP48, VP160, p65 subdomain (e.g., from NFkB), and activation domain of EDLL and/or TAL activation domain (e.g., for activity in plants); histone lysine methyltransferases such as SETIA, SET1B, MLL1 to 5, ASH1, SYMD2, NSDI, and the like; histone lysine demethylases such as JHDM2a/b, UTX, JMJD3, and the like; histone acetyltransferases such as GCN5, PCAF, CBP, p300, TAF1, TIP60/PLIP, MOZ/MYST3, MORF/MYST4, SRCI, ACTR, P160, CLOCK, and the like; and DNA demethylases such as Ten-Eleven Translocation (TET) dioxygenase 1 (TET1CD), TET1, DME, DML1, DML2, ROS1, and the like.
[0110] Examples of proteins (or fragments thereof) that can be used in decrease transcription include but are not limited to: transcriptional repressors such as the Krppel associated box (KRAB or SKD); KOX1 repression domain; the Mad mSIN3 interaction domain (SID); the ERF repressor domain (ERD), the SRDX repression domain (e.g., for repression in plants), and the like; histone lysine methyltransferases such as Pr-SET7/8, SUV4-20H1, RIZI, and the like; histone lysine demethylases such as JMJD2A/JHDM3A, JMJD2B, JMJD2C/GASC1, JMJD2D, JARIDIA/RBP2, JARIDIB/PLU-1, JARIDIC/SMCX, JARIDID/SMCY, and the like; histone lysine deacetylases such as HDAC1, HDAC2, HDAC3, HDAC8, HDAC4, HDAC5, HDAC7, HDAC9, SIRT1, SIRT2, HDAC11, and the like; DNA methylases such as Hhal DNA m5c-methyltransferase (M.Hhal), DNA methyltransferase 1 (DNMT1), DNA methyltransferase 3a (DNMT3a), DNA methyltransferase 3b (DNMT3b), MET1, DRM3 (plants), ZMET2, CMT1, CMT2 (plants), and the like; and periphery recruitment elements such as Lamin A, Lamin B, and the like.
[0111] In some embodiments the fusion partner used in a Cas12f4 fusion polypeptide has enzymatic activity that modifies the target nucleic acid (e.g., ssRNA, dsRNA, ssDNA, dsDNA). Examples of enzymatic activity that can be provided by the fusion partner include but are not limited to: nuclease activity such as that provided by a restriction enzyme (e.g., Fokl nuclease), methyltransferase activity such as that provided by a methyltransferase (e.g., Hhal DNA m5c-methyltransferase, M.Hhal), DNA methyltransferase 1 (DNMT1), DNA methyltransferase 3a (DNMT3a), DNA methyltransferase 3b (DNMT3b), MET1, DRM3 (plants), ZMET2, CMT1, CMT2 (plants), and the like); demethylase activity such as that provided by a demethylase (e.g., Ten-Eleven Translocation (TET) dioxygenase 1 (TET1CD), TET1, DME, DML1, DML2, ROS 1, and the like), DNA repair activity, DNA damage activity, deamination activity such as that provided by a deaminase (e.g., a cytosine deaminase enzyme such as rat APOBEC1), dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity such as that provided by an integrase and/or resolvase (e.g., Gin invertase such as the hyperactive mutant of the Gin invertase, GinH106Y; human immunodeficiency virus type 1 integrase (IN); Tn3 resolvase; and the like), transposase activity, recombinase activity such as that provided by a recombinase (e.g., catalytic domain of Gin recombinase), polymerase activity, ligase activity, helicase activity, photolyase activity, and glycosylase activity.
[0112] In some embodiments the fusion partner used in a Cas12f4 fusion polypeptide has enzymatic activity that modifies a protein associated with the target nucleic acid (e.g., ssRNA, dsRNA, ssDNA, dsDNA) (e.g., a histone, an RNA binding protein, a DNA binding protein, and the like). Examples of enzymatic activity (that modifies a protein associated with a target nucleic acid) that can be provided by the fusion partner include but are not limited to: methyltransferase activity such as that provided by a histone methyltransferase (HMT) (e.g., suppressor of variegation 3-9 homolog 1 (SUV39H1, also known as KMTIA)), euchromatic histone lysine methyltransferase 2 (G9A, also known as KMTIC and EHMT2), SUV39H2, ESET/SETDB 1, and the like, SETIA, SET1B, MLL1 to 5, ASH1, SYMD2, NSD1, DOTIL, Pr-SET7/8, SUV4-20H1, EZH2, RIZI), demethylase activity such as that provided by a histone demethylase (e.g., Lysine Demethylase 1A (KDMIA also known as LSD1), JHDM2a/b, JMJD2A/JHDM3A, JMJD2B, JMJD2C/GASC1, JMJD2D, JARIDIA/RBP2, JARIDIB/PLU-1, JARIDIC/SMCX, JARIDID/SMCY, UTX, JMJD3, and the like), acetyltransferase activity such as that provided by a histone acetylase transferase (e.g., catalytic core/fragment of the human acetyltransferase p300, GCN5, PCAF, CBP, TAF1, TIP60/PLIP, MOZ/MYST3, MORF/MYST4, HB01/MYST2, HMOF/MYST1, SRC1, ACTR, P160, CLOCK, and the like), deacetylase activity such as that provided by a histone deacetylase (e.g., HDAC1, HDAC2, HDAC3, HDAC8, HDAC4, HDAC5, HDAC7, HDAC9, SIRT1, SIRT2, HDAC11, and the like), kinase activity, phosphatase activity, ubiquitin ligase activity, deubiquitinating activity, adenylation activity, deadenylation activity, SUMOylating activity, deSUMOylating activity, ribosylation activity, deribosylation activity, myristoylation activity, and demyristoylation activity.
[0113] An additional examples of a suitable fusion partners used in a Cas12f4 fusion polypeptide are dihydrofolate reductase (DHFR) destabilization domain (e.g., to generate a chemically controllable chimeric Cas12f4 protein or Cas12f4 fusion polypeptide), and a chloroplast transit peptide. In some case, a Cas12f4 fusion polypeptide of the present disclosure comprises: a) a Cas12f4 polypeptide of the present disclosure; and b) a chloroplast transit peptide. Thus, for example, a CRISPR-Cas12f4 complex can be targeted to the chloroplast. In some embodiments, this targeting may be achieved by the presence of an N-terminal extension, called a chloroplast transit peptide (CTP) or plastid transit peptide. Chromosomal transgenes from bacterial sources must have a sequence encoding a CTP sequence fused to a sequence encoding an expressed polypeptide if the expressed polypeptide is to be compartmentalized in the plant plastid (e.g., chloroplast).
[0114] Accordingly, localization of an exogenous polypeptide to a chloroplast is often 1 accomplished by means of operably linking a polynucleotide sequence encoding a CTP sequence to the 5 region of a polynucleotide encoding the exogenous polypeptide. The CTP is removed in a processing step during translocation into the plastid. Processing efficiency may, however, be affected by the amino acid sequence of the CTP and nearby sequences at the amino terminus of the peptide. Other options for targeting to the chloroplast which have been described are the maize cab-m7 signal sequence (U.S. Pat. No. 7,022,896, WO 97/41228) a pea glutathione reductase signal sequence (WO 97/41228) and the CTP described in US2009029861.
[0115] The variant Cas12f4 polypeptides disclosed herein can further comprise at least one plastid targeting signal peptide, at least one mitochondrial targeting signal peptide, or a signal peptide targeting the variant Cas12f4 polypeptide to both plastids and mitochondria. Plastid, mitochondrial, and dual-targeting signal peptide localization signals are known in the art (see, e.g., Nassoury and Morse (2005) Biochim Biophys Acta 1743:5-19; Kunze and Berger (2015) Front Physiol dx.doi.org/10.3389/fphys.2015.00259; Herrmann and Neupert (2003) IUBMB Life 55:219-225; Soll (2002) Curr Opin Plant Biol 5:529-535; Carrie and Small (2013) Biochim Biophys Acta 1833:253-259; Carrie et al. (2009) FEBS J 276:1187-1195; Silva-Filho (2003) Curr Opin Plant Biol 6:589-595; Peeters and Small (2001) Biochim Biophys Acta 1541:54-63; Murcha et al. (2014) J Exp Bot 65:6301-6335; Mackenzie (2005) Trends Cell Biol 15:548-554; Glaser et al. (1998) Plant Mol Biol 38:311-338). The plastid, mitochondrial, or dual-targeting signal peptide can be located at the N-terminus, the C-terminus, or in an internal location of the Cas12f4 polypeptide.
[0116] For examples of some of the above fusion partners (and more) used in the context of fusions with Cas9, Zinc Finger, and/or TALE proteins (for site specific target nucleic modification, modulation of transcription, and/or target protein modification, e.g., histone modification), see, e.g.: Nomura et al J Am Chem Soc. 2007 Jul. 18; 129 (28): 8676-7; Rivenbark et al., Epigenetics. 2012 April; 7 (4): 350-60; Nucleic Acids Res. 2016 Jul. 8; 44 (12): 5615-28; Gilbert et al, Cell. 2013 Jul. 18; 154 (2): 442-51; Kearns et al, Nat Methods. 2015 May; 12 (5): 401-3; Mendenhall et al, Nat Biotechnol. 2013 December; 31 (12): 1133-6; Hilton et al., Nat Biotechnol. 2015 May; 33 (5): 510-7; Gordley et al., Proc Natl Acad Sci USA. 2009 Mar. 31; 106 (13): 5053-8; Akopian et al., Proc Natl Acad Sci USA. 2003 Jul. 22; 100 (15): 8688-91; Tan et al., J Virol. 2006 February; 80 (4): 1939-48; Tan et al., Proc Natl Acad Sci USA. 2003 Oct. 14; 100 (21): 11997-2002; Papworth et al., Proc Natl Acad Sci USA. 2003 Feb. 18; 100 (4): 1621-6; Sanjana et al., Nat Protoc. 2012 Jan. 5; 7 (1): 171-92; Beerli et al., Proc Natl Acad Sci USA. 1998 Dec. 8; 95 (25): 14628-33; Snowden et al., Curr Biol. 2002 Dec. 23; 12 (24): 2159-66; Xu et. al., Cell Discov. 2016 May 3; 2:16009; Komor et al., Nature. 2016 Apr. 20; 533 (7603): 420-4; Chaikind et al., Nucleic Acids Res. 2016 Aug. 11; Choudhury at. al., Oncotarget. 2016 Jun. 23; Du et al., Cold Spring Harb Protoc. 2016 Jan. 4; Pham et al, Methods Mol Biol. 2016; 1358:43-57; Balboa et al., Stem Cell Reports. 2015 Sep. 8; 5 (3): 448-59; Hara et al., Sci Rep. 2015 Jun. 9; 5:11221; Piatek et al., Plant Biotechnol J. 2015 May; 13 (4): 578-89; Hu et al., Nucleic Acids Res. 2014 April; 42 (7): 4375-90; Cheng et al., Cell Res. 2013 October; 23 (10): 1163-71; Cheng et al, Cell Res. 2013 October; 23 (10): 1 163-71; and Maeder et al., Nat Methods. 2013 October; 10 (10): 977-9.
[0117] Additional suitable heterologous polypeptides that can be used in a variant Cas12f4 fusion polypeptide include, but are not limited to, a polypeptide that directly and/or indirectly provides for increased transcription and/or translation of a target nucleic acid (e.g., a transcription activator or a fragment thereof, a protein or fragment thereof that recruits a transcription activator, a small molecule/drug-responsive transcription and/or translation regulator, a translation-regulating protein, etc.). Non-limiting examples of heterologous polypeptides to accomplish increased or decreased transcription include transcription activator and transcription repressor domains. In some such cases, a chimeric Cas12f4 polypeptide or Cas12f4 fusion polypeptide is targeted by the guide nucleic acid (guide RNA) to a specific location (i.e. sequence) in the target nucleic acid and exerts locus-specific regulation such as blocking RNA polymerase binding to a promoter (which selectively inhibits transcription activator function), and/or modifying the local chromatin status (e.g., when a fusion sequence is used that modifies the target nucleic acid or modifies a polypeptide associated with the target nucleic acid). In some embodiments, the changes are transient (e.g., transcription repression or activation). In some embodiments, the changes are inheritable (e.g., when epigenetic modifications are made to the target nucleic acid or to proteins associated with the target nucleic acid, e.g., nucleosomal histones).
[0118] Non-limiting examples of heterologous polypeptides for use when targeting ssRNA target nucleic acids include but are not limited to: splicing factors (e.g., RS domains); protein translation components (e.g., translation initiation, elongation, and/or release factors; e.g., eIF4G); RNA methylases; RNA editing enzymes (e.g., RNA deaminases, e.g., adenosine deaminase acting on RNA (ADAR), including A to I and/or C to U editing enzymes); helicases; RNA-binding proteins; and the like. It is understood that a heterologous polypeptide can include the entire protein or in some embodiments can include a fragment of the protein (e.g., a functional domain).
[0119] The heterologous polypeptide of a subject chimeric Cas12f4 polypeptide or Cas12f4 fusion polypeptide can be any domain capable of interacting with ssRNA (which, for the purposes of this disclosure, includes intramolecular and/or intermolecular secondary structures, e.g., double-stranded RNA duplexes such as hairpins, stem-loops, etc.), whether transiently or irreversibly, directly or indirectly, including but not limited to an effector domain selected from the group comprising: Endonucleases (for example RNase III, the CRR22 DYW domain, Dicer, and PIN (PilT N-terminus) domains from proteins such as SMG5 and SMG6); proteins and protein domains responsible for stimulating RNA cleavage (for example CPSF, CstF, CFIm and CFIIm); Exonucleases (for example XRN-1 or Exonuclease T); Deadenylases (for example HNT3); proteins and protein domains responsible for nonsense mediated RNA decay (for example UPF1, UPF2, UPF3, UPF3b, RNP SI, Y14, DEK, REF2, and SRml60); proteins and protein domains responsible for stabilizing RNA (for example PABP); proteins and protein domains responsible for repressing translation (for example Ago2 and Ago4); proteins and protein domains responsible for stimulating translation (for example Staufen); proteins and protein domains responsible for (e.g., capable of) modulating translation (e.g., translation factors such as initiation factors, elongation factors, release factors, etc., e.g., eIF4G); proteins and protein domains responsible for polyadenylation of RNA (for example PAP1, GLD-2, and Star-PAP); proteins and protein domains responsible for polyuridinylation of RNA (for example CI DI and terminal uridylate transferase); proteins and protein domains responsible for RNA localization (for example from IMP1, ZBP1, She2p, She3p, and Bicaudal-D); proteins and protein domains responsible for nuclear retention of RNA (for example Rrp6); proteins and protein domains responsible for nuclear export of RNA (for example TAP, NXF1, THO, TREX, REF, and Aly); proteins and protein domains responsible for repression of RNA splicing (for example PTB, Sam68, and hnRNP Al); proteins and protein domains responsible for stimulation of RNA splicing (for example Serine/Arginine-rich (SR) domains); proteins and protein domains responsible for reducing the efficiency of transcription (for example FUS (TLS)); and proteins and protein domains responsible for stimulating transcription (for example CDK7 and HIV Tat). Alternatively, the effector domain may be selected from the group comprising Endonucleases; proteins and protein domains capable of stimulating RNA cleavage; Exonucleases; Deadenylases; proteins and protein domains having nonsense mediated RNA decay activity; proteins and protein domains capable of stabilizing RNA; proteins and protein domains capable of repressing translation; proteins and protein domains capable of stimulating translation; proteins and protein domains capable of modulating translation (e.g., translation factors such as initiation factors, elongation factors, release factors, etc., e.g., eIF4G); proteins and protein domains capable of polyadenylation of RNA; proteins and protein domains capable of polyuridinylation of RNA; proteins and protein domains having RNA localization activity; proteins and protein domains capable of nuclear retention of RNA; proteins and protein domains having RNA nuclear export activity; proteins and protein domains capable of repression of RNA splicing; proteins and protein domains capable of stimulation of RNA splicing; proteins and protein domains capable of reducing the efficiency of transcription; and proteins and protein domains capable of stimulating transcription. Another suitable heterologous polypeptide is a PUF RNA-binding domain, which is described in more detail in WO2012068627, which is hereby incorporated by reference in its entirety.
[0120] Some RNA splicing factors that can be used (in whole or as fragments thereof) as heterologous polypeptides for a chimeric Cas12f4 polypeptide or Cas12f4 fusion polypeptide have modular organization, with separate sequence-specific RNA binding modules and splicing effector domains. For example, members of the Serine/Arginine-rich (SR) protein family contain N-terminal RNA recognition motifs (RRMs) that bind to exonic splicing enhancers (ESEs) in pre-mRNAs and C-terminal RS domains that promote exon inclusion. As another example, the hnRNP protein hnRNP Al binds to exonic splicing silencers (ESSs) through its RRM domains and inhibits exon inclusion through a C-terminal Glycine-rich domain. Some splicing factors can regulate alternative use of splice site (ss) by binding to regulatory sequences between the two alternative sites. For example, ASF/SF2 can recognize ESEs and promote the use of intron proximal sites, whereas hnRNP Al can bind to ESSs and shift splicing towards the use of intron distal sites. One application for such factors is to generate ESFs that modulate alternative splicing of endogenous genes, particularly disease associated genes. For example, Bcl-x pre-mRNA produces two splicing isoforms with two alternative 5 splice sites to encode proteins of opposite functions. The long splicing isoform Bcl-xL is a potent apoptosis inhibitor expressed in long-lived postmitotic cells and is up-regulated in many cancer cells, protecting cells against apoptotic signals. The short isoform Bcl-xS is a pro-apoptotic isoform and expressed at high levels in cells with a high turnover rate (e.g., developing lymphocytes). The ratio of the two Bcl-x splicing isoforms is regulated by multiple cc-elements that are located in either the core exon region or the exon extension region (i.e. between the two alternative 5 splice sites). For more examples, see WO2010075303, which is hereby incorporated by reference in its entirety.
[0121] Further suitable fusion partners or Cas12f4 fusion polypeptide Cas12f4 fusion polypeptide include, but are not limited to proteins (or fragments thereof) that are boundary elements (e.g., CTCF), proteins and fragments thereof that provide periphery recruitment (e.g., Lamin A, Lamin B, etc.), and protein docking elements (e.g., FKBP/FRB, Pill/Abyl, etc.).
[0122] Examples of various additional suitable heterologous polypeptide (or fragments thereof) that can be adapted for use in a subject chimeric Cas12f4 polypeptide or Cas12f4 fusion polypeptide include, but are not limited to those described in the following applications (which publications are related to other CRISPR endonucleases such as Cas9, but the described fusion partners can also be used with Cas12f4 instead): PCT patent applications: WO2010075303, WO2012068627, and WO2013155555, and can be found, for example, in U.S. patents and patent applications: U.S. Pat. Nos. 8,906,616; 8,895,308; 8,889,418; 8,889,356; 8,871,445; 8,865,406; 8,795,965; 8,771,945; 8,697,359; 20140068797; 20140170753; 20140179006; 20140179770; 20140186843; 20140186919; 20140186958; 20140189896; 20140227787; 20140234972; 20140242664; 20140242699; 20140242700; 20140242702; 20140248702; 20140256046; 20140273037; 20140273226; 20140273230; 20140273232; 20140273233; 20140273234; 20140273235; 20140287938; 20140295556; 20140295557; 20140298547; 20140304853; 20140309487; 20140310828; 20140310830; 20140315985; 20140335063; 20140335620; 20140342456; 20140342457; 20140342458; 20140349400; 20140349405; 20140356867; 20140356956; 20140356958; 20140356959; 20140357523; 20140357530; 20140364333; and 20140377868; all of which are hereby incorporated by reference in their entirety.
[0123] In some embodiments, a heterologous polypeptide (a fusion partner) or Cas12f4 fusion polypeptide provides for subcellular localization, e.g., the heterologous polypeptide contains a subcellular localization sequence (e.g., a nuclear localization signal (NLS) for targeting to the nucleus, a sequence to keep the fusion protein out of the nucleus, e.g., a nuclear export sequence (NES), a sequence to keep the fusion protein retained in the cytoplasm, a mitochondrial localization signal for targeting to the mitochondria, a chloroplast localization signal for targeting to a chloroplast, an ER retention signal, and the like). In some embodiments, a Cas12f4 fusion polypeptide does not include a NLS so that the protein is not targeted to the nucleus (which can be advantageous, e.g., when the target nucleic acid is an RNA that is present in the cytosol). In some embodiments, the heterologous polypeptide can provide a tag (e.g., the heterologous polypeptide is a detectable label) for ease of tracking and/or purification (e.g., a fluorescent protein, e.g., green fluorescent protein (GFP), YFP, RFP, CFP, mCherry, tdTomato, mScarlett, and the like; a histidine tag, e.g., a 6XHis tag; a hemagglutinin (HA) tag; a FLAG tag; a Myc tag; and the like).
[0124] In some embodiments a Cas12f4 protein (e.g., a wild-type Cas12f4 polypeptide, a variant Cas12f4 polypeptide, a chimeric variant Cas12f4 protein, variant Cas12f4 fusion polypeptide, a mutant dCas12f4 protein, a chimeric variant Cas12f4 protein or a variant Cas12f4 fusion polypeptide where the variant Cas12f4 portion has reduced nuclease activity-such as a mutant dCas12f4 polypeptide fused to a fusion partner, and the like) includes (is fused to) a nuclear localization signal (NLS) (e.g, in some embodiments 2 or more, 3 or more, 4 or more, or 5 or more NLSs). Thus, in embodiments, a Cas12f4 polypeptide includes one or more NLSs (e.g., 2 or more, 3 or more, 4 or more, or 5 or more NLSs). In some embodiments, one or more NLSs (2 or more, 3 or more, 4 or more, or 5 or more NLSs) are positioned at or near (e.g., within 50 amino acids of) the N-terminus and/or the C-terminus. In some embodiments, one or more NLSs (2 or more, 3 or more, 4 or more, or 5 or more NLSs) are positioned at or near (e.g., within 50 amino acids of) the N-terminus. In some embodiments, one or more NLSs (2 or more, 3 or more, 4 or more, or 5 or more NLSs) are positioned at or near (e.g., within 50 amino acids of) the C-terminus. In some embodiments, one or more NLSs (3 or more, 4 or more, or 5 or more NLSs) are positioned at or near (e.g., within 50 amino acids of) both the N-terminus and the C-terminus. In some embodiments, an NLS is positioned at the N-terminus and an NLS is positioned at the C-terminus.
[0125] In some embodiments a Cas12f4 protein (e.g., a wild-type Cas12f4 protein, a variant Cas12f4 polypeptide, a chimeric variant Cas12f4 protein, or variant Cas12f4 fusion polypeptide, a mutant dCas12f4 polypeptide, a chimeric variant Cas12f4 protein or variant Cas12f4 fusion polypeptide where the variant Cas12f4 portion has reduced nuclease activity-such as a mutant dCas12f4 polypeptide fused to a fusion partner, and the like) includes (is fused to) between 1 and 10 NLSs (e.g., 1-9, 1-8, 1-7, 1-6, 1-5, 2-10, 2-9, 2-8, 2-7, 2-6, or 2-5 NLSs). In some embodiments a Cas12f4 protein (e.g., a wild-type Cas12f4 protein, a variant Cas12f4 polypeptide, a chimeric variant Cas12f4 protein, a mutant dCas12f4 polypeptide, a chimeric variant Cas12f4 protein or variant Cas12f4 fusion polypeptide where the variant Cas12f4 portion has reduced nuclease activity-such as a mutant dCas12f4 polypeptide fused to a fusion partner, and the like) includes (is fused to) between 2 and 5 NLSs (e.g., 2-4, or 2-3 NLSs).
[0126] Non-limiting examples of NLSs include the NLS of the SV40 virus large T-antigen, the NLS from nucleoplasmin (e.g., the nucleoplasmin bipartite NLS), the c-myc NLS, the hRNPAI M9 NLS, the IBB domain from importin-alpha, the myoma T protein, human p53, mouse c-abl IV, influenza virus NS1, the Hepatitis virus delta antigen, the mouse Mxl protein, the human poly(ADP-ribose) polymerase, and the steroid hormone receptor (e.g., human glucocorticoid receptor). In general, NLS (or multiple NLSs) are of sufficient strength to drive accumulation of the Cas12f4 protein in a detectable amount in the nucleus of a eukaryotic cell. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to the Cas12f4 protein such that location within a cell may be visualized. Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly.
[0127] In some embodiments, a Cas12f4 fusion polypeptide includes a Protein Transduction Domain or PTD (also known as a CPP-cell penetrating peptide), which refers to a polypeptide, polynucleotide, carbohydrate, or organic or inorganic compound that facilitates traversing a lipid bilayer, micelle, cell membrane, organelle membrane, or vesicle membrane. A PTD attached to another molecule, which can range from a small polar molecule to a large macromolecule and/or a nanoparticle, facilitates the molecule traversing a membrane, for example going from extracellular space to intracellular space, or cytosol to within an organelle.
[0128] In some embodiments, a PTD is covalently linked to the amino terminus of a polypeptide (e.g., linked to a wild-type Cas12f4 to generate a fusion protein, or linked to a variant Cas12f4 polypeptide such as a mutant dCas12f4, mutant nickase Cas12f4, or chimeric variant Cas12f4 protein or variant Cas12f4 fusion polypeptide to generate a fusion protein). In some embodiments, a PTD is covalently linked to the carboxyl terminus of a polypeptide (e.g., linked to a wild-type Cas12f4 to generate a fusion protein, or linked to a variant Cas12f4 polypeptide such as a mutant dCas12f4, mutant nickase Cas12f4, or chimeric variant Cas12f4 protein or variant Cas12f4 fusion polypeptide to generate a fusion protein). In some embodiments, the PTD is inserted internally in the Cas12f4 fusion polypeptide (i.e. is not at the N- or C-terminus of the Cas12f4 fusion polypeptide) at a suitable insertion site. In some embodiments, a subject Cas12f4 fusion polypeptide includes (is conjugated to, is fused to) one or more PTDs (e.g., two or more, three or more, four or more PTDs).
[0129] In some embodiments a PTD includes a nuclear localization signal (NLS) (e.g, in some embodiments 2 or more, 3 or more, 4 or more, or 5 or more NLSs). Thus, in some embodiments, a Cas12f4 fusion polypeptide includes one or more NLSs (e.g., 2 or more, 3 or more, 4 or more, or 5 or more NLSs). In some embodiments, a PTD is covalently linked to a nucleic acid (e.g., a Cas12f4 guide nucleic acid, a polynucleotide encoding a Cas12f4 guide nucleic acid, a polynucleotide encoding a Cas12f4 fusion polypeptide, a donor polynucleotide, etc.). Examples of PTDs include but are not limited to a minimal undecapeptide protein transduction domain; a polyarginine sequence comprising a number of arginines sufficient to direct entry into a cell (e.g., 3, 4, 5, 6, 7, 8, 9, 10, or 10-50 arginines); a VP22 domain (Zender et al. (2002) Cancer Gene Ther. 9 (6): 489-96); an Drosophila Antennapedia protein transduction domain (Noguchi et al. (2003) Diabetes 52 (7): 1732-1737); a truncated human calcitonin peptide (Trehin et al. (2004) Pharm. Research 21:1248-1256); polylysine (Wender et al. (2000) Proc. Natl. Acad. Sci. USA 97:13003-13008); and Transportan.
[0130] In some embodiments, the PTD is an activatable CPP (ACPP) (Aguilera et al. (2009) Integr Biol (Camb) June; 1 (5-6): 371-381). ACPPs comprise a polycationic CPP (e.g., Arg9 or R9) connected via a cleavable linker to a matching polyanion (e.g., Glu9 or E9), which reduces the net charge to nearly zero and thereby inhibits adhesion and uptake into cells. Upon cleavage of the linker, the polyanion is released, locally unmasking the polyarginine and its inherent adhesiveness, thus activating the ACPP to traverse the membrane.
[0131] In some embodiments, a subject variant Cas12f4 polypeptide of the present disclosure can be fused to a fusion partner via a linker polypeptide (e.g., one or more linker polypeptides). The linker polypeptide may have any of a variety of amino acid sequences. Proteins can be joined by a spacer peptide, generally of a flexible nature, although other chemical linkages are not excluded. Suitable linkers include polypeptides of between 4 amino acids and 40 amino acids in length, or between 4 amino acids and 25 amino acids in length. These linkers can be produced by using synthetic, linker-encoding oligonucleotides to couple the proteins, or can be encoded by a nucleic acid sequence encoding the fusion protein. Peptide linkers with a degree of flexibility can be used. The linking peptides may have virtually any amino acid sequence, bearing in mind that the preferred linkers will have a sequence that results in a generally flexible peptide. The use of small amino acids, such as glycine and alanine, are of use in creating a flexible peptide. The creation of such sequences is routine to those of skill in the art. A variety of different linkers are commercially available and are considered suitable for use.
[0132] In some embodiments, a variant Cas12f4 polypeptide or variant Cas12f4 fusion polypeptide of the present disclosure comprises a detectable label. Suitable detectable labels and/or moieties that can provide a detectable signal can include, but are not limited to, an enzyme, a radioisotope, a member of a specific binding pair; a fluorophore; a fluorescent protein; a quantum dot; and the like.
[0133] Suitable fluorescent proteins include, but are not limited to, green fluorescent protein (GFP) or variants thereof, blue fluorescent variant of GFP (BFP), cyan fluorescent variant of GFP (CFP), yellow fluorescent variant of GFP (YFP), enhanced GFP (EGFP), enhanced CFP (ECFP), enhanced YFP (EYFP), GFPS65T, Emerald, Topaz (TYFP), Venus, Citrine, mCitrine, GFPuv, destabilised EGFP (dEGFP), destabilised ECFP (dECFP), destabilised EYFP (dEYFP), mCFPm, Cerulean, T-Sapphire, CyPet, YPet, mKO, HcRed, t-HcRed, DsRed, DsRed2, DsRed-monomer, J-Red, dimer2, t-dimer2 (12), mRFPI, pocilloporin, Renilla GFP, Monster GFP, paGFP, Kaede protein and kindling protein, Phycobiliproteins and Phycobiliprotein conjugates including B-Phycoerythrin, R-Phycoerythrin and Allophycocyanin. Other examples of fluorescent proteins include mHoneydew, mBanana, mOrange, dTomato, tdTomato, mScarlett, mTangerine, mStrawberry, mCherry, mGrapel, mRaspberry, mGrape2, mPlum (Shaner et al. (2005) Nat. Methods 2:905-909), and the like. Any of a variety of fluorescent and colored proteins from Anthozoan species, as described in, e.g., Matz et al. (1999) Nature Biotechnol. 17:969-973, are suitable for use.
[0134] Suitable enzymes include, but are not limited to, horse radish peroxidase (HRP), alkaline phosphatase (AP), beta-galactosidase (GAL), glucose-6-phosphate dehydrogenase, beta-N-acetylglucosaminidase, -glucuronidase, invertase, Xanthine Oxidase, firefly luciferase, glucose oxidase (GO), and the like.
[0135] It is known in the art that a Cas12f4 protein binds to target DNA at a target sequence defined by the region of complementarity between the DNA-targeting RNA and the target DNA. As is the case for many CRISPR endonucleases, site-specific binding (and/or cleavage) of a double stranded target DNA occurs at locations determined by both (i) base-pairing complementarity between the guide RNA and the target DNA; and (ii) a short motif, referred to as the protospacer adjacent motif (PAM), in the target DNA.
[0136] In some embodiments, the PAM for a Cas12f4 protein is immediately 5 of the target sequence of the non-complementary strand of the target DNA (the complementary strand hybridizes to the guide sequence of the guide RNA while the non-complementary strand does not directly hybridize with the guide RNA and is the reverse complement of the complementary strand). In some embodiments (e.g., when Cas12f4 as described herein is used), the PAM consensus sequence of the non-complementary strand is T-rich. Examples of PAM sequences include, but are not limited to, TTN, wherein Nis A, G, T, or C. Corresponding guide RNAs and PAM sites for Cpf1 endonuclease are disclosed in US Patent Application Publication 2016/0208243 A1, which is incorporated herein by reference for its disclosure of DNA encoding Cpf1 endonucleases and guide RNAs and PAM sites.
[0137] In some embodiments, different Cas12f4 proteins (e.g., Cas12f4 proteins from various species) may be advantageous to use in the various provided methods in order to capitalize on various enzymatic characteristics of the different Cas12f4 proteins (e.g., for different PAM sequence preferences; for increased or decreased enzymatic activity; for an increased or decreased level of cellular toxicity; to change the balance between NHEJ, homology-directed repair, single strand breaks, double strand breaks, etc.; to take advantage of a short total sequence; and the like). Cas12f4 proteins may require different PAM sequences in the target DNA. Thus, for a particular Cas12f4 protein of choice, the PAM sequence requirement may be different than the T-rich sequence described above. Various methods (including in silico and/or wet lab methods) for identification of the appropriate PAM sequence are known in the art and are routine, and any convenient method can be used. A PAM sequence can be identified using a PAM depletion assay.
[0138] A nucleic acid molecule that binds to a Cas12f4 polypeptide, forming a ribonucleoprotein complex (RNP), and targets the complex to a specific location within a target nucleic acid (e.g., a target DNA) is referred to herein as a Cas12f4 guide RNA or simply as a guide RNA. It is to be understood that in some embodiments, a hybrid DNA/RNA can be made such that a Cas12f4 guide RNA includes DNA bases in addition to RNA bases, but the term Cas12f4 guide RNA is still used to encompass such a molecule herein.
[0139] A Cas12f4 guide RNA can be said to include two segments, a targeting segment and a protein-binding segment. The targeting segment of a Cas12f4 guide RNA includes a nucleotide sequence (a guide sequence) that is complementary to (and therefore hybridizes with) a specific sequence (a target site) within a target nucleic acid (e.g., a target ssRNA, a target ssDNA, the complementary strand of a double stranded target DNA, etc.). Site-specific binding and/or cleavage of a target nucleic acid (e.g., genomic DNA) can occur at locations (e.g., target sequence of a target locus) determined by base-pairing complementarity between the Cas12f4 guide RNA (the guide sequence of the Cas12f4 guide RNA) and the target nucleic acid.
[0140] The protein-binding segment (or protein-binding sequence) interacts with (binds to) a Cas12f4 polypeptide. In some embodiments the protein-binding segment is made up of a short sequence of 17-20 nucleotides, such as a sequence of 18 or 19 nucleotides. This protein binding segment forms a double-stranded RNA duplex of five paired residues in length. The 5 terminus has about three residues upstream from the first RNA duplexed residue. A stem structure of 4-5 residues separates the double stranded regions.
[0141] In some embodiments the protein-binding segment of a subject Cas12f4 guide RNA includes two complementary stretches of nucleotides that hybridize to one another to form a double stranded RNA duplex (dsRNA duplex). A Cas12f4 guide RNA and a Cas12f4 polypeptide, e.g., a fusion Cas12f4 polypeptide, form a complex (e.g., bind via non-covalent interactions). The Cas12f4 guide RNA provides target specificity to the complex by including a targeting segment, which includes a guide sequence (a nucleotide sequence that is complementary to a sequence of a target nucleic acid). The Cas12f4 polypeptide of the complex provides the site-specific activity (e.g., cleavage activity provided by the Cas12f4 polypeptide or Cas12f4 fusion polypeptide and/or an activity provided by the fusion partner in the case of a chimeric Cas12f4 protein or Cas12f4 fusion polypeptide). In other words, the Cas12f4 protein is guided to a target nucleic acid sequence (e.g., a target sequence) by virtue of its association with the Cas12f4 guide RNA.
[0142] The guide sequence also referred to as the targeting sequence of a Cas12f4 guide RNA can be made so that the Cas12f4 guide RNA can target a Cas12f4 protein (e.g., a wild-type Cas12f4 protein, a variant Cas12f4 polypeptide, a variant Cas12f4 fusion polypeptide (chimeric variant Cas12f4), and the like) to any desired sequence of any desired target nucleic acid, with the exception (e.g., as described herein) that the PAM sequence can be taken into account. Thus, for example, a Cas12f4 guide RNA can have a guide sequence with complementarity to (e.g., can hybridize to) a sequence in a nucleic acid in a eukaryotic cell, e.g., a viral nucleic acid, a eukaryotic nucleic acid (e.g., a eukaryotic chromosome, chromosomal sequence, a eukaryotic RNA, etc.), and the like.
[0143] The targeting segment of a subject Cas12f4 guide RNA includes a guide sequence (i.e. a targeting sequence), which is a nucleotide sequence that is complementary to a sequence (a target site) in a target nucleic acid. In other words, the targeting segment of a Cas12f4 guide RNA can interact with a target nucleic acid (e.g., double stranded DNA (dsDNA), single stranded DNA (ssDNA), single stranded RNA (ssRNA), or double stranded RNA (dsRNA)) in a sequence-specific manner via hybridization (i.e. base pairing). The guide sequence of a Cas12f4 guide RNA can be modified (e.g., by genetic engineering)/designed to hybridize to any desired target sequence (e.g., while taking the PAM into account, e.g., when targeting a dsDNA target) within a target nucleic acid (e.g., a eukaryotic target nucleic acid such as genomic DNA).
[0144] The present disclosure provides an engineered, non-naturally-occurring Cas12f4 system. In certain embodiments, a Cas12f4 system of the present disclosure can comprise: a) a variant Cas12f4 polypeptide of the present disclosure and a Cas12f4 guide RNA; b) a variant Cas12f4 polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; c) a variant Cas12f4 fusion polypeptide of the present disclosure and a Cas12f4 guide RNA; d) a variant Cas12f4 fusion polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; e) an mRNA encoding a variant Cas12f4 polypeptide of the present disclosure; and a Cas12f4 guide RNA; f) an mRNA encoding a variant Cas12f4 polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; g) an mRNA encoding a variant Cas12f4 fusion polypeptide of the present disclosure; and a Cas12f4 guide RNA; h) an mRNA encoding a variant Cas12f4 fusion polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; i) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure and a nucleotide sequence encoding a Cas12f4 guide RNA; j) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, a nucleotide sequence encoding a Cas12f4 guide RNA, and a nucleotide sequence encoding a donor template nucleic acid; k) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure and a nucleotide sequence encoding a Cas12f4 guide RNA; 1) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, a nucleotide sequence encoding a Cas12f4 guide RNA, and a nucleotide sequence encoding a donor template nucleic acid; m) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; n) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; and a donor template nucleic acid; o) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; p) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; and a donor template nucleic acid; q) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, a nucleotide sequence encoding a first Cas12f4 guide RNA, and a nucleotide sequence encoding a second Cas12f4 guide RNA; or r) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, a nucleotide sequence encoding a first Cas12f4 guide RNA, and a nucleotide sequence encoding a second Cas12f4 guide RNA; or some variation of one of (a) through (r).
[0145] The present disclosure provides one or more nucleic acids comprising one or more of: a donor polynucleotide sequence, a nucleotide sequence encoding a variant Cas12f4 polypeptide (e.g., a variant Cas12f4 nuclease, a mutant nickase Cas12f4 protein, a mutant dCas12f4 protein, chimeric variant Cas12f4 protein, variant Cas12f4 fusion polypeptide, and the like), a Cas12f4 guide RNA, and a nucleotide sequence encoding a Cas12f4 guide RNA (which can include two separate nucleotide sequences in the case of dual guide RNA format or which can include a single nucleotide sequence in the case of single guide RNA format). The present disclosure provides a nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide. The present disclosure provides a recombinant expression vector that comprises a nucleotide sequence encoding a variant Cas12f4 polypeptide. The present disclosure provides a recombinant expression vector that comprises a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide. The present disclosure provides a recombinant expression vector that comprises: a) a nucleotide sequence encoding a variant Cas12f4 polypeptide; and b) a nucleotide sequence encoding a Cas12f4 guide RNA(s). The present disclosure provides a recombinant expression vector that comprises: a) a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide; and b) a nucleotide sequence encoding a Cas12f4 guide RNA(s). In some embodiments, the nucleotide sequence encoding the variant Cas12f4 polypeptide and/or the nucleotide sequence encoding the Cas12f4 guide RNA is operably linked to a promoter that is operable in a cell type of choice (e.g., a prokarytoic cell, a eukaryotic cell, a plant cell, an animal cell, a mammalian cell, a primate cell, a rodent cell, a human cell, etc.).
[0146] In some embodiments, a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure is codon optimized. This type of optimization can entail a mutation of a Cas12f4-encoding nucleotide sequence to mimic the codon preferences of the intended host organism or cell while encoding the same protein. Thus, the codons can be changed, but the encoded protein remains unchanged. For example, if the intended target cell was a human cell, a human codon-optimized Cas12f4-encoding nucleotide sequence could be used. As another non-limiting example, if the intended host cell were a mouse cell, then a mouse codon-optimized Cas12f4-encoding nucleotide sequence could be generated. As another non-limiting example, if the intended host cell were a plant cell, then a plant codon-optimized Cas12f4-encoding nucleotide sequence could be generated. As another non-limiting example, if the intended host cell were an insect cell, then an insect codon-optimized Cas12f4-encoding nucleotide sequence could be generated.
[0147] The present disclosure provides one or more recombinant expression vectors that include (in different recombinant expression vectors in some embodiments, and in the same recombinant expression vector in some embodiments): (i) a nucleotide sequence of a donor template nucleic acid (where the donor template comprises a nucleotide sequence having homology to a target sequence of a target nucleic acid (e.g., a target genome)); (ii) a nucleotide sequence that encodes a Cas12f4 guide RNA that hybridizes to a target sequence of the target locus of the targeted genome (e.g., a single or dual guide RNA) (e.g., operably linked to a promoter that is operable in a target cell such as a eukaryotic cell); and (iii) a nucleotide sequence encoding a variant Cas12f4 polypeptide (e.g., operably linked to a promoter that is operable in a target cell such as a eukaryotic cell). The present disclosure provides one or more recombinant expression vectors that include (in different recombinant expression vectors in some embodiments, and in the same recombinant expression vector in some embodiments): (i) a nucleotide sequence of a donor template nucleic acid (where the donor template comprises a nucleotide sequence having homology to a target sequence of a target nucleic acid (e.g., a target genome)); and (ii) a nucleotide sequence that encodes a Cas12f4 guide RNA that hybridizes to a target sequence of the target locus of the targeted genome (e.g., a single or dual guide RNA) (e.g., operably linked to a promoter that is operable in a target cell such as a eukaryotic cell). The present disclosure provides one or more recombinant expression vectors that include (in different recombinant expression vectors in some embodiments, and in the same recombinant expression vector in some embodiments): (i) a nucleotide sequence that encodes a Cas12f4 guide RNA that hybridizes to a target sequence of the target locus of the targeted genome (e.g., a single or dual guide RNA) (e.g., operably linked to a promoter that is operable in a target cell such as a eukaryotic cell); and (ii) a nucleotide sequence encoding a variant Cas12f4 polypeptide (e.g., operably linked to a promoter that is operable in a target cell such as a eukaryotic cell).
[0148] Suitable expression vectors include viral expression vectors (e.g., viral vectors based on vaccinia virus; poliovirus; adenovirus (see, e.g., Li et al., Invest Opthalmol Vis Sci 35:2543 2549, 1994; Borras et al, Gene Ther 6:515 524, 1999; Li and Davidson, PNAS 92:7700 7704, 1995; Sakamoto et al., H Gene Ther 5:1088 1097, 1999; WO 94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984 and WO 95/00655); adeno-associated virus (AAV) (see, e.g., Ali et al., Hum Gene Ther 9:81 86, 1998, Flannery et al., PNAS 94:6916 6921, 1997; Bennett et al., Invest Opthalmol Vis Sci 38:2857 2863, 1997; Jomary et al., Gene Ther 4:683 690, 1997, Rolling et al., Hum Gene Ther 10:641 648, 1999; Ali et al., Hum Mol Genet 5:591 594, 1996; Srivastava in WO 93/09239, Samulski et al., J. Vir. (1989) 63:3822-3828; Mendelson et al., Virol. (1988) 166:154-165; and Flotte et al., PNAS (1993) 90:10613-10617); SV40; herpes simplex virus; human immunodeficiency virus (see, e.g., Miyoshi et al., PNAS 94:10319 23, 1997; Takahashi et al., J Virol 73:7812 7816, 1999); a retroviral vector (e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, human immunodeficiency virus, myeloproliferative sarcoma virus, and mammary tumor virus); and the like. In some embodiments, a recombinant expression vector of the present disclosure is a recombinant adeno-associated virus (AAV) vector. In some embodiments, a recombinant expression vector of the present disclosure is a recombinant lentivirus vector. In some embodiments, a recombinant expression vector of the present disclosure is a recombinant retroviral vector.
[0149] Depending on the host/vector system utilized, any of a number of suitable transcription and translation control elements, including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc. may be used in the expression vector.
[0150] In some embodiments, a nucleotide sequence encoding a Cas12f4 guide RNA is operably linked to a control element, e.g., a transcriptional control element, such as a promoter. In some embodiments, a nucleotide sequence encoding a variant Cas12f4 polypeptide or a variant Cas12f4 fusion polypeptide is operably linked to a control element, e.g., a transcriptional control element, such as a promoter.
[0151] The transcriptional control element can be a promoter. In some embodiments, the promoter is a constitutively active promoter. In some embodiments, the promoter is a regulatable promoter. In some embodiments, the promoter is an inducible promoter. In some embodiments, the promoter is a tissue-specific promoter. In some embodiments, the promoter is a cell type-specific promoter. In some embodiments, the transcriptional control element (e.g., the promoter) is functional in a targeted cell type or targeted cell population. For example, in some embodiments, the transcriptional control element can be functional in eukaryotic cells, e.g., hematopoietic stem cells (e.g., mobilized peripheral blood (mPB) CD34 (+) cell, bone marrow (BM) CD34 (+) cell, etc.).
[0152] Nonlimiting examples of eukaryotic promoters (promoters functional in a eukaryotic cell) include EF1a, those from cytomegalovirus (CMV) immediate early, herpes simplex virus (HSV) thymidine kinase, early and late SV40, long terminal repeats (LTRs) from retrovirus, and mouse metallothionein-I. Selection of the appropriate vector and promoter is well within the level of ordinary skill in the art. The expression vector may also contain a ribosome binding site for translation initiation and a transcription terminator. The expression vector may also include appropriate sequences for amplifying expression. The expression vector may also include nucleotide sequences encoding protein tags (e.g., 6xHis tag, hemagglutinin tag, fluorescent protein, etc.) that can be fused to the variant Cas12f4 polypeptide, thus resulting in a chimeric variant Cas12f4 polypeptide or variant Cas12f4 fusion polypeptide.
[0153] In some embodiments, a nucleotide sequence encoding a Cas12f4 guide RNA and/or a variant Cas12f4 fusion polypeptide is operably linked to an inducible promoter. In some embodiments, a nucleotide sequence encoding a Cas12f4 guide RNA and/or a variant Cas12f4 fusion protein is operably linked to a constitutive promoter.
[0154] A promoter can be a constitutively active promoter (i.e. a promoter that is constitutively in an active/ON state), it may be an inducible promoter (i.e. a promoter whose state, active/ON or inactive/OFF, is controlled by an external stimulus, e.g., the presence of a particular temperature, compound, or protein.), it may be a spatially restricted promoter (e.g., transcriptional control element, enhancer, etc.) (e.g., tissue specific promoter, cell type specific promoter, etc.), and it may be a temporally restricted promoter (e.g., the promoter is in the ON state or OFF state during specific stages of embryonic development or during specific stages of a biological process, e.g., hair follicle cycle in mice).
[0155] Suitable promoters can be derived from viruses and can therefore be referred to as viral promoters, or they can be derived from any organism, including prokaryotic or eukaryotic organisms. Suitable promoters can be used to drive expression by any RNA polymerase (e.g., pol I, pol II, pol III). Exemplary promoters include, but are not limited to the SV40 early promoter, mouse mammary tumor virus long terminal repeat (LTR) promoter; adenovirus major late promoter (Ad MLP); a herpes simplex virus (HSV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter region (CMVIE), a rous sarcoma virus (RSV) promoter, a human U6 small nuclear promoter (U6) (Miyagishi et al., Nature Biotechnology 20, 497-500 (2002)), an enhanced U6 promoter (e.g., Xia et al., Nucleic Acids Res. 2003 Sep. 1; 31 (17)), a human HI promoter (HI), and the like.
[0156] In some embodiments, a nucleotide sequence encoding a Cas12f4 guide RNA is operably linked to (under the control of) a promoter operable in a eukaryotic cell (e.g., a U6 promoter, an enhanced U6 promoter, an HI promoter, and the like). As would be understood by one of ordinary skill in the art, when expressing an RNA (e.g., a guide RNA) from a nucleic acid (e.g., an expression vector) using a U6 promoter (e.g., in a eukaryotic cell), or another PolIII promoter, the RNA may need to be mutated if there are several Ts in a row (coding for Us in the RNA). This is because a string of Ts (e.g., 5 Ts) in DNA can act as a terminator for polymerase III (PolIII). Thus, in order to ensure transcription of a guide RNA (e.g., the crRNA portion and/or spacer portion, in single guide format) in a eukaryotic cell it may sometimes be necessary to modify the sequence encoding the guide RNA to eliminate runs of Ts. In some embodiments, a nucleotide sequence encoding a Cas12f4 protein (e.g., a variant Cas12f4 polypeptide, a mutant nickase Cas12f4 polypeptide, a mutant dCas12f4 polypeptide, a chimeric variant Cas12f4 protein, variant Cas12f4 fusion polypeptide, and the like) is operably linked to a promoter operable in a eukaryotic cell (e.g., a CMV promoter, an EF1a promoter, an estrogen receptor-regulated promoter, and the like).
[0157] Examples of inducible promoters include, but are not limited to T7 RNA polymerase promoter, T3 RNA polymerase promoter, Isopropyl-beta-D-thiogalactopyranoside (IPTG)-regulated promoter, lactose induced promoter, heat shock promoter, Tetracycline-regulated promoter, Steroid-regulated promoter, Metal-regulated promoter, estrogen receptor-regulated promoter, etc. Inducible promoters can therefore be regulated by molecules including, but not limited to, doxycycline; estrogen and/or an estrogen analog; IPTG; etc.
[0158] Inducible promoters suitable for use include any inducible promoter described herein or known to one of ordinary skill in the art. Examples of inducible promoters include, without limitation, chemically/biochemically-regulated and physically-regulated promoters such as alcohol-regulated promoters, tetracycline-regulated promoters (e.g., anhydrotetracycline (aTc)-responsive promoters and other tetracycline-responsive promoter systems, which include a tetracycline repressor protein (tetR), a tetracycline operator sequence (tetO) and a tetracycline transactivator fusion protein (tTA)), steroid-regulated promoters (e.g., promoters based on the rat glucocorticoid receptor, human estrogen receptor, moth ecdysone receptors, and promoters from the steroid/retinoid/thyroid receptor superfamily), metal-regulated promoters (e.g., promoters derived from metallothionein (proteins that bind and sequester metal ions) genes from yeast, mouse and human), pathogenesis-regulated promoters (e.g., induced by salicylic acid, ethylene or benzothiadiazole (BTH)), temperature/heat-inducible promoters (e.g., heat shock promoters), and light-regulated promoters (e.g., light responsive promoters from plant cells).
[0159] In some embodiments, the promoter is a spatially restricted promoter (e.g., cell type specific promoter, tissue specific promoter, etc.) such that in a multi-cellular organism, the promoter is active (i.e. ON) in a subset of specific cells. Spatially restricted promoters may also be referred to as enhancers, transcriptional control elements, control sequences, etc. Any convenient spatially restricted promoter may be used as long as the promoter is functional in the targeted host cell (e.g., eukaryotic cell; prokaryotic cell). In some embodiments, the promoter is a reversible promoter. Suitable reversible promoters, including reversible inducible promoters are known in the art. Such reversible promoters may be isolated and derived from many organisms, e.g., eukaryotes and prokaryotes. Modification of reversible promoters derived from a first organism for use in a second organism, e.g., a first prokaryote and a second a eukaryote, a first eukaryote and a second a prokaryote, etc., is well known in the art. Such reversible promoters, and systems based on such reversible promoters but also comprising additional control proteins, include, but are not limited to, alcohol regulated promoters (e.g., alcohol dehydrogenase I (alcA) gene promoter, promoters responsive to alcohol transactivator proteins (AlcR), etc.), tetracycline regulated promoters, (e.g., promoter systems including Tet Activators, TetON, TetOFF, etc.), steroid regulated promoters (e.g., rat glucocorticoid receptor promoter systems, human estrogen receptor promoter systems, retinoid promoter systems, thyroid promoter systems, ecdysone promoter systems, mifepristone promoter systems, etc.), metal regulated promoters (e.g., metallothionein promoter systems, etc.), pathogenesis-related regulated promoters (e.g., salicylic acid regulated promoters, ethylene regulated promoters, benzothiadiazole regulated promoters, etc.), temperature regulated promoters (e.g., heat shock inducible promoters (e.g., HSP-70, HSP-90, soybean heat shock promoter, etc.), light regulated promoters, synthetic inducible promoters, and the like.
[0160] Methods of introducing a nucleic acid (e.g., a nucleic acid comprising a donor polynucleotide sequence, one or more nucleic acids encoding a variant Cas12f4 polypeptide and/or a Cas12f4 guide RNA, and the like) into a host cell are known in the art, and any convenient method can be used to introduce a nucleic acid (e.g., an expression construct) into a cell. Suitable methods include e.g., viral infection, transfection, lipofection, electroporation, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran mediated transfection, liposome-mediated transfection, particle gun technology, calcium phosphate precipitation, direct microinjection, nanoparticle-mediated nucleic acid delivery, and the like.
[0161] Introducing the recombinant expression vector into cells can occur in any culture media and under any culture conditions that promote the survival of the cells. Introducing the recombinant expression vector into a target cell can be carried out in vivo or ex vivo. Introducing the recombinant expression vector into a target cell can be carried out in vitro.
[0162] In some embodiments, a variant Cas12f4 polypeptide can be provided as RNA. The RNA can be provided by direct chemical synthesis or may be transcribed in vitro from a DNA (e.g., encoding the variant Cas12f4 polypeptide). Once synthesized, the RNA may be introduced into a cell by any of the well-known techniques for introducing nucleic acids into cells (e.g., microinjection, electroporation, transfection, etc.).
[0163] Nucleic acids may be provided to the cells using well-developed transfection techniques; see, e.g., Angel and Yanik (2010) PLOS ONE 5 (7): el 1756, and the commercially available TransMessenger reagents from Qiagen, STEMFECT RNA Transfection Kit from Stemgent, and TRANSIT-mRNA Transfection Kit from Mirus Bio LLC. See also Beumer et al. (2008) PNAS 105 (50): 19821-19826.
[0164] Vectors may be provided directly to a target host cell. In other words, the cells are contacted with vectors comprising the subject nucleic acids (e.g., recombinant expression vectors having the donor template sequence and encoding the Cas12f4 guide RNA; recombinant expression vectors encoding the variant Cas12f4 polypeptide; etc.) such that the vectors are taken up by the cells. Methods for contacting cells with nucleic acid vectors that are plasmids, including electroporation, calcium chloride transfection, microinjection, and lipofection are well known in the art. For viral vector delivery, cells can be contacted with viral particles comprising the subject viral expression vectors.
[0165] Retroviruses, for example, lentiviruses, are suitable for use in methods of the present disclosure. Commonly used retroviral vectors are defective, e.g., unable to produce viral proteins required for productive infection. Rather, replication of the vector requires growth in a packaging cell line. To generate viral particles comprising nucleic acids of interest, the retroviral nucleic acids comprising the nucleic acid are packaged into viral capsids by a packaging cell line. Different packaging cell lines provide a different envelope protein (ecotropic, amphotropic or xenotropic) to be incorporated into the capsid, this envelope protein determining the specificity of the viral particle for the cells (ecotropic for murine and rat; amphotropic for most mammalian cell types including human, dog and mouse; and xenotropic for most mammalian cell types except murine cells). The appropriate packaging cell line may be used to ensure that the cells are targeted by the packaged viral particles. Methods of introducing subject vector expression vectors into packaging cell lines and of collecting the viral particles that are generated by the packaging lines are well known in the art. Nucleic acids can also introduced by direct micro-injection (e.g., injection of RNA).
[0166] Vectors used for providing the nucleic acids encoding Cas12f4 guide RNA and/or a variant Cas12f4 polypeptide to a target host cell can include suitable promoters for driving the expression, that is, transcriptional activation, of the nucleic acid of interest. In other words, in some embodiments, the nucleic acid of interest will be operably linked to a promoter. This may include ubiquitously acting promoters, for example, the CMVactin promoter, or inducible promoters, such as promoters that are active in particular cell populations or that respond to the presence of drugs such as tetracycline. By transcriptional activation, it is intended that transcription will be increased above basal levels in the target cell by 10 fold, by 100 fold, more usually by 1000 fold. In addition, vectors used for providing a nucleic acid encoding a Cas12f4 guide RNA and/or a variant Cas12f4 polypeptide to a cell may include nucleic acid sequences that encode for selectable markers in the target cells, so as to identify cells that have taken up the Cas12f4 guide RNA and/or variant Cas12f4 polypeptide.
[0167] A nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide, or a variant Cas12f4 fusion polypeptide, is in some embodiments an RNA. Thus, a variant Cas12f4 fusion protein can be introduced into cells as RNA. Methods of introducing RNA into cells are known in the art and may include, for example, direct injection, transfection, or any other method used for the introduction of DNA. A Cas12f4 protein may instead be provided to cells as a polypeptide. Such a polypeptide may optionally be fused to a polypeptide domain that increases solubility of the product. The domain may be linked to the polypeptide through a defined protease cleavage site, e.g., a TEV sequence, which is cleaved by TEV protease. The linker may also include one or more flexible sequences, e.g., from 1 to 10 glycine residues. In some embodiments, the cleavage of the fusion protein is performed in a buffer that maintains solubility of the product, e.g., in the presence of from 0.5 to 2 M urea, in the presence of polypeptides and/or polynucleotides that increase solubility, and the like. Domains of interest include endosomolytic domains, e.g. influenza HA domain; and other polypeptides that aid in production, e.g., IF2 domain, GST domain, GRPE domain, and the like. The polypeptide may be formulated for improved stability. For example, the peptides may be PEGylated, where the polyethyleneoxy group provides for enhanced lifetime in the blood stream.
[0168] Additionally or alternatively, a variant Cas12f4 polypeptide of the present disclosure may be fused to a polypeptide permeant domain to promote uptake by the cell. A number of permeant domains are known in the art and may be used in the non-integrating polypeptides of the present disclosure, including peptides, peptidomimetics, and non-peptide carriers. For example, a permeant peptide may be derived from the third alpha helix of Drosophila melanogaster transcription factor Antennapaedia, referred to as penetratin, which comprises the amino acid sequence of SEQ ID NO: 202. As another example, the permeant peptide comprises the HIV-1 tat basic region amino acid sequence, which may include, for example, amino acids 49-57 of naturally-occurring tat protein. Other permeant domains include poly-arginine motifs, for example, the region of amino acids 34-56 of HIV-1 rev protein, nona-arginine, octa-arginine, and the like. (See, for example, Futaki et al. (2003) Curr Protein Pept Sci. 2003 April; 4 (2): 87-9 and 446; and Wender et al. (2000) Proc. Natl. Acad. Sci. U.S.A 2000 Nov. 21; 97 (24): 13003-8; published U.S. Patent applications 20030220334; 20030083256; 20030032593; and 20030022831, herein specifically incorporated by reference for the teachings of translocation peptides and peptoids). The nona-arginine (R9) sequence is one of the more efficient PTDs that have been characterized (Wender et al. 2000; Uemura et al. 2002). The site at which the fusion is made may be selected in order to optimize the biological activity, secretion or binding characteristics of the polypeptide. The optimal site will be determined by routine experimentation.
[0169] A variant Cas12f4 polypeptide of the present disclosure may be produced in vitro or by eukaryotic cells or by prokaryotic cells, and it may be further processed by unfolding, e.g., heat denaturation, dithiothreitol reduction, etc. and may be further refolded, using methods known in the art. Modifications of interest that do not alter primary sequence include chemical derivatization of polypeptides, e.g., acylation, acetylation, carboxylation, amidation, etc. Also included are modifications of glycosylation, e.g., those made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing or in further processing steps; e.g., by exposing the polypeptide to enzymes which affect glycosylation, such as mammalian glycosylating or deglycosylating enzymes. Also embraced are sequences that have phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine, or phosphothreonine.
[0170] Also suitable for inclusion in embodiments of the present disclosure are nucleic acids (e.g., encoding a Cas12f4 guide RNA, encoding a variant Cas12f4 fusion polypeptide, etc.) and proteins (e.g., a variant Cas12f4 fusion protein derived from a wild-type protein or a variant protein) that have been modified using ordinary molecular biological techniques and synthetic chemistry so as to improve their resistance to proteolytic degradation, to change the target sequence specificity, to optimize solubility properties, to alter protein activity (e.g., transcription modulatory activity, enzymatic activity, etc.) or to render them more suitable. Analogs of such polypeptides include those containing residues other than naturally-occurring L-amino acids, e.g., D-amino acids or non-naturally-occurring synthetic amino acids. D-amino acids may be substituted for some or all of the amino acid residues.
[0171] A variant Cas12f4 polypeptide of the present disclosure may be prepared by in vitro synthesis, using conventional methods as known in the art. Various commercial synthetic apparatuses are available, for example, automated synthesizers by Applied Biosystems, Inc., Beckman, etc. By using synthesizers, naturally-occurring amino acids may be substituted with unnatural amino acids. The particular sequence and the manner of preparation will be determined by convenience, economics, purity required, and the like.
[0172] If desired, various groups may be introduced into the peptide during synthesis or during expression, which allow for linking to other molecules or to a surface. Thus, cysteines can be used to make thioethers, histidines for linking to a metal ion complex, carboxyl groups for forming amides or esters, amino groups for forming amides, and the like.
[0173] A variant Cas12f4 polypeptide of the present disclosure may also be isolated and purified in accordance with conventional methods of recombinant synthesis. A lysate may be prepared of the expression host and the lysate purified using high performance liquid chromatography (HPLC), exclusion chromatography, gel electrophoresis, affinity chromatography, or other purification technique. For the most part, the compositions which are used will comprise 20% or more by weight of the desired product, more usually 75% or more by weight, preferably 95% or more by weight, and for therapeutic purposes, usually 99.5% or more by weight, in relation to contaminants related to the method of preparation of the product and its purification. Usually, the percentages will be based upon total protein. Thus, in some embodiments, a variant Cas12f4 polypeptide, or a variant Cas12f4 fusion polypeptide, of the present disclosure is at least 80% pure, at least 85% pure, at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure (e.g., free of contaminants, non-Cas12f4 proteins or other macromolecules, etc.).
[0174] To induce cleavage or any desired modification to a target nucleic acid (e.g., genomic DNA), or any desired modification to a polypeptide associated with target nucleic acid, the Cas12f4 guide RNA and/or the variant Cas12f4 polypeptide of the present disclosure and/or the donor template sequence, whether they be introduced as nucleic acids or polypeptides, are provided to the cells for about 30 minutes to about 24 hours, e.g., 1 hour, 1.5 hours, 2 hours, 2.5 hours, 3 hours, 3.5 hours 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 12 hours, 16 hours, 18 hours, 20 hours, or any other period from about 30 minutes to about 24 hours, which may be repeated with a frequency of about every day to about every 4 days, e.g., every 1.5 days, every 2 days, every 3 days, or any other frequency from about every day to about every four days. The agent(s) may be provided to the subject cells one or more times, e.g., one time, twice, three times, or more than three times, and the cells allowed to incubate with the agent(s) for some amount of time following each contacting event e.g., 16-24 hours, after which time the media is replaced with fresh media and the cells are cultured further.
[0175] In cases in which two or more different targeting complexes are provided to the cell (e.g., two different Cas12f4 guide RNAs that are complementary to different sequences within the same or different target nucleic acid), the complexes may be provided simultaneously (e.g., as two polypeptides and/or nucleic acids), or delivered simultaneously. Alternatively, they may be provided consecutively, e.g., the targeting complex being provided first, followed by the second targeting complex, etc. or vice versa.
[0176] To improve the delivery of a DNA vector into a target cell, the DNA can be protected from damage and its entry into the cell facilitated, for example, by using lipoplexes and polyplexes. Thus, in some embodiments, a nucleic acid of the present disclosure (e.g., a recombinant expression vector of the present disclosure) can be covered with lipids in an organized structure like a micelle or a liposome. When the organized structure is complexed with DNA it is called a lipoplex. There are three types of lipids, anionic (negatively-charged), neutral, or cationic (positively-charged). Lipoplexes that utilize cationic lipids have proven utility for gene transfer. Cationic lipids, due to their positive charge, naturally complex with the negatively charged DNA. Also as a result of their charge, they interact with the cell membrane. Endocytosis of the lipoplex then occurs, and the DNA is released into the cytoplasm. The cationic lipids also protect against degradation of the DNA by the cell.
[0177] Complexes of polymers with DNA are called polyplexes. Most polyplexes consist of cationic polymers and their production is regulated by ionic interactions. One large difference between the methods of action of polyplexes and lipoplexes is that polyplexes cannot release their DNA load into the cytoplasm, so to this end, co-transfection with endosome-lytic agents (to lyse the endosome that is made during endocytosis) such as inactivated adenovirus must occur. However, this is not always the case; polymers such as polyethylenimine have their own method of endosome disruption as does chitosan and trimethylchitosan.
[0178] Dendrimers, a highly branched macromolecule with a spherical shape, may be also be used to genetically modify stem cells. The surface of the dendrimer particle may be functionalized to alter its properties. In particular, it is possible to construct a cationic dendrimer (i.e. one with a positive surface charge). When in the presence of genetic material such as a DNA plasmid, charge complementarity leads to a temporary association of the nucleic acid with the cationic dendrimer. On reaching its destination, the dendrimer-nucleic acid complex can be taken up into a cell by endocytosis.
[0179] In some embodiments, a nucleic acid of the disclosure (e.g., an expression vector) includes an insertion site for a guide sequence of interest. For example, a nucleic acid can include an insertion site for a guide sequence of interest, where the insertion site is immediately adjacent to a nucleotide sequence encoding the portion of a Cas12f4 guide RNA that does not change when the guide sequence is changed to hybridize to a desired target sequence (e.g., sequences that contribute to the Cas12f4 binding aspect of the guide RNA, e.g, the sequences that contribute to the dsRNA duplex(es) of the Cas12f4 guide RNAthis portion of the guide RNA can also be referred to as the scaffold or constant region of the guide RNA). Thus, in some embodiments, a subject nucleic acid (e.g., an expression vector) includes a nucleotide sequence encoding a Cas12f4 guide RNA, except that the portion encoding the guide sequence portion of the guide RNA is an insertion sequence (an insertion site). An insertion site is any nucleotide sequence used for the insertion of a desired sequence. Insertion sites for use with various technologies are known to those of ordinary skill in the art and any convenient insertion site can be used. An insertion site can be for any method for manipulating nucleic acid sequences. For example, in some embodiments the insertion site is a multiple cloning site (MCS) (e.g., a site including one or more restriction enzyme recognition sequences), a site for ligation independent cloning, a site for recombination based cloning (e.g., recombination based on att sites), a nucleotide sequence recognized by a CRISPR/Cas (e.g., Cas9) based technology, and the like.
[0180] An insertion site can be any desirable length, and can depend on the type of insertion site (e.g., can depend on whether (and how many) the site includes one or more restriction enzyme recognition sequences, whether the site includes a target site for a CRISPR/Cas protein, etc.). In some embodiments, an insertion site of a subject nucleic acid is 3 or more nucleotides (nt) in length (e.g., 5 or more, 8 or more, 10 or more, 15 or more, 17 or more, 18 or more, 19 or more, 20 or more, 25 or more, or 30 or more nt in length). In some embodiments, the length of an insertion site of a subject nucleic acid has a length in a range of from 2 to 50 nucleotides (nt) (e.g., from 2 to 40 nt, from 2 to 30 nt, from 2 to 25 nt, from 2 to 20 nt, from 5 to 50 nt, from 5 to 40 nt, from 5 to 30 nt, from 5 to 25 nt, from 5 to 20 nt, from 10 to 50 nt, from 10 to 40 nt, from 10 to 30 nt, from 10 to 25 nt, from 10 to 20 nt, from 17 to 50 nt, from 17 to 40 nt, from 17 to 30 nt, from 17 to 25 nt). In some embodiments, the length of an insertion site of a subject nucleic acid has a length in a range of from 5 to 40 nt.
[0181] In some embodiments, a subject nucleic acid (e.g., a Cas12f4 guide RNA) has one or more modifications, e.g., a base modification, a backbone modification, etc., to provide the nucleic acid with a new or enhanced feature (e.g., improved stability). A nucleoside is a base-sugar combination. The base portion of the nucleoside is normally a heterocyclic base. The two most common classes of such heterocyclic bases are the purines and the pyrimidines. Nucleotides are nucleosides that further include a phosphate group covalently linked to the sugar portion of the nucleoside. For those nucleosides that include a pentofuranosyl sugar, the phosphate group can be linked to the 2, the 3, or the 5 hydroxyl moiety of the sugar. In forming oligonucleotides, the phosphate groups covalently link adjacent nucleosides to one another to form a linear polymeric compound. In turn, the respective ends of this linear polymeric compound can be further joined to form a circular compound. However, linear compounds are also suitable. In addition, linear compounds may have internal nucleotide base complementarity and may therefore fold in a manner as to produce a fully or partially double-stranded compound. Within oligonucleotides, the phosphate groups are commonly referred to as forming the internucleoside backbone of the oligonucleotide. The normal linkage or backbone of RNA and DNA is a 3 to 5 phosphodiester linkage.
[0182] Suitable nucleic acid modifications include, but are not limited to: 2-O-methyl modified nucleotides, 2 Fluoro modified nucleotides, locked nucleic acid (LNA) modified nucleotides, peptide nucleic acid (PNA) modified nucleotides, nucleotides with phosphorothioate linkages, and a 5 cap (e.g., a 7-methylguanylate cap (m7G)). Additional details and additional modifications are described below.
[0183] A 2-O-Methyl modified nucleotide (also referred to as 2-O-Methyl RNA) is a naturally-occurring modification of RNA found in tRNA and other small RNAs that arises as a post-transcriptional modification. Oligonucleotides can be directly synthesized that contain 2-O-Methyl RNA. This modification increases Tm of RNA: RNA duplexes but results in only small changes in RNA: DNA stability. It is stabile with respect to attack by single-stranded ribonucleases and is typically 5 to 10-fold less susceptible to DNases than DNA. It is commonly used in antisense oligos as a means to increase stability and binding affinity to the target message.
[0184] 2 Fluoro modified nucleotides (e.g., 2 Fluoro bases) have a fluorine modified ribose which increases binding affinity (Tm) and also confers some relative nuclease resistance when compared to native RNA. These modifications are commonly employed in ribozymes and siRNAs to improve stability in serum or other biological fluids. LNA bases have a modification to the ribose backbone that locks the base in the C3-endo position, which favors RNA A-type helix duplex geometry. This modification significantly increases Tm and is also very nuclease resistant. Multiple LNA insertions can be placed in an oligo at any position except the 3-end. Applications have been described ranging from antisense oligos to hybridization probes to SNP detection and allele specific PCR. Due to the large increase in Tm conferred by LNAs, they also can cause an increase in primer dimer formation as well as self-hairpin formation. In some embodiments, the number of LNAs incorporated into a single oligo is 10 bases or less.
[0185] The phosphorothioate (PS) bond (i.e. a phosphorothioate linkage) substitutes a sulfur atom for a non-bridging oxygen in the phosphate backbone of a nucleic acid (e.g., an oligo). This modification renders the internucleotide linkage resistant to nuclease degradation. Phosphorothioate bonds can be introduced between the last 3-5 nucleotides at the 5- or 3-end of the oligo to inhibit exonuclease degradation. Including phosphorothioate bonds within the oligo (e.g., throughout the entire oligo) can help reduce attack by endonucleases as well.
[0186] In some embodiments, a subject nucleic acid has one or more nucleotides that are 2-O-Methyl modified nucleotides. In some embodiments, a subject nucleic acid (e.g., a dsRNA, a siRNA, etc.) has one or more 2 Fluoro modified nucleotides. In some embodiments, a subject nucleic acid (e.g., a dsRNA, a siRNA, etc.) has one or more LNA bases. In some embodiments, a subject nucleic acid (e.g., a dsRNA, a siRNA, etc.) has one or more nucleotides that are linked by a phosphorothioate bond (i.e. the subject nucleic acid has one or more phosphorothioate linkages). In some embodiments, a subject nucleic acid (e.g., a dsRNA, a siRNA, etc.) has a 5 cap (e.g., a 7-methylguanylate cap (m7G)). In some embodiments, a subject nucleic acid (e.g., a dsRNA, a siRNA, etc.) has a combination of modified nucleotides. For example, a subject nucleic acid (e.g., a dsRNA, a siRNA, etc.) can have a 5 cap (e.g., a 7-methylguanylate cap (m7G)) in addition to having one or more nucleotides with other modifications (e.g., a 2-O-Methyl nucleotide and/or a 2 Fluoro modified nucleotide and/or a LNA base and/or a phosphorothioate linkage).
[0187] Examples of suitable nucleic acids (e.g., a Cas12f4 guide RNA) containing modifications include nucleic acids containing modified backbones or non-natural internucleoside linkages. Nucleic acids having modified backbones include those that retain a phosphorus atom in the backbone and those that do not have a phosphorus atom in the backbone.
[0188] Suitable modified oligonucleotide backbones containing a phosphorus atom therein include, for example, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates including 3-alkylene phosphonates, 5-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3-amino phosphoramidate and aminoalkylphosphoramidates, phosphorodiamidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, selenophosphates and boranophosphates having normal 3-5 linkages, 2-5 linked analogs of these, and those having inverted polarity wherein one or more internucleotide linkages is a 3 to 3, 5 to 5 or 2 to 2 linkage. Suitable oligonucleotides having inverted polarity comprise a single 3 to 3 linkage at the 3-most internucleotide linkage e.g., a single inverted nucleoside residue which may be a basic (the nucleobase is missing or has a hydroxyl group in place thereof). Various salts (such as, for example, potassium or sodium), mixed salts and free acid forms are also included.
[0189] In some embodiments, a subject nucleic acid comprises one or more phosphorothioate and/or heteroatom internucleoside linkages, in particular CH.sub.2NHOCH.sub.2, CH.sub.2N(CH.sub.3)OCH.sub.2 (known as a methylene (methylimino) or MMI backbone), CH.sub.2ON(CH.sub.3)CH.sub.2, CH.sub.2N(CH.sub.3)N(CH.sub.3)CH.sub.2 and ON(CH.sub.3)CH.sub.2CH.sub.2 (wherein the native phosphodiester internucleotide linkage is represented as OP(O)(OH)OCH.sub.2). MMI type internucleoside linkages are disclosed in the above referenced U.S. Pat. No. 5,489,677, the disclosure of which is incorporated herein by reference in its entirety. Suitable amide internucleoside linkages are disclosed in U.S. Pat. No. 5,602,240, the disclosure of which is incorporated herein by reference in its entirety.
[0190] Also suitable are nucleic acids having morpholino backbone structures as described in, e.g., U.S. Pat. No. 5,034,506. For example, in some embodiments, a subject nucleic acid comprises a 6-membered morpholino ring in place of a ribose ring. In some of these embodiments, a phosphorodiamidate or other non-phosphodiester internucleoside linkage replaces a phosphodiester linkage.
[0191] Suitable modified polynucleotide backbones that do not include a phosphorus atom therein have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages. These include those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones; formacetyl and thioformacetyl backbones; methylene formacetyl and thioformacetyl backbones; riboacetyl backbones; alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; and others having mixed N, O, S and CH.sub.2 component parts.
[0192] A subject nucleic acid can be a nucleic acid mimetic. The term mimetic as it is applied to polynucleotides is intended to include polynucleotides wherein only the furanose ring or both the furanose ring and the internucleotide linkage are replaced with non-furanose groups. Replacement of only the furanose ring is also referred to in the art as being a sugar surrogate. The heterocyclic base moiety or a modified heterocyclic base moiety is maintained for hybridization with an appropriate target nucleic acid. One such nucleic acid, a polynucleotide mimetic that has been shown to have excellent hybridization properties, is referred to as a peptide nucleic acid (PNA). In PNA, the sugar-backbone of a polynucleotide is replaced with an amide containing backbone, in particular an aminoethylglycine backbone. The nucleotides are retained and are bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone.
[0193] One polynucleotide mimetic that has been reported to have excellent hybridization properties is a peptide nucleic acid (PNA). The backbone in PNA compounds is two or more linked aminoethylglycine units which gives PNA an amide containing backbone. The heterocyclic base moieties are bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone. Representative U.S. patents that describe the preparation of PNA compounds include, but are not limited to: U.S. Pat. Nos. 5,539,082; 5,714,331; and 5,719,262, the disclosures of which are incorporated herein by reference in their entirety.
[0194] Another class of polynucleotide mimetic that has been studied is based on linked morpholino units (morpholino nucleic acid) having heterocyclic bases attached to the morpholino ring. A number of linking groups have been reported that link the morpholino monomeric units in a morpholino nucleic acid. One class of linking groups has been selected to give a non-ionic oligomeric compound. The non-ionic morpholino-based oligomeric compounds are less likely to have undesired interactions with cellular proteins. Morpholino-based polynucleotides are non-ionic mimics of oligonucleotides which are less likely to form undesired interactions with cellular proteins (Dwaine A. Braasch and David R. Corey, Biochemistry, 2002, 41 (14), 4503-4510). Morpholino-based polynucleotides are disclosed in U.S. Pat. No. 5,034,506, the disclosure of which is incorporated herein by reference in its entirety. A variety of compounds within the morpholino class of polynucleotides have been prepared, having a variety of different linking groups joining the monomeric subunits.
[0195] A further class of polynucleotide mimetic is referred to as cyclohexenyl nucleic acids (CeNA). The furanose ring normally present in a DNA/RNA molecule is replaced with a cyclohexenyl ring. CeNA DMT protected phosphoramidite monomers have been prepared and used for oligomeric compound synthesis following classical phosphoramidite chemistry. Fully modified CeNA oligomeric compounds and oligonucleotides having specific positions modified with CeNA have been prepared and studied (see Wang et al., Am. Chem. Soc, 2000, 122, 8595-8602, the disclosure of which is incorporated herein by reference in its entirety). In general the incorporation of CeNA monomers into a DNA chain increases stability of a DNA/RNA hybrid. CeNA oligoadenylates formed complexes with RNA and DNA complements with similar stability to the native complexes. The study of incorporating CeNA structures into natural nucleic acid structures was shown by NMR and circular dichroism to proceed with easy conformational adaptation.
[0196] A further modification includes Locked Nucleic Acids (LNAs) in which the 2-hydroxyl group is linked to the 4 carbon atom of the sugar ring thereby forming a 2-C,4-C-oxymethylene linkage thereby forming a bicyclic sugar moiety. The linkage can be a methylene (CH.sub.2), group bridging the 2 oxygen atom and the 4 carbon atom wherein n is 1 or 2 (Singh et al., Chem. Commun., 1998, 4, 455-456, the disclosure of which is incorporated herein by reference in its entirety). LNA and LNA analogs display very high duplex thermal stabilities with complementary DNA and RNA (Tm=+3 to +10 C.), stability towards 3-exonucleolytic degradation and good solubility properties. Potent and nontoxic antisense oligonucleotides containing LNAs have been described (e.g., Wahlestedt et al., Proc. Natl. Acad. Sci. U.S.A., 2000, 97, 5633-5638, the disclosure of which is incorporated herein by reference in its entirety).
[0197] The synthesis and preparation of the LNA monomers adenine, cytosine, guanine, 5-methyl-cytosine, thymine and uracil, along with their oligomerization, and nucleic acid recognition properties have been described (e.g., Koshkin et al., Tetrahedron, 1998, 54, 3607-3630, the disclosure of which is incorporated herein by reference in its entirety). LNAs and preparation thereof are also described in WO 98/39352 and WO 99/14226, as well as U.S. applications 20120165514, 20100216983, 20090041809, 20060117410, 20040014959, 20020094555, and 20020086998, the disclosures of which are incorporated herein by reference in their entirety.
[0198] A subject nucleic acid can also include one or more substituted sugar moieties. Suitable polynucleotides comprise a sugar substituent group selected from: OH; F; O-, S-, or N-alkyl; O-, S-, or N-alkenyl; O-, S- or N-alkynyl; or O-alkyl-O-alkyl, wherein the alkyl, alkenyl and alkynyl may be substituted or unsubstituted C.sub. 1 to do alkyl or C.sub.2 to do alkenyl and alkynyl. Particularly suitable are O ((CH.sub.2).sub.nO).sub.mCH.sub.3, O(CH.sub.2).sub.nOCH.sub.3, O(CH.sub.2).sub.nNH.sub.2, O(CH.sub.2).sub.nCH.sub.3, O(CH.sub.2).sub.nONH.sub.2, and O(CH.sub.2).sub.nON((CH.sub.2).sub.nCH.sub.3).sub.2, where n and m are from 1 to about 10. Other suitable polynucleotides comprise a sugar substituent group selected from: d to C.sub.10 lower alkyl, substituted lower alkyl, alkenyl, alkynyl, alkaryl, aralkyl, O-alkaryl or O-aralkyl, SH, SCH.sub.3, OCN, CI, Br, CN, CF.sub.3, OCF.sub.3, SOCH.sub.3, SO.sub.2CH.sub.3, ONO.sub.2, NO.sub.2, N.sub.3, NH.sub.2, heterocycloalkyl, heterocycloalkaryl, aminoalkylamino, polyalkylamino, substituted silyl, an RNA cleaving group, a reporter group, an intercalator, a group for improving the pharmacokinetic properties of an oligonucleotide, or a group for improving the pharmacodynamic properties of an oligonucleotide, and other substituents having similar properties. A suitable modification includes 2-methoxyethoxy (2OCH.sub.2CH.sub.2OCH.sub.3, also known as 2O-(2-methoxyethyl) or 2-MOE) (Martin et al., Helv. Chim. Acta, 1995, 78, 486-504, the disclosure of which is incorporated herein by reference in its entirety) e.g., an alkoxyalkoxy group. A further suitable modification includes 2-dimethylaminooxyethoxy, i.e. a O (CH.sub.2) 2ON (CH.sub.3) 2 group, also known as 2-DMAOE, as described in examples hereinbelow, and 2-dimethylaminoethoxyethoxy (also known in the art as 2O-dimethyl-amino-ethoxy-ethyl or 2-DMAEOE), i.e. 2OCH.sub.2OCH.sub.2N(CH.sub.3) 2.
[0199] Other suitable sugar substituent groups include methoxy (OCH.sub.3), aminopropoxy (O CH.sub.2CH.sub.2CH.sub.2NH.sub.2), allyl (CH.sub.2CHCH.sub.2), O-allyl (OCH.sub.2CHCH.sub.2) and fluoro (F). 2-sugar substituent groups may be in the arabino (up) position or ribo (down) position. A suitable 2-arabino modification is 2-F. Similar modifications may also be made at other positions on the oligomeric compound, particularly the 3 position of the sugar on the 3 terminal nucleoside or in 2-5 linked oligonucleotides and the 5 position of 5 terminal nucleotide. Oligomeric compounds may also have sugar mimetics such as cyclobutyl moieties in place of the pentofuranosyl sugar.
[0200] A subject nucleic acid may also include nucleobase (often referred to in the art simply as base) modifications or substitutions. As used herein, unmodified or natural nucleobases include the purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine (C) and uracil (U). Modified nucleobases include other synthetic and natural nucleobases such as 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl (CCCH.sub.3) uracil and cytosine and other alkynyl derivatives of pyrimidine bases, 6-azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo, 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other 5-substituted uracils and cytosines, 7-methylguanine and 7-methyladenine, 2-F-adenine, 2-amino-adenine, 8-azaguanine and 8-azaadenine, 7-deazaguanine and 7-deazaadenine and 3-deazaguanine and 3-deazaadenine. Further modified nucleobases include tricyclic pyrimidines such as phenoxazine cytidine (1H-pyrirnido (5,4-b) (1,4)benzoxazin-2 (3H)-one), phenothiazine cytidine (1H-pyrimido (5,4-b) (1,4)benzothiazin-2 (3H)-one), G-clamps such as a substituted phenoxazine cytidine (e.g., 9-(2-aminoethoxy)-H-pyrimido (5,4-(b) (1,4)benzoxazin-2 (3H)-one), carbazole cytidine (2H-pyrimido (4,5-b) indol-2-one), pyridoindole cytidine (H-pyrido (3,2: 4,5) pyrrolo (2,3-d)pyrimidin-2-one).
[0201] Heterocyclic base moieties may also include those in which the purine or pyrimidine base is replaced with other heterocycles, for example 7-deaza-adenine, 7-deazaguanosine, 2-aminopyridine and 2-pyridone. Further nucleobases include those disclosed in U.S. Pat. No. 3,687,808, those disclosed in The Concise Encyclopedia Of Polymer Science And Engineering, pages 858-859, Kroschwitz, J. I., ed. John Wiley & Sons, 1990, those disclosed by Englisch et al., Angewandte Chemie, International Edition, 1991, 30, 613, and those disclosed by Sanghvi, Y. S., Chapter 15, Antisense Research and Applications, pages 289-302, Crooke, S. T. and Lebleu, B., ed., CRC Press, 1993; the disclosures of which are incorporated herein by reference in their entirety. Certain of these nucleobases are useful for increasing the binding affinity of an oligomeric compound. These include 5-substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and O-6 substituted purines, including 2-aminopropyladenine, 5-propynyluracil and 5-propynylcytosine. 5-methylcytosine substitutions have been shown to increase nucleic acid duplex stability by 0.6-1.2 C. (Sanghvi et al., eds., Antisense Research and Applications, CRC Press, Boca Raton, 1993, pp. 276-278; the disclosure of which is incorporated herein by reference in its entirety) and are suitable base substitutions, e.g., when combined with 2O-methoxyethyl sugar modifications.
[0202] Another possible modification of a subject nucleic acid involves chemically linking to the polynucleotide one or more moieties or conjugates which enhance the activity, cellular distribution or cellular uptake of the oligonucleotide. These moieties or conjugates can include conjugate groups covalently bound to functional groups such as primary or secondary hydroxyl groups. Conjugate groups include, but are not limited to, intercalators, reporter molecules, polyamines, polyamides, polyethylene glycols, polyethers, groups that enhance the pharmacodynamic properties of oligomers, and groups that enhance the pharmacokinetic properties of oligomers. Suitable conjugate groups include, but are not limited to, cholesterols, lipids, phospholipids, biotin, phenazine, folate, phenanthridine, anthraquinone, acridine, fluoresceins, rhodamines, coumarins, and dyes. Groups that enhance the pharmacodynamic properties include groups that improve uptake, enhance resistance to degradation, and/or strengthen sequence-specific hybridization with the target nucleic acid. Groups that enhance the pharmacokinetic properties include groups that improve uptake, distribution, metabolism or excretion of a subject nucleic acid.
[0203] Conjugate moieties include but are not limited to lipid moieties such as a cholesterol moiety (Letsinger et al., Proc. Natl. Acad. Sci. USA, 1989, 86, 6553-6556), cholic acid (Manoharan et al., Bioorg. Med. Chem. Let., 1994, 4, 1053-1060), a thioether, e.g., hexyl-S-tritylthiol (Manoharan et al., Ann. N Y. Acad. Sci., 1992, 660, 306-309; Manoharan et al., Bioorg. Med. Chem. Let., 1993, 3, 2765-2770), a thiocholesterol (Oberhauser et al., Nucl. Acids Res., 1992, 20, 533-538), an aliphatic chain, e.g., dodecandiol or undecyl residues (Saison-Behmoaras et al., EMBO J., 1991, 10, 1111-1118; Kabanov et al, FEBS Lett., 1990, 259, 327-330; Svinarchuk et al., Biochimie, 1993, 75, 49-54), a phospholipid, e.g., di-hexadecyl-rac-glycerol or triethylammonium 1,2-di-O-hexadecyl-rac-glycero-3-H-phosphonate (Manoharan et al., Tetrahedron Lett., 1995, 36, 3651-3654; Shea et al., Nucl. Acids Res., 1990, 18, 3777-3783), a polyamine or a polyethylene glycol chain (Manoharan et al., Nucleosides & Nucleotides, 1995, 14, 969-973), or adamantane acetic acid (Manoharan et al., Tetrahedron Lett., 1995, 36, 3651-3654), a palmityl moiety (Mishra et al., Biochim. Biophys. Acta, 1995, 1264, 229-237), or an octadecylamine or hexylamino-carbonyl-oxycholesterol moiety (Crooke et al.,/. Pharmacol. Exp. Ther., 1996, 277, 923-937).
[0204] A conjugate may include a Protein Transduction Domain or PTD (also known as a CPP-cell penetrating peptide), which may refer to a polypeptide, polynucleotide, carbohydrate, or organic or inorganic compound that facilitates traversing a lipid bilayer, micelle, cell membrane, organelle membrane, or vesicle membrane. A PTD attached to another molecule, which can range from a small polar molecule to a large macromolecule and/or a nanoparticle, facilitates the molecule traversing a membrane, for example going from extracellular space to intracellular space, or cytosol to within an organelle (e.g., the nucleus). In some embodiments, a PTD is covalently linked to the 3 end of an exogenous polynucleotide. In some embodiments, a PTD is covalently linked to the 5 end of an exogenous polynucleotide. Examples of PTDs include but are not limited to a minimal undecapeptide protein transduction domain; a polyarginine sequence comprising a number of arginines sufficient to direct entry into a cell (e.g., 3, 4, 5, 6, 7, 8, 9, 10, or 10-50 arginines); a VP22 domain (Zender et al. (2002) Cancer Gene Ther. 9 (6): 489-96); an Drosophila Antennapedia protein transduction domain (Noguchi et al. (2003) Diabetes 52 (7): 1732-1737); a truncated human calcitonin peptide (Trehin et al. (2004) Pharm. Research 21:1248-1256); polylysine (Wender et al. (2000) Proc. Natl. Acad. Sci. USA 97:13003-13008). ACPPs comprise a polycationic CPP (e.g., Arg9 or R9) connected via a cleavable linker to a matching polyanion (e.g., Glu9 or E9), which reduces the net charge to nearly zero and thereby inhibits adhesion and uptake into cells. Upon cleavage of the linker, the polyanion is released, locally unmasking the polyarginine and its inherent adhesiveness, thus activating the ACPP to traverse the membrane.
[0205] A Cas12f4 guide RNA (or a nucleic acid comprising a nucleotide sequence encoding same) and/or a variant Cas12f4 polypeptide of the present disclosure (or a nucleic acid comprising a nucleotide sequence encoding same) and/or a variant Cas12f4 fusion polypeptide of the present disclosure (or a nucleic acid that includes a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure) and/or a donor polynucleotide (donor template) can be introduced into a host cell by any of a variety of well-known methods.
[0206] Any of a variety of compounds and methods can be used to deliver to a target cell a Cas12f4 system of the present disclosure (e.g., where a Cas12f4 system comprises: a) a variant Cas12f4 polypeptide of the present disclosure and a Cas12f4 guide RNA; b) a variant Cas12f4 polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; c) a variant Cas12f4 fusion polypeptide of the present disclosure and a Cas12f4 guide RNA; d) a variant Cas12f4 fusion polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; e) an mRNA encoding a variant Cas12f4 polypeptide of the present disclosure; and a Cas12f4 guide RNA; f) an mRNA encoding a variant Cas12f4 polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; g) an mRNA encoding a variant Cas12f4 fusion polypeptide of the present disclosure; and a Cas12f4 guide RNA; h) an mRNA encoding a variant Cas12f4 fusion polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; i) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure and a nucleotide sequence encoding a Cas12f4 guide RNA; j) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, a nucleotide sequence encoding a Cas12f4 guide RNA, and a nucleotide sequence encoding a donor template nucleic acid; k) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure and a nucleotide sequence encoding a Cas12f4 guide RNA; 1) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, a nucleotide sequence encoding a Cas12f4 guide RNA, and a nucleotide sequence encoding a donor template nucleic acid; m) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; n) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; and a donor template nucleic acid; o) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; p) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; and a donor template nucleic acid; q) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, a nucleotide sequence encoding a first Cas12f4 guide RNA, and a nucleotide sequence encoding a second Cas12f4 guide RNA; or r) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, a nucleotide sequence encoding a first Cas12f4 guide RNA, and a nucleotide sequence encoding a second Cas12f4 guide RNA; or some variation of one of (a) through (r). As a non-limiting example, a Cas12f4 system of the present disclosure can be combined with a lipid. As another non-limiting example, a Cas12f4 system of the present disclosure can be combined with a particle, or formulated into a particle.
[0207] Methods of introducing a nucleic acid into a host cell are known in the art, and any convenient method can be used to introduce a subject nucleic acid (e.g., an expression construct/vector) into a target cell (e.g., prokaryotic cell, eukaryotic cell, plant cell, animal cell, mammalian cell, human cell, and the like). Suitable methods include, e.g., viral infection, transfection, conjugation, protoplast fusion, lipofection, electroporation, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran mediated transfection, liposome-mediated transfection, particle gun technology, calcium phosphate precipitation, direct micro injection, nanoparticle-mediated nucleic acid delivery (see, e.g., Panyam et., al Adv Drug Deliv Rev. 2012 Sep. 13. pii: S0169-409X (12) 00283-9. doi: 10.1016/j.addr.2012.09.023), and the like.
[0208] In some embodiments, a variant Cas12f4 polypeptide of the present disclosure is provided as a nucleic acid (e.g., an mRNA, a DNA, a plasmid, an expression vector, a viral vector, etc.) that encodes the variant Cas12f4 polypeptide. In some embodiments, the variant Cas12f4 polypeptide of the present disclosure is provided directly as a protein (e.g., without an associated guide RNA or with an associate guide RNA, i.e. as a ribonucleoprotein complex). A variant Cas12f4 polypeptide of the present disclosure can be introduced into a cell (provided to the cell) by any convenient method; such methods are known to those of ordinary skill in the art. As an illustrative example, a variant Cas12f4 polypeptide of the present disclosure can be injected directly into a cell (e.g., with or without a Cas12f4 guide RNA or nucleic acid encoding a Cas12f4 guide RNA, and with or without a donor polynucleotide). As another example, a preformed complex of a variant Cas12f4 polypeptide of the present disclosure and a Cas12f4 guide RNA (an RNP) can be introduced into a cell (e.g, eukaryotic cell) (e.g., via injection, via nucleofection; via a protein transduction domain (PTD) conjugated to one or more components, e.g., conjugated to the variant Cas12f4 polypeptide, conjugated to a guide RNA, conjugated to a variant Cas12f4 polypeptide of the present disclosure and a guide RNA; etc.). In some embodiments, a variant Cas12f4 fusion polypeptide (e.g., mutant dCas12f4 fused to a fusion partner, mutant nickase Cas12f4 fused to a fusion partner, etc.) of the present disclosure is provided as a nucleic acid (e.g., an mRNA, a DNA, a plasmid, an expression vector, a viral vector, etc.) that encodes the variant Cas12f4 fusion polypeptide. In some embodiments, the variant Cas12f4 fusion polypeptide of the present disclosure is provided directly as a protein (e.g., without an associated guide RNA or with an associate guide RNA, i.e. as a ribonucleoprotein complex). A variant Cas12f4 fusion polypeptide of the present disclosure can be introduced into a cell (provided to the cell) by any convenient method; such methods are known to those of ordinary skill in the art. As an illustrative example, a variant Cas12f4 fusion polypeptide of the present disclosure can be injected directly into a cell (e.g., with or without nucleic acid encoding a Cas12f4 guide RNA and with or without a donor polynucleotide). As another example, a preformed complex of a variant Cas12f4 fusion polypeptide of the present disclosure and a Cas12f4 guide RNA (an RNP) can be introduced into a cell (e.g., via injection, via nucleofection; via a protein transduction domain (PTD) conjugated to one or more components, e.g., conjugated to the variant Cas12f4 fusion protein, conjugated to a guide RNA, conjugated to a variant Cas12f4 fusion polypeptide of the present disclosure and a guide RNA; etc.).
[0209] In some embodiments, a nucleic acid (e.g., a Cas12f4 guide RNA; a nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure; etc.) is delivered to a cell (e.g., a target host cell) and/or a polypeptide (e.g., a variant Cas12f4 polypeptide; a variant Cas12f4 fusion polypeptide) in a particle, or associated with a particle. In some embodiments, a Cas12f4 system of the present disclosure is delivered to a cell in a particle, or associated with a particle. The terms particle and nanoparticle can be used interchangeable, as appropriate. A recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure and/or a Cas12f4 guide RNA, an mRNA comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, and guide RNA may be delivered simultaneously using particles or lipid envelopes; for instance, a variant Cas12f4 polypeptide and a Cas12f4 guide RNA, e.g., as a complex (e.g., a ribonucleoprotein (RNP) complex), can be delivered via a particle, e.g., a delivery particle comprising lipid or lipidoid and hydrophilic polymer, e.g., a cationic lipid and a hydrophilic polymer, for instance wherein the cationic lipid comprises 1,2-dioleoyl-3-trimethylammonium-propane (DOTAP) or 1,2-ditetradecanoyl-sn-glycero-3-phosphocholine (DMPC) and/or wherein the hydrophilic polymer comprises ethylene glycol or polyethylene glycol (PEG); and/or wherein the particle further comprises cholesterol (e.g., particle from formulation 1=DOTAP 100, DMPC 0, PEG 0, Cholesterol 0; formulation number 2=DOTAP 90, DMPC 0, PEG 10, Cholesterol 0; formulation number 3=DOTAP 90, DMPC 0, PEG 5, Cholesterol 5). For example, a particle can be formed using a multistep process in which a variant Cas12f4 polypeptide and a Cas12f4 guide RNA are mixed together, (e.g., at a 1:1 molar ratio, e.g., at room temperature, e.g., for 30 minutes, e.g., in sterile, nuclease free 1phosphate-buffered saline (PBS); and separately, DOTAP, DMPC, PEG, and cholesterol as applicable for the formulation are dissolved in alcohol, e.g., 100% ethanol; and, the two solutions are mixed together to form particles containing the complexes).
[0210] A variant Cas12f4 polypeptide of the present disclosure (or an mRNA comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure; or a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure) and/or Cas12f4 guide RNA (or a nucleic acid such as one or more expression vectors encoding the Cas12f4 guide RNA) may be delivered simultaneously using particles or lipid envelopes. For example, a biodegradable core-shell structured nanoparticle with a poly (-amino ester) (PBAE) core enveloped by a phospholipid bilayer shell can be used. In some embodiments, particles/nanoparticles based on self-assembling bioadhesive polymers are used; such particles/nanoparticles may be applied to oral delivery of peptides, intravenous delivery of peptides and nasal delivery of peptides, e.g., to the brain. Other embodiments, such as oral absorption and ocular delivery of hydrophobic drugs are also contemplated. A molecular envelope technology, which involves an engineered polymer envelope which is protected and delivered to the site of the disease, can be used. Doses of about 5 mg/kg can be used, with single or multiple doses, depending on various factors, e.g., the target tissue.
[0211] Lipidoid compounds (e.g., as described in U.S. patent application No. 20110293703) are also useful in the administration of polynucleotides, and can be used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure.
[0212] In one aspect, the aminoalcohol lipidoid compounds are combined with an agent to be delivered to a cell or a subject to form microparticles, nanoparticles, liposomes, or micelles. The aminoalcohol lipidoid compounds may be combined with other aminoalcohol lipidoid compounds, polymers (synthetic or natural), surfactants, cholesterol, carbohydrates, proteins, lipids, etc. to form the particles. These particles may then optionally be combined with a pharmaceutical excipient to form a pharmaceutical composition.
[0213] A poly(beta-amino alcohol) (PBAA) can be used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell. US Patent Publication No. 20130302401 relates to a class of poly(beta-amino alcohols) (PBAAs) that has been prepared using combinatorial polymerization.
[0214] Sugar-based particles, for example GalNAc, as described with reference to WO2014118272 (incorporated herein by reference) and Nair, J K et al., 2014, Journal of the American Chemical Society 136 (49), 16958-16961) can be used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell.
[0215] In some embodiments, lipid nanoparticles (LNPs) are used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell. Negatively charged polymers such as RNA may be loaded into LNPs at low pH values (e.g., pH 4) where the ionizable lipids display a positive charge. However, at physiological pH values, the LNPs exhibit a low surface charge compatible with longer circulation times. Four species of ionizable cationic lipids have been focused upon, namely 1,2-dilineoyl-3-dimethylammonium-propane (DLinDAP), 1,2-dilinoleyloxy-3-N,N-dimethylaminopropane (DLinDMA), 1,2-dilinoleyloxy-keto-N,N-dimethyl-3-aminopropane (DLinKDMA), and 1,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane (DLinKC2-DMA). Preparation of LNPs and is described in, e.g., Rosin et al. (2011) Molecular Therapy 19:1286-2200). The cationic lipids 1,2-dilineoyl-3-dimethylammonium-propane (DLinDAP), 1,2-dilinoleyloxy-3-N,N-dimethylaminopropane (DLinDMA), 1,2-dilinoleyloxyketo-N,N-dimethyl-3-aminopropane (DLinKDMA), 1,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane (DLinKC2-DM A), (3O-[2-(methoxypolyethyleneglycol 2000) succinoyl]-1,2-dimyristoyl-sn-glycol (PEG-S-DMG), and R-3-[(.omega.-methoxy-poly(ethylene glycol) 2000) carbamoyl]-1,2-dimyristyloxlpropyl-3-amine (PEG-C-DOMG) may be used. A nucleic acid (e.g., a Cas12f4 guide RNA; a nucleic acid of the present disclosure; etc.) may be encapsulated in LNPs containing DLinDAP, DLinDMA, DLinK-DMA, and DLinKC2-DMA (cationic lipid: DSPC: CHOL: PEGS-DMG or PEG-C-DOMG at 40:10:40:10 molar ratios). In some embodiments, 0.2% SP-DiOC18 is incorporated.
[0216] Spherical Nucleic Acid (SNA) constructs and other nanoparticles (particularly gold nanoparticles) can be used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell. See, e.g., Cutler et al., J. Am. Chem. Soc. 2011 133:9254-9257, Hao et al., Small. 2011 7:3158-3162, Zhang et al., ACS Nano. 2011 5:6962-6970, Cutler et al., J. Am. Chem. Soc. 2012 134:1376-1391, Young et al., Nano Lett. 2012 12:3867-71, Zheng et al., Proc. Natl. Acad. Sci. USA. 2012 109:11975-80, Mirkin, Nanomedicine 2012 7:635-638 Zhang et al., J. Am. Chem. Soc. 2012 134:16488-1691, Weintraub, Nature 2013 495: S14-S16, Choi et al., Proc. Natl. Acad. Sci. USA. 2013 110 (19): 7625-7630, Jensen et al, Sci. Transl. Med. 5, 209ral52 (2013) and Mirkin, et al., Small, 10:186-192.
[0217] Self-assembling nanoparticles with RNA may be constructed with polyethyleneimine (PEI) that is PEGylated with an Arg-Gly-Asp (RGD) peptide ligand attached at the distal end of the polyethylene glycol (PEG). In general, a nanoparticle refers to any particle having a diameter of less than 1000 nm.
[0218] In some embodiments, nanoparticles suitable for use in delivering a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell have a diameter of 500 nm or less, e.g., from 25 nm to 35 nm, from 35 nm to 50 nm, from 50 nm to 75 nm, from 75 nm to 100 nm, from 100 nm to 150 nm, from 150 nm to 200 nm, from 200 nm to 300 nm, from 300 nm to 400 nm, or from 400 nm to 500 nm. In some embodiments, nanoparticles suitable for use in delivering a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell have a diameter of from 25 nm to 200 nm. In some embodiments, nanoparticles suitable for use in delivering a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell have a diameter of 100 nm or less In some embodiments, nanoparticles suitable for use in delivering a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell have a diameter of from 35 nm to 60 nm.
[0219] Nanoparticles suitable for use in delivering a Cas12f4 polypeptide of the present disclosure, a Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell may be provided in different forms, e.g., as solid nanoparticles (e.g., metal such as silver, gold, iron, titanium), non-metal, lipid-based solids, polymers), suspensions of nanoparticles, or combinations thereof. Metal, dielectric, and semiconductor nanoparticles may be prepared, as well as hybrid structures (e.g., core-shell nanoparticles). Nanoparticles made of semiconducting material may also be labeled quantum dots if they are small enough (typically below 10 nm) that quantization of electronic energy levels occurs. Such nanoscale particles are used in biomedical applications as drug carriers or imaging agents and may be adapted for similar purposes in the present disclosure.
[0220] Semi-solid and soft nanoparticles are also suitable for use in delivering a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell. A prototype nanoparticle of semi-solid nature is the liposome.
[0221] In some embodiments, an exosome is used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell. Exosomes are endogenous nano-vesicles that transport RNAs and proteins, and which can deliver RNA to the brain and other target organs.
[0222] In some embodiments, a liposome is used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell. Liposomes are spherical vesicle structures composed of a uni- or multilamellar lipid bilayer surrounding internal aqueous compartments and a relatively impermeable outer lipophilic phospholipid bilayer. Liposomes can be made from several different types of lipids; however, phospholipids are most commonly used to generate liposomes. Although liposome formation is spontaneous when a lipid film is mixed with an aqueous solution, it can also be expedited by applying force in the form of shaking by using a homogenizer, sonicator, or an extrusion apparatus. Several other additives may be added to liposomes in order to modify their structure and properties. For instance, either cholesterol or sphingomyelin may be added to the liposomal mixture in order to help stabilize the liposomal structure and to prevent the leakage of the liposomal inner cargo. A liposome formulation may be mainly comprised of natural phospholipids and lipids such as 1,2-distearoryl-sn-glycero-3-phosphatidyl choline (DSPC), sphingomyelin, egg phosphatidylcholines and monosialoganglioside.
[0223] A stable nucleic-acid-lipid particle (SNALP) can be used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell. The SNALP formulation may contain the lipids 3-N-[(methoxypoly(ethylene glycol) 2000) carbamoyl]-1,2-dimyristyloxy-propylamine (PEG-C-DMA), 1,2-dilinoleyloxy-N,N-dimethyl-3-aminopropane (DLinDMA), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC) and cholesterol, in a 2:40: 10:48 molar percent ratio. The SNALP liposomes may be prepared by formulating D-Lin-DMA and PEG-C-DMA with distearoylphosphatidylcholine (DSPC), Cholesterol and siRNA using a 25:1 lipid/siRNA ratio and a 48/40/10/2 molar ratio of Cholesterol/D-Lin-DMA/DSPC/PEG-C-DMA. The resulting SNALP liposomes can be about 80-100 nm in size. A SNALP may comprise synthetic cholesterol (Sigma-Aldrich, St Louis, Mo., USA), dipalmitoylphosphatidylcholine (Avanti Polar Lipids, Alabaster, Ala., USA), 3-N-[(w-methoxy poly(ethylene glycol) 2000) carbamoyl]-1,2-dimyrestyloxypropylamine, and cationic 1,2-dilinoleyloxy-3-N,Ndimethylaminopropane. A SNALP may comprise synthetic cholesterol (Sigma-Aldrich), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC; Avanti Polar Lipids Inc.), PEG-CDMA, and 1,2-dilinoleyloxy-3-(N;N-dimethyl) aminopropane (DLinDMA).
[0224] Other cationic lipids, such as amino lipid 2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA) can be used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell. A preformed vesicle with the following lipid composition may be contemplated: amino lipid, distearoylphosphatidylcholine (DSPC), cholesterol and (R)-2,3-bis(octadecyloxy) propyl-1-(methoxy poly(ethyleneglycol) 2000) propylcarbamate (PEG-lipid) in the molar ratio 40/10/40/10, respectively, and a FVII siRN A/total lipid ratio of approximately 0.05 (w/w). To ensure a narrow particle size distribution in the range of 70-90 nm and a low polydispersity index of 0.11.+. 0.04 (n=56), the particles may be extruded up to three times through 80 nm membranes prior to adding the guide RNA. Particles containing the highly potent amino lipid 16 may be used, in which the molar ratio of the four lipid components 16, DSPC, cholesterol and PEG-lipid (50/10/38.5/1.5) may be further optimized to enhance in vivo activity.
[0225] Lipids may be formulated with a Cas12f4 system of the present disclosure or component(s) thereof or nucleic acids encoding the same to form lipid nanoparticles (LNPs). Suitable lipids include, but are not limited to, DLin-KC2-DMA4, CI 2-200 and colipids disteroylphosphatidyl choline, cholesterol, and PEG-DMG may be formulated with a Cas12f4 system, or component thereof, of the present disclosure, using a spontaneous vesicle formation procedure. The component molar ratio may be about 50/10/38.5/1.5 (DLin-KC2-DMA or C12-200/disteroylphosphatidyl choline/cholesterol/PEG-DMG).
[0226] A Cas12f4 system of the present disclosure, or a component thereof, may be delivered encapsulated in PLGA microspheres such as that further described in US published applications Ser. No. 20/130,252281 and 20130245107 and 20130244279.
[0227] Supercharged proteins can be used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell. Supercharged proteins are a class of engineered or naturally-occurring proteins with unusually high positive or negative net theoretical charge. Both supernegatively and superpositively charged proteins exhibit the ability to withstand thermally or chemically induced aggregation. Superpositively charged proteins are also able to penetrate mammalian cells. Associating cargo with these proteins, such as plasmid DNA, RNA, or other proteins, can facilitate the functional delivery of these macromolecules into mammalian cells both in vitro and in vivo.
[0228] Cell Penetrating Peptides (CPPs) can be used to deliver a variant Cas12f4 polypeptide of the present disclosure, a variant Cas12f4 fusion polypeptide of the present disclosure, an RNP of the present disclosure, a nucleic acid of the present disclosure, or a Cas12f4 system of the present disclosure, to a target cell. CPPs typically have an amino acid composition that either contains a high relative abundance of positively charged amino acids such as lysine or arginine or has sequences that contain an alternating pattern of polar/charged amino acids and non-polar, hydrophobic amino acids.
[0229] The present disclosure provides a modified cell comprising a variant Cas12f4 polypeptide of the present disclosure and/or a nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure. The present disclosure provides a modified cell comprising a variant Cas12f4 polypeptide of the present disclosure, where the modified cell is a cell that does not normally comprise a variant Cas12f4 polypeptide of the present disclosure. The present disclosure provides a modified cell (e.g., a genetically modified cell) comprising nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure. The present disclosure provides a genetically modified cell that is genetically modified with an mRNA comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure. The present disclosure provides a genetically modified cell that is genetically modified with a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure. The present disclosure provides a genetically modified cell that is genetically modified with a recombinant expression vector comprising: a) a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure; and b) a nucleotide sequence encoding a Cas12f4 guide RNA of the present disclosure. The present disclosure provides a genetically modified cell that is genetically modified with a recombinant expression vector comprising: a) a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure; b) a nucleotide sequence encoding a Cas12f4 guide RNA of the present disclosure; and c) a nucleotide sequence encoding a donor template.
[0230] A cell that serves as a recipient for a variant Cas12f4 polypeptide of the present disclosure and/or a nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure and/or a Cas12f4 guide RNA of the present disclosure, can be any of a variety of cells, including, e.g., in vitro cells; in vivo cells; ex vivo cells; primary cells; cancer cells; animal cells; plant cells; algal cells; fungal cells; etc. A cell that serves as a recipient for a variant Cas12f4 polypeptide of the present disclosure and/or a nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure and/or a Cas12f4 guide RNA of the present disclosure is referred to as a host cell or a target cell. A host cell or a target cell can be a recipient of a Cas12f4 system of the present disclosure. A host cell or a target cell can be a recipient of a Cas12f4 RNP of the present disclosure. A host cell or a target cell can be a recipient of a single component of a Cas12f4 system of the present disclosure.
[0231] Non-limiting examples of cells (target cells) include: a prokaryotic cell, eukaryotic cell, a bacterial cell, an archaeal cell, a cell of a single-cell eukaryotic organism, a protozoa cell, a cell from a plant (e.g., cells from plant crops, fruits, vegetables, grains, soy bean, corn, maize, wheat, seeds, tomatos, rice, cassava, sugarcane, pumpkin, hay, potatos, cotton, Brassica sp. including oilseed rape, sorghum, sugarbeet, cannabis, tobacco, flowering plants, conifers, gymnosperms, angiosperms, ferns, clubmosses, hornworts, liverworts, mosses, dicotyledons, monocotyledons, etc.), an algal cell, (e.g., Botryococcus braunii, Chlamydomonas reinhardtii, Nannochloropsis gaditana, Chlorella pyrenoidosa, Sargassum patens, C. agardh, and the like), seaweeds (e.g., kelp) a fungal cell (e.g., a yeast cell, a cell from a mushroom), an animal cell, a cell from an invertebrate animal (e.g., fruit fly, cnidarian, echinoderm, nematode, etc.), a cell from a vertebrate animal (e.g., fish, amphibian, reptile, bird, mammal), a cell from a mammal (e.g., an ungulate (e.g., a pig, a cow, a goat, a sheep); a rodent (e.g., a rat, a mouse); a non-human primate; a human; a feline (e.g., a cat); a canine (e.g., a dog); etc.), and the like. In some embodiments, the cell is a cell that does not originate from a natural organism (e.g., the cell can be a synthetically made cell; also referred to as an artificial cell).
[0232] A cell can be an in vitro cell (e.g., established cultured cell line). A cell can be an ex vivo cell (cultured cell from an individual). A cell can be an in vivo cell (e.g., a cell in an individual). A cell can be an isolated cell. A cell can be a cell inside of an organism. A cell can be an organism. A cell can be a cell in a cell culture (e.g., in vitro cell culture). A cell can be one of a collection of cells. A cell can be a prokaryotic cell or derived from a prokaryotic cell. A cell can be a bacterial cell or can be derived from a bacterial cell. A cell can be an archaeal cell or derived from an archaeal cell. A cell can be a eukaryotic cell or derived from a eukaryotic cell. A cell can be a plant cell or derived from a plant cell. A cell can be an animal cell or derived from an animal cell. A cell can be an invertebrate cell or derived from an invertebrate cell. A cell can be a vertebrate cell or derived from a vertebrate cell. A cell can be a mammalian cell or derived from a mammalian cell. A cell can be a rodent cell or derived from a rodent cell. A cell can be a human cell or derived from a human cell. A cell can be a microbial cell or derived from a microbe cell. A cell can be a fungi cell or derived from a fungi cell. A cell can be an insect cell. A cell can be an arthropod cell. A cell can be a protozoan cell. A cell can be a helminth cell.
[0233] In certain embodiments, suitable cells include a stem cell (e.g., an embryonic stem(ES) cell, an induced pluripotent stem (iPS) cell; a germ cell (e.g., an oocyte, a sperm, an oogonia, a spermatogonia, etc.); a somatic cell, e.g., a fibroblast, an oligodendrocyte, a glial cell, a hematopoietic cell, a neuron, a muscle cell, a bone cell, a hepatocyte, a pancreatic cell, etc.
[0234] Suitable cells include human embryonic stem cells, fetal cardiomyocytes, myofibroblasts, mesenchymal stem cells, autotransplated expanded cardiomyocytes, adipocytes, totipotent cells, pluripotent cells, blood stem cells, myoblasts, adult stem cells, bone marrow cells, mesenchymal cells, embryonic stem cells, parenchymal cells, epithelial cells, endothelial cells, mesothelial cells, fibroblasts, osteoblasts, chondrocytes, exogenous cells, endogenous cells, stem cells, hematopoietic stem cells, bone-marrow derived progenitor cells, myocardial cells, skeletal cells, fetal cells, undifferentiated cells, multi-potent progenitor cells, unipotent progenitor cells, monocytes, cardiac myoblasts, skeletal myoblasts, macrophages, capillary endothelial cells, xenogenic cells, allogenic cells, and post-natal stem cells.
[0235] In some embodiments, the cell is an immune cell, a neuron, an epithelial cell, and endothelial cell, or a stem cell. In some embodiments, the immune cell is a T cell, a B cell, a monocyte, a natural killer cell, a dendritic cell, or a macrophage. In some embodiments, the immune cell is a cytotoxic T cell. In some embodiments, the immune cell is a helper T cell. In some embodiments, the immune cell is a regulatory T cell (Treg).
[0236] In some embodiments, the cell is a stem cell. Stem cells include adult stem cells. Adult stem cells are also referred to as somatic stem cells. Adult stem cells are resident in differentiated tissue, but retain the properties of self-renewal and ability to give rise to multiple cell types, usually cell types typical of the tissue in which the stem cells are found. Numerous examples of somatic stem cells are known to those of skill in the art, including muscle stem cells; hematopoietic stem cells; epithelial stem cells; neural stem cells; mesenchymal stem cells; mammary stem cells; intestinal stem cells; mesodermal stem cells; endothelial stem cells; olfactory stem cells; neural crest stem cells; and the like.
[0237] Stem cells of interest include mammalian stem cells, where the term mammalian refers to any animal classified as a mammal, including humans; non-human primates; domestic and farm animals; and zoo, laboratory, sports, or pet animals, such as dogs, horses, cats, cows, mice, rats, rabbits, etc. In some embodiments, the stem cell is a human stem cell. In some embodiments, the stem cell is a rodent (e.g., a mouse; a rat) stem cell. In some embodiments, the stem cell is a non-human primate stem cell. Stem cells can express one or more stem cell markers, e.g., SOX9, KRT19, KRT7, LGR5, CA9, FXYD2, CDH6, CLDN18, TSPAN8, BPIFB1, OLFM4, CDH17, and PPARGCIA.
[0238] In some embodiments, the stem cell is a hematopoietic stem cell (HSC). HSCs are mesoderm-derived cells that can be isolated from bone marrow, blood, cord blood, fetal liver and yolk sac. HSCs are characterized as CD34+ and CD3-. HSCs can repopulate the erythroid, neutrophil-macrophage, megakaryocyte and lymphoid hematopoietic cell lineages in vivo. In vitro, HSCs can be induced to undergo at least some self-renewing cell divisions and can be induced to differentiate to the same lineages as is seen in vivo. As such, HSCs can be induced to differentiate into one or more of erythroid cells, megakaryocytes, neutrophils, macrophages, and lymphoid cells.
[0239] In other embodiments, the stem cell is a neural stem cell (NSC). NSCs are capable of differentiating into neurons, and glia (including oligodendrocytes, and astrocytes). A neural stem cell is a multipotent stem cell which is capable of multiple divisions, and under specific conditions can produce daughter cells which are neural stem cells, or neural progenitor cells that can be neuroblasts or glioblasts, e.g., cells committed to become one or more types of neurons and glial cells respectively. Methods of obtaining NSCs are known in the art.
[0240] In other embodiments, the stem cell is a mesenchymal stem cell (MSC). MSCs originally derived from the embryonal mesoderm and isolated from adult bone marrow, can differentiate to form muscle, bone, cartilage, fat, marrow stroma, and tendon. Methods of isolating MSC are known in the art; and any known method can be used to obtain MSC. See, e.g., U.S. Pat. No. 5,736,396, which describes isolation of human MSC.
[0241] In certain optional embodiments, the methods disclosed herein are not processes for modifying the germ line genetic identity of human beings. In certain optional embodiments, the methods disclosed herein are not processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes. In certain optional embodiments, the methods disclosed herein are not methods for treatment of the human or animal body by surgery or therapy. In a certain optional embodiments, the cells disclosed herein are not human embryos. In certain optional embodiments, the cells disclosed herein are not the human body, at the various stages of its formation and development.
[0242] A cell is in some embodiments a plant cell. A plant cell can be a cell of a monocotyledon. A cell can be a cell of a dicotyledon. For example, the cell can be a cell of a major agricultural plant, e.g., Barley, Beans (Dry Edible), Canola, Corn, Cotton (Pima), Cotton (Upland), Flaxseed, Hay (Alfalfa), Hay (Non-Alfalfa), Oats, Peanuts, Rice, Sorghum, Soybeans, Sugarbeets, Sugarcane, Sunflowers (Oil), Sunflowers (Non-Oil), Sweet Potatoes, Tobacco (Burley), Tobacco (Flue-cured), Tomatoes, Wheat (Durum), Wheat (Spring), Wheat (Winter), and the like. As another example, the cell is a cell of a vegetable crops which include but are not limited to, e.g., alfalfa sprouts, aloe leaves, arrow root, arrowhead, artichokes, asparagus, bamboo shoots, banana flowers, bean sprouts, beans, beet tops, beets, bittermelon, bok choy, broccoli, broccoli rabe (rappini), brussels sprouts, cabbage, cabbage sprouts, cactus leaf (nopales), calabaza, cardoon, carrots, cauliflower, celery, chayote, Chinese artichoke (crosnes), Chinese cabbage, Chinese celery, Chinese chives, choy sum, chrysanthemum leaves (tung ho), collard greens, corn stalks, corn-sweet, cucumbers, daikon, dandelion greens, dasheen, dau mue (pea tips), donqua (winter melon), eggplant, endive, escarole, fiddle head ferns, field cress, frisee, gai choy (chinese mustard), gailon, galanga (siam, thai ginger), garlic, ginger root, gobo, greens, hanover salad greens, huauzontle, jerusalem artichokes, jicama, kale greens, kohlrabi, lamb's quarters (quilete), lettuce (bibb), lettuce (boston), lettuce (boston red), lettuce (green leaf), lettuce (iceberg), lettuce (lolla rossa), lettuce (oak leaf-green), lettuce (oak leaf-red), lettuce (processed), lettuce (red leaf), lettuce (romaine), lettuce (ruby romaine), lettuce (russian red mustard), linkok, lo bok, long beans, lotus root, mache, maguey (agave) leaves, malanga, mesculin mix, mizuna, moap (smooth luffa), moo, moqua (fuzzy squash), mushrooms, mustard, nagaimo, okra, ong choy, onions green, opo (long squash), ornamental corn, ornamental gourds, parsley, parsnips, peas, peppers (bell type), peppers, pumpkins, radicchio, radish sprouts, radishes, rape greens, rape greens, rhubarb, romaine (baby red), rutabagas, salicornia (sea bean), sinqua (angled/ridged luffa), spinach, squash, straw bales, sugarcane, sweet potatoes, swiss chard, tamarindo, taro, taro leaf, taro shoots, tatsoi, tepeguaje (guaje), tindora, tomatillos, tomatoes, tomatoes (cherry), tomatoes (grape type), tomatoes (plum type), tumeric, turnip tops greens, turnips, water chestnuts, yampi, yams (names), yu choy, yuca (cassava), and the like.
[0243] A cell is in some embodiments an arthropod cell. For example, the cell can be a cell of a suborder, a family, a sub-family, a group, a sub-group, or a species of, e.g., Chelicerata, Myriapodia, Hexipodia, Arachnida, Insecta, Archaeognatha, Thysanura, Palaeoptera, Ephemeroptera, Odonata, Anisoptera, Zygoptera, Neoptera, Exopterygota, Plecoptera, Embioptera, Orthoptera, Zoraptera, Dermaptera, Dictyoptera, Notoptera, Grylloblattidae, Mantophasmatidae, Phasmatodea, Blattaria, Isoptera, Mantodea, Parapneuroptera, Psocoptera, Thysanoptera, Phthiraptera, Hemiptera, Endopterygota or Holometabola, Hymenoptera, Coleoptera, Strepsiptera, Raphidioptera, Megaloptera, Neuroptera, Mecoptera, Siphonaptera, Diptera, Trichoptera, or Lepidoptera.
[0244] A cell is in some embodiments an insect cell. For example, in some embodiments, the cell is a cell of a mosquito, a grasshopper, a true bug, a fly, a flea, a bee, a wasp, an ant, a louse, a moth, or a beetle.
[0245] The present disclosure provides a kit comprising a Cas12f4 system of the present disclosure, or a component of a Cas12f4 system of the present disclosure. A kit of the present disclosure can comprise: a) a variant Cas12f4 polypeptide of the present disclosure and a Cas12f4 guide RNA; b) a variant Cas12f4 polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; c) a variant Cas12f4 fusion polypeptide of the present disclosure and a Cas12f4 guide RNA; d) a variant Cas12f4 fusion polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; e) an mRNA encoding a variant Cas12f4 polypeptide of the present disclosure; and a Cas12f4 guide RNA; f) an mRNA encoding a variant Cas12f4 polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; g) an mRNA encoding a variant Cas12f4 fusion polypeptide of the present disclosure; and a Cas12f4 guide RNA; h) an mRNA encoding a variant Cas12f4 fusion polypeptide of the present disclosure, a Cas12f4 guide RNA, and a donor template nucleic acid; i) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure and a nucleotide sequence encoding a Cas12f4 guide RNA; j) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, a nucleotide sequence encoding a Cas12f4 guide RNA, and a nucleotide sequence encoding a donor template nucleic acid; k) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure and a nucleotide sequence encoding a Cas12f4 guide RNA; 1) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, a nucleotide sequence encoding a Cas12f4 guide RNA, and a nucleotide sequence encoding a donor template nucleic acid; m) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; n) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; and a donor template nucleic acid; o) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; p) a first recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, and a second recombinant expression vector comprising a nucleotide sequence encoding a Cas12f4 guide RNA; and a donor template nucleic acid; q) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure, a nucleotide sequence encoding a first Cas12f4 guide RNA, and a nucleotide sequence encoding a second Cas12f4 guide RNA; or r) a recombinant expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure, a nucleotide sequence encoding a first Cas12f4 guide RNA, and a nucleotide sequence encoding a second Cas12f4 guide RNA; or some variation of one of (a) through (r).
[0246] A kit of the present disclosure can comprise: a) a component, as described above, of a Cas12f4 system of the present disclosure, or can comprise a Cas12f4 system of the present disclosure; and b) one or more additional reagents, e.g., i) a buffer; ii) a protease inhibitor; iii) a nuclease inhibitor; iv) a reagent required to develop or visualize a detectable label; v) a positive and/or negative control target DNA; vi) a positive and/or negative control Cas12f4 guide RNA; and the like. A kit of the present disclosure can comprise: a) a component, as described above, of a Cas12f4 system of the present disclosure, or can comprise a Cas12f4 system of the present disclosure; and b) a therapeutic agent. A kit of the present disclosure can comprise a recombinant expression vector comprising: a) an insertion site for inserting a nucleic acid comprising a nucleotide sequence encoding a portion of a Cas12f4 guide RNA that hybridizes to a target nucleotide sequence in a target nucleic acid; and b) a nucleotide sequence encoding the Cas12f4-binding portion of a Cas12f4 guide RNA. A kit of the present disclosure can comprise a recombinant expression vector comprising: a) an insertion site for inserting a nucleic acid comprising a nucleotide sequence encoding a portion of a Cas12f4 guide RNA that hybridizes to a target nucleotide sequence in a target nucleic acid; b) a nucleotide sequence encoding the Cas12f4-binding portion of a Cas12f4 guide RNA; and c) a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure.
[0247] A variant Cas12f4 polypeptide of the present disclosure, or a variant Cas12f4 fusion polypeptide of the present disclosure, finds use in a variety of methods (e.g., in combination with a Cas12f4 guide RNA and in some embodiments further in combination with a donor template). For example, a variant Cas12f4 polypeptide of the present disclosure can be used to (i) modify (e.g., cleave, e.g., nick; methylate; etc.) target nucleic acid (DNA or RNA; single stranded or double stranded); (ii) modulate transcription of a target nucleic acid; (iii) label a target nucleic acid; (iv) bind a target nucleic acid (e.g., for purposes of isolation, labeling, imaging, tracking, etc.); (v) modify a polypeptide (e.g., a histone) associated with a target nucleic acid; and the like. Thus, the present disclosure provides a method of modifying a target nucleic acid. In some embodiments, a method of the present disclosure for modifying a target nucleic acid comprises contacting the target nucleic acid with: a) a variant Cas12f4 polypeptide of the present disclosure; and b) one or more (e.g., two) Cas12f4 guide RNAs. In some embodiments, a method of the present disclosure for modifying a target nucleic acid comprises contacting the target nucleic acid with: a) a variant Cas12f4 polypeptide of the present disclosure; b) a Cas12f4 guide RNA; and c) a donor nucleic acid (e.g, a donor template). In some embodiments, the contacting step is carried out in a cell in vitro. In some embodiments, the contacting step is carried out in a cell in vivo. In some embodiments, the contacting step is carried out in a cell ex vivo.
[0248] Because a method that uses a variant Cas12f4 polypeptide includes binding of the variant Cas12f4 polypeptide to a particular region in a target nucleic acid (by virtue of being targeted there by an associated Cas12f4 guide RNA), the methods are generally referred to herein as methods of binding (e.g., a method of binding a target nucleic acid). However, it is to be understood that in some embodiments, while a method of binding may result in nothing more than binding of the target nucleic acid, in other cases, the method can have different final results (e.g., the method can result in modification of the target nucleic acid, e.g., cleavage/methylation/etc, modulation of transcription from the target nucleic acid; modulation of translation of the target nucleic acid; genome editing; modulation of a protein associated with the target nucleic acid; isolation of the target nucleic acid; etc.).
[0249] For examples of suitable methods, see, for example, Jinek et al., Science. 2012 Aug. 17; 337 (6096): 816-21; Chylinski et al., RNA Biol. 2013 May; 10 (5): 726-37; Ma et al., Biomed Res Int. 2013; 2013:270805; Hou et al., Proc Natl Acad Sci USA. 2013 Sep. 24; 110 (39): 15644-9; Jinek et al., Elife. 2013; 2: e00471; Pattanayak et al., Nat Biotechnol. 2013 September; 31 (9): 839-43; Qi et al, Cell. 2013 Feb. 28; 152 (5): 1173-83; Wang et al., Cell. 2013 May 9; 153 (4): 910-8; Auer et al, Genome Res. 2013 Oct. 31; Chen et al., Nucleic Acids Res. 2013 Nov. 1; 41 (20): el9; Cheng et al., Cell Res. 2013 October; 23 (10): 1163-71; Cho et al., Genetics. 2013 November; 195 (3): 1177-80; DiCarlo et al., Nucleic Acids Res. 2013 April; 41 (7): 4336-43; Dickinson et al., Nat Methods. 2013 October; 10 (10): 1028-34; Ebina et al., Sci Rep. 2013; 3:2510; Fujii et al, Nucleic Acids Res. 2013 Nov. 1; 41 (20): e187; Hu et al., Cell Res. 2013 November; 23 (11): 1322-5; Jiang et al., Nucleic Acids Res. 2013 Nov. 1; 41 (20): e188; Larson et al, Nat Protoc. 2013 November; 8 (11): 2180-96; Mali et. at., Nat Methods. 2013 October; 10 (10): 957-63; Nakayama et al., Genesis. 2013 December; 51 (12): 835-43; Ran et al., Nat Protoc. 2013 November; 8 (11): 2281-308; Ran et al., Cell. 2013 Sep. 12; 154 (6): 1380-9; Upadhyay et al., G3 (Bethesda). 2013 Dec. 9; 3 (12): 2233-8; Walsh et al., Proc Natl Acad Sci USA. 2013 Sep. 24; 110 (39): 15514-5; Xie et al., Mol Plant. 2013 Oct. 9; Yang et al., Cell. 2013 Sep. 12; 154 (6): 1370-9; and U.S. patents and patent applications: U.S. Pat. Nos. 8,906,616; 8,895,308; 8,889,418; 8,889,356; 8,871,445; 8,865,406; 8,795,965; 8,771,945; 8,697,359; 20140068797; 20140170753; 20140179006; 20140179770; 20140186843; 20140186919; 20140186958; 20140189896; 20140227787; 20140234972; 20140242664; 20140242699; 20140242700; 20140242702; 20140248702; 20140256046; 20140273037; 20140273226; 20140273230; 20140273231; 20140273232; 20140273233; 20140273234; 20140273235; 20140287938; 20140295556; 20140295557; 20140298547; 20140304853; 20140309487; 20140310828; 20140310830; 20140315985; 20140335063; 20140335620; 20140342456; 20140342457; 20140342458; 20140349400; 20140349405; 20140356867; 20140356956; 20140356958; 20140356959; 20140357523; 20140357530; 20140364333; and 20140377868; each of which is hereby incorporated by reference in its entirety.
[0250] For example, the present disclosure provides (but is not limited to) methods of cleaving a target nucleic acid; methods of editing a target nucleic acid; methods of modulating transcription from a target nucleic acid; methods of isolating a target nucleic acid, methods of binding a target nucleic acid, methods of imaging a target nucleic acid, methods of modifying a target nucleic acid, and the like.
[0251] As used herein, the terms/phrases contact a target nucleic acid and contacting a target nucleic acid, for example, with a variant Cas12f4 polypeptide or with a variant Cas12f4 fusion polypeptide, etc., encompass all methods for contacting the target nucleic acid. For example, a variant Cas12f4 polypeptide can be provided to a cell as protein, RNA (encoding the variant Cas12f4 polypeptide), or DNA (encoding the variant Cas12f4 polypeptide); while a Cas12f4 guide RNA can be provided as a guide RNA or as a nucleic acid encoding the guide RNA. As such, when, for example, performing a method in a cell (e.g., inside of a cell in vitro, inside of a cell in vivo, inside of a cell ex vivo), a method that includes contacting the target nucleic acid encompasses the introduction into the cell of any or all of the components in their active/final state (e.g., in the form of a protein(s) for variant Cas12f4 polypeptide; in the form of a protein for a variant Cas12f4 fusion polypeptide; in the form of an RNA in some embodiments for the guide RNA), and also encompasses the introduction into the cell of one or more nucleic acids encoding one or more of the components (e.g., nucleic acid(s) comprising nucleotide sequence(s) encoding a variant Cas12f4 polypeptide or a variant Cas12f4 fusion polypeptide, nucleic acid(s) comprising nucleotide sequence(s) encoding guide RNA(s), nucleic acid comprising a nucleotide sequence encoding a donor template, and the like). Because the methods can also be performed in vitro outside of a cell, a method that includes contacting a target nucleic acid, (unless otherwise specified) encompasses contacting outside of a cell in vitro, inside of a cell in vitro, inside of a cell in vivo, inside of a cell ex vivo, etc.
[0252] In some embodiments, a method of the present disclosure for modifying a target nucleic acid comprises contacting a target nucleic acid with a variant Cas12f4 polypeptide of the present disclosure, or with a variant Cas12f4 fusion polypeptide of the present disclosure. In some embodiments, a method of the present disclosure for modifying a target nucleic acid comprises contacting a target nucleic acid with a variant Cas12f4 polypeptide and a Cas12f4 guide RNA. In some embodiments, a method of the present disclosure for modifying a target nucleic acid comprises contacting a target nucleic acid with a variant Cas12f4 polypeptide, a first Cas12f4 guide RNA, and a second Cas12f4 guide RNA In some embodiments, a method of the present disclosure for modifying a target nucleic acid comprises contacting a target nucleic acid with a variant Cas12f4 polypeptide of the present disclosure and a Cas12f4 guide RNA and a DNA donor template.
[0253] A variant Cas12f4 polypeptide of the present disclosure, or a variant Cas12f4 fusion polypeptide of the present disclosure, when bound to a Cas12f4 guide RNA, can bind to a target nucleic acid, and in some embodiments, can bind to and modify a target nucleic acid. A target nucleic acid can be any nucleic acid (e.g., DNA, RNA), can be double stranded or single stranded, can be any type of nucleic acid (e.g., a chromosome (genomic DNA), derived from a chromosome, chromosomal DNA, plasmid, viral, extracellular, intracellular, mitochondrial, chloroplast, linear, circular, etc.) and can be from any organism (e.g., as long as the Cas12f4 guide RNA comprises a nucleotide sequence that hybridizes to a target sequence in a target nucleic acid, such that the target nucleic acid can be targeted).
[0254] A target nucleic acid can be DNA or RNA. A target nucleic acid can be double stranded (e.g., dsDNA, dsRNA) or single stranded (e.g., ssRNA, ssDNA). In some embodiments, a target nucleic acid is single stranded. In some embodiments, a target nucleic acid is a single stranded RNA (ssRNA). In some embodiments, a target ssRNA (e.g., a target cell ssRNA, a viral ssRNA, etc.) is selected from: mRNA, IRNA, tRNA, non-coding RNA (ncRNA), long non-coding RNA (IncRNA), and microRNA (miRNA). In some embodiments, a target nucleic acid is a single stranded DNA (ssDNA) (e.g., a viral DNA). As noted above, in some embodiments, a target nucleic acid is single stranded.
[0255] A target nucleic acid can be located anywhere, for example, outside of a cell in vitro, inside of a cell in vitro, inside of a cell in vivo, inside of a cell ex vivo. Suitable target cells (which can comprise target nucleic acids such as genomic DNA) include, but are not limited to: a bacterial cell; an archaeal cell; a cell of a single-cell eukaryotic organism; a plant cell; an algal cell, e.g., Botryococcus braunii, Chlamydomonas reinhardtii, Nannochloropsis gaditana, Chlorella pyrenoidosa, Sargassum patens, C. agardh, and the like; a fungal cell (e.g., a yeast cell); an animal cell; a cell from an invertebrate animal (e.g., fruit fly, a cnidarian, an echinoderm, a nematode, etc.); a cell of an insect (e.g., a mosquito; a bee; an agricultural pest; etc.); a cell of an arachnid (e.g., a spider; a tick; etc.); a cell from a vertebrate animal (e.g., a fish, an amphibian, a reptile, a bird, a mammal); a cell from a mammal (e.g., a cell from a rodent; a cell from a human; a cell of a non-human mammal; a cell of a rodent (e.g., a mouse, a rat); a cell of a lagomorph (e.g., a rabbit); a cell of an ungulate (e.g., a cow, a horse, a camel, a llama, a vicuna, a sheep, a goat, etc.); a cell of a marine mammal (e.g., a whale, a seal, an elephant seal, a dolphin, a sea lion; etc.) and the like. Any type of cell may be of interest (e.g., a stem cell, e.g., an embryonic stem (ES) cell, an induced pluripotent stem (iPS) cell, a germ cell (e.g., an oocyte, a sperm, an oogonia, a spermatogonia, etc.), an adult stem cell, a somatic cell, e.g., a fibroblast, a hematopoietic cell, a neuron, a muscle cell, a bone cell, a hepatocyte, a pancreatic cell; an in vitro or in vivo embryonic cell of an embryo at any stage, e.g., a 1-cell, 2-cell, 4-cell, 8-cell, etc. stage zebrafish embryo; etc.).
[0256] Cells may be from established cell lines or they may be primary cells, where primary cells, primary cell lines, and primary cultures are used interchangeably herein to refer to cells and cells cultures that have been derived from a subject and allowed to grow in vitro for a limited number of passages, i.e. splittings, of the culture. For example, primary cultures are cultures that may have been passaged 0 times, 1 time, 2 times, 4 times, 5 times, 10 times, or 15 times, but not enough times go through the crisis stage. Typically, the primary cell lines are maintained for fewer than 10 passages in vitro. Target cells can be unicellular organisms and/or can be grown in culture. If the cells are primary cells, they may be harvest from an individual by any convenient method. For example, leukocytes may be conveniently harvested by apheresis, leukocytapheresis, density gradient separation, etc., while cells from tissues such as skin, muscle, bone marrow, spleen, liver, pancreas, lung, intestine, stomach, etc. can be conveniently harvested by biopsy.
[0257] In some of the above applications, the subject methods may be employed to induce target nucleic acid cleavage, target nucleic acid modification, and/or to bind target nucleic acids (e.g., for visualization, for collecting and/or analyzing, etc.) in mitotic or post-mitotic cells in vivo and/or ex vivo and/or in vitro (e.g., to disrupt production of a protein encoded by a targeted mRNA, to cleave or otherwise modify target DNA, to genetically modify a target cell, and the like). Because the guide RNA provides specificity by hybridizing to target nucleic acid, a mitotic and/or post-mitotic cell of interest in the disclosed methods may include a cell from any organism (e.g., a bacterial cell, an archaeal cell, a cell of a single-cell eukaryotic organism, a plant cell, an algal cell, e.g., Botryococcus braunii, Chlamydomonas reinhardtii, Nannochloropsis gaditana, Chlorella pyrenoidosa, Sargassum patens, C. agardh, and the like, a fungal cell (e.g., a yeast cell), an animal cell, a cell from an invertebrate animal (e.g., fruit fly, cnidarian, echinoderm, nematode, etc.), a cell from a vertebrate animal (e.g., fish, amphibian, reptile, bird, mammal), a cell from a mammal, a cell from a rodent, a cell from a human, etc.). In some embodiments, a subject variant Cas12f4 protein (and/or nucleic acid encoding the protein such as DNA and/or RNA), and/or Cas12f4 guide RNA (and/or a DNA encoding the guide RNA), and/or donor template, and/or RNP can be introduced into an individual (e.g., the target cell can be in vivo) (e.g., a mammal, a rat, a mouse, a pig, a primate, a non-human primate, a human, etc.). In some case, such an administration can be for the purpose of treating and/or preventing a disease, e.g., by editing the genome of targeted cells.
[0258] Plant cells include cells of a monocotyledon, and cells of a dicotyledon. The cells can be root cells, leaf cells, cells of the xylem, cells of the phloem, cells of the cambium, apical meristem cells, parenchyma cells, collenchyma cells, sclerenchyma cells, and the like. Plant cells include cells of agricultural crops such as wheat, corn, rice, sorghum, millet, soybean, etc. Plant cells include cells of agricultural fruit and nut plants, e.g., plant that produce apricots, oranges, lemons, apples, plums, pears, almonds, etc.
[0259] Non-limiting examples of cells can be found in the section Modified host cells. Guided by a Cas12f4 dual or single guide RNA, a variant Cas12f4 polypeptide in some embodiments generates site-specific double strand breaks (DSBs) or single strand breaks (SSBs) (e.g., when the variant Cas12f4 polypeptide is a nickase variant) within double-stranded DNA (dsDNA) target nucleic acids, which are repaired either by non-homologous end joining (NHEJ) or homology-directed repair (HDR).
[0260] In some embodiments, contacting a target DNAwith a variant Cas12f4 polypeptide and a Cas12f4 guide RNA-occurs under conditions that are permissive for nonhomologous end joining or homology-directed repair. Thus, in some embodiments, a subject method includes contacting the target DNA with a donor polynucleotide or DNA donor template (e.g., by introducing the donor polynucleotide or DNA donor template into a cell), wherein the donor polynucleotide or DNA donor template, a portion of the donor polynucleotide or DNA donor template, a copy of the donor polynucleotide or DNA donor template, or a portion of a copy of the donor polynucleotide or DNA donor template integrates into the target DNA. In some embodiments, the method does not comprise contacting a cell with a donor polynucleotide or DNA donor template, and the target DNA is modified such that nucleotides within the target DNA are deleted.
[0261] In some embodiments, Cas12f4 guide RNA (or DNA encoding same) and a variant Cas12f4 polypeptide (or a nucleic acid encoding same, such as an RNA or a DNA, e.g, one or more expression vectors) are coadministered (e.g., contacted with a target nucleic acid, administered to cells, etc.) with a donor polynucleotide sequence or DNA donor template that includes at least a segment with homology to the target DNA sequence, the subject methods may be used to add, e.g., insert or replace, nucleic acid material to a target DNA sequence (e.g., to knock in a nucleic acid, e.g., one that encodes for a protein, an siRNA, an miRNA, etc.), to add a tag (e.g., 6xHis, a fluorescent protein (e.g., a green fluorescent protein; a yellow fluorescent protein, etc.), hemagglutinin (HA), FLAG, etc.), to add a regulatory sequence to a gene (e.g., promoter, polyadenylation signal, internal ribosome entry sequence (IRES), 2A peptide, start codon, stop codon, splice signal, localization signal, etc.), to modify a nucleic acid sequence (e.g., introduce a mutation, remove a disease causing mutation by introducing a correct sequence), and the like. As such, a complex comprising a Cas12f4 guide RNA and variant Cas12f4 polypeptide is useful in any in vitro or in vivo application in which it is desirable to modify DNA in a site-specific, i.e. targeted, way, for example gene knock-out, gene knock-in, gene editing, gene tagging, etc., as used in, for example, conferring a trait, gene therapy, e.g., to treat a disease or as an antiviral, antipathogenic, or anticancer therapeutic, the production of genetically modified organisms in agriculture, the large scale production of proteins by cells for therapeutic, diagnostic, or research purposes, the induction of iPS cells, biological research, the targeting of genes of pathogens for deletion or replacement, etc.
[0262] In applications in which it is desirable to insert a polynucleotide sequence into the genome where a target sequence is cleaved, a donor polynucleotide or DNA donor template (a nucleic acid comprising a donor sequence) can also be provided to the cell. By a donor sequence or donor polynucleotide or donor template or DNA donor template it is meant a nucleic acid sequence to be inserted at the site cleaved by the variant Cas12f4 polypeptide (e.g., after dsDNA cleavage, after nicking a target DNA, after dual nicking a target DNA, and the like). The donor polynucleotide or DNA donor template can contain sufficient homology to a genomic sequence at the target site, e.g., 70%, 80%, 85%, 90%, 95%, or 100% homology with the nucleotide sequences flanking the target site, e.g., within about 50 bases or less of the target site, e.g., within about 30 bases, within about 15 bases, within about 10 bases, within about 5 bases, or immediately flanking the target site, to support homology-directed repair between it and the genomic sequence to which it bears homology. Approximately 25, 50, 100, or 200 nucleotides, or more than 200 nucleotides, of sequence homology between a donor and a genomic sequence (or any integral value between 10 and 200 nucleotides, or more) can support homology-directed repair. Donor polynucleotides or DNA donor template can be of any length, e.g., 10 nucleotides or more, 50 nucleotides or more, 100 nucleotides or more, 250 nucleotides or more, 500 nucleotides or more, 1000 nucleotides or more, 5000 nucleotides or more, etc.
[0263] The donor sequence or DNA donor template is typically not identical to the genomic sequence that it replaces. Rather, the donor sequence or DNA donor template may contain at least one or more single base changes, insertions, deletions, inversions or rearrangements with respect to the genomic sequence, so long as sufficient homology is present to support homology-directed repair (e.g., for gene correction, e.g., to convert a disease-causing base pair to a non-disease-causing base pair). In some embodiments, the donor sequence or DNA donor template comprises a nonhomologous sequence flanked by two regions of homology, such that homology-directed repair between the target DNA region and the two flanking sequences results in insertion of the non-homologous sequence at the target region. Donor sequences or DNA donor template may also comprise a vector backbone containing sequences that are not homologous to the DNA region of interest and that are not intended for insertion into the DNA region of interest. Generally, the homologous region(s) of a donor sequence or DNA donor template will have at least 50% sequence identity to a genomic sequence with which recombination is desired. In certain embodiments, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 99.9% sequence identity is present. Any value between 1% and 100% sequence identity can be present, depending upon the length of the donor polynucleotide.
[0264] The donor sequence or DNA donor template may comprise certain sequence differences as compared to the genomic sequence, e.g., restriction sites, nucleotide polymorphisms, selectable markers (e.g., drug resistance genes, fluorescent proteins, enzymes etc.), etc., which may be used to assess for successful insertion of the donor sequence at the cleavage site or in some embodiments may be used for other purposes (e.g., to signify expression at the targeted genomic locus). In some embodiments, if located in a coding region, such nucleotide sequence differences will not change the amino acid sequence, or will make silent amino acid changes (e.g., changes which do not affect the structure or function of the protein). Alternatively, these sequences differences may include flanking recombination sequences such as FLPs, loxP sequences, or the like, that can be activated at a later time for removal of the marker sequence.
[0265] In some embodiments, the donor sequence or DNA donor template is provided to the cell as single-stranded DNA. In some embodiments, the donor sequence or DNA donor template is provided to the cell as double-stranded DNA. It may be introduced into a cell in linear or circular form. If introduced in linear form, the ends of the donor sequence may be protected (e.g., from exonucleolytic degradation) by any convenient method and such methods are known to those of skill in the art. For example, one or more dideoxynucleotide residues can be added to the 3 terminus of a linear molecule and/or self-complementary oligonucleotides can be ligated to one or both ends. See, for example, Chang et al. (1987) Proc. Natl. Acad Sci USA 84:4959-4963; Nehls et al. (1996) Science 272:886-889. Additional methods for protecting exogenous polynucleotides from degradation include, but are not limited to, addition of terminal amino group(s) and the use of modified internucleotide linkages such as, for example, phosphorothioates, phosphor amidates, and O-methyl ribose or deoxyribose residues. As an alternative to protecting the termini of a linear donor sequence, additional lengths of sequence may be included outside of the regions of homology that can be degraded without impacting recombination. A donor sequence or DNA donor template can be introduced into a cell as part of a vector molecule having additional sequences such as, for example, replication origins, promoters and genes encoding antibiotic resistance. Moreover, donor sequences can be introduced as naked nucleic acid, as nucleic acid complexed with an agent such as a liposome or poloxamer, or can be delivered by viruses (e.g., adenovirus, AAV, geminiviruses), as described elsewhere herein for nucleic acids encoding a Cas12f4 guide RNA and/or a variant Cas12f4 fusion polypeptide and/or donor polynucleotide.
[0266] As described above, in some embodiments, a nucleic acid (e.g., a recombinant expression vector) of the present disclosure (e.g., a nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure; a nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure; etc.), is used as a transgene to generate a transgenic non-human organism (e.g., a plant) that produces a variant Cas12f4 polypeptide, or a variant Cas12f4 fusion polypeptide, of the present disclosure. The present disclosure provides a transgenic-non-human organism comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide, or a variant Cas12f4 fusion polypeptide, of the present disclosure.
[0267] The present disclosure provides a transgenic non-human animal, which animal comprises a transgene comprising a nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide or a variant Cas12f4 fusion polypeptide. In some embodiments, the genome of the transgenic non-human animal comprises a nucleotide sequence encoding a variant Cas12f4 polypeptide or a variant Cas12f4 fusion polypeptide, of the present disclosure. In some embodiments, the transgenic non-human animal is homozygous for the genetic modification. In some embodiments, the transgenic non-human animal is heterozygous for the genetic modification. In some embodiments, the transgenic non-human animal is a vertebrate, for example, a fish (e.g., salmon, trout, zebra fish, gold fish, puffer fish, cave fish, etc.), an amphibian (frog, newt, salamander, etc.), a bird (e.g., chicken, turkey, etc.), a reptile (e.g., snake, lizard, etc.), a non-human mammal (e.g., an ungulate, e.g., a pig, a cow, a goat, a sheep, etc.; a lagomorph (e.g., a rabbit); a rodent (e.g., a rat, a mouse); a non-human primate; etc.), etc. In some embodiments, the transgenic non-human animal is an invertebrate. In some embodiments, the transgenic non-human animal is an insect (e.g., a mosquito; an agricultural pest; etc.). In some embodiments, the transgenic non-human animal is an arachnid.
[0268] Nucleotide sequences encoding a variant Cas12f4 polypeptide or a variant Cas12f4 fusion polypeptide, of the present disclosure can be under the control of (i.e. operably linked to) an unknown promoter (e.g., when the nucleic acid randomly integrates into a host cell genome) or can be under the control of (i.e. operably linked to) a known promoter. Suitable known promoters can be any known promoter and include constitutively active promoters (e.g., CMV promoter), inducible promoters (e.g., heat shock promoter, tetracycline-regulated promoter, steroid-regulated promoter, metal-regulated promoter, estrogen receptor-regulated promoter, etc.), spatially restricted and/or temporally restricted promoters (e.g., a tissue specific promoter, a cell type specific promoter, etc.), etc.
[0269] As described above, in some embodiments, a nucleic acid (e.g., a recombinant expression vector) of the present disclosure (e.g., a nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of the present disclosure; a nucleic acid comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of the present disclosure; etc.), is used as a transgene to generate a transgenic plant that produces a variant Cas12f4 polypeptide, or a variant Cas12f4 fusion polypeptide, of the present disclosure. The present disclosure provides a transgenic plant comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide, or a variant Cas12f4 fusion polypeptide, of the present disclosure. In some embodiments, the genome of the transgenic plant comprises a subject nucleic acid. In some embodiments, the transgenic plant is homozygous for the genetic modification. In some embodiments, the transgenic plant is heterozygous for the genetic modification.
[0270] Methods of introducing exogenous nucleic acids into plant cells are well known in the art. Such plant cells are considered transformed, as defined above. Suitable methods include viral infection (such as double stranded DNA viruses including geminiviruses), transfection, conjugation, protoplast fusion, electroporation, particle gun technology, calcium phosphate precipitation, direct microinjection, silicon carbide whiskers technology, Agrobacterium-mediated transformation and the like. The choice of method is generally dependent on the type of cell being transformed and the circumstances under which the transformation is taking place (e.g., in vitro, ex vivo, or in vivo).
[0271] Transformation methods based upon the soil bacterium Agrobacterium tumefaciens are particularly useful for introducing an exogenous nucleic acid molecule into a vascular plant. The wild type form of Agrobacterium contains a Ti (tumor-inducing) plasmid that directs production of tumorigenic crown gall growth on host plants. Transfer of the tumor-inducing T-DNA region of the Ti plasmid to a plant genome requires the Ti plasmid-encoded virulence genes as well as T-DNA borders, which are a set of direct DNA repeats that delineate the region to be transferred. An Agrobacterium-based vector is a modified form of a Ti plasmid, in which the tumor inducing functions are replaced by the nucleic acid sequence of interest to be introduced into the plant host.
[0272] Agrobacterium-mediated transformation generally employs cointegrate vectors or binary vector systems, in which the components of the Ti plasmid are divided between a helper vector, which resides permanently in the Agrobacterium host and carries the virulence genes, and a shuttle vector, which contains the gene of interest bounded by T-DNA sequences. A variety of binary vectors is well known in the art and are commercially available, for example, from Clontech (Palo Alto, Calif.). Methods of coculturing Agrobacterium with cultured plant cells or wounded tissue such as leaf tissue, root explants, hypocotyledons, stem pieces or tubers, for example, also are well known in the art. See, e.g., Glick and Thompson, (eds.), Methods in Plant Molecular Biology and Biotechnology, Boca Raton, Fla.: CRC Press (1993).
[0273] Microprojectile-mediated transformation also can be used to produce a subject transgenic plant. This method, first described by Klein et al. (Nature 327:70-73 (1987)), relies on microprojectiles such as gold or tungsten that are coated with the desired nucleic acid molecule by precipitation with calcium chloride, spermidine or polyethylene glycol. The microprojectile particles are accelerated at high speed into an angiosperm tissue using a device such as the BIOLISTIC PD-1000 (Biorad; Hercules Calif.). A nucleic acid of the present disclosure (e.g., a nucleic acid (e.g., a recombinant expression vector) comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide, or a variant Cas12f4 fusion polypeptide, of the present disclosure) may be introduced into a plant in a manner such that the nucleic acid is able to enter a plant cell(s), e.g., via an in vivo or ex vivo protocol. By in vivo, it is meant in the nucleic acid is administered to a living body of a plant e.g., infiltration. By ex vivo it is meant that cells or explants are modified outside of the plant, and then such cells or organs are regenerated to a plant. A number of vectors suitable for stable transformation of plant cells or for the establishment of transgenic plants have been described, including those described in Weissbach and Weissbach, (1989) Methods for Plant Molecular Biology Academic Press, and Gelvin et al., (1990) Plant Molecular Biology Manual, Kluwer Academic Publishers. Specific examples include those derived from a Ti plasmid of Agrobacterium tumefaciens, as well as those disclosed by Herrera-Estrella et al. (1983) Nature 303:209, Bevan (1984) Nucl Acid Res. 12:8711-8721, Klee (1985) Bio/Technolo 3:637-642.
[0274] Alternatively, non-Ti vectors can be used to transfer the DNA into plants and cells by using free DNA delivery techniques. By using these methods transgenic plants such as wheat, rice (Christou (1991) Bio/Technology 9:957-9 and 4462) and corn (Gordon-Kamm (1990) Plant Cell 2:603-618) can be produced. An immature embryo can also be a good target tissue for monocots for direct DNA delivery techniques by using the particle gun (Weeks et al. (1993) Plant Physiol 102:1077-1084; Vasil (1993) Bio/Technolo 10:667-674; Wan and Lemeaux (1994) Plant Physiol 104:37-48 and for Agrobacterium-mediated DNA transfer (Ishida et al. (1996) Nature Biotech 14:745-750). Methods for introduction of DNA into chloroplasts are biolistic bombardment, polyethylene glycol transformation of protoplasts, and microinjection (Danieli et al Nat. Biotechnol 16:345-348, 1998; Staub et al Nat. Biotechnol 18:333-338, 2000; O'Neill et al Plant J. 3:729-738, 1993; Knoblauch et al Nat. Biotechnol 17:906-909; U.S. Pat. Nos. 5,451,513, 5,545,817, 5,545,818, and 5,576,198; in Intl. Application No. WO 95/16783; and in Boynton et al., Methods in Enzymology 217:510-536 (1993), Svab et al., Proc. Natl. Acad. Sci. USA 90:913-917 (1993), and McBride et al., Proc. Natl. Acad. Sci. USA 91:7301-7305 (1994)). Any vector suitable for the methods of biolistic bombardment, polyethylene glycol transformation of protoplasts and microinjection will be suitable as a targeting vector for chloroplast transformation. Any double stranded DNA vector may be used as a transformation vector, especially when the method of introduction does not utilize Agrobacterium.
[0275] Plants which can be genetically modified include grains, forage crops, fruits, vegetables, oil seed crops, palms, forestry, and vines. Specific examples of plants which can be modified follow: maize, banana, peanut, field peas, sunflower, tomato, canola, tobacco, wheat, barley, oats, potato, soybeans, cotton, carnations, sorghum, lupin and rice.
[0276] The present disclosure provides transformed plant cells, tissues, plants and products that contain the transformed plant cells. A feature of the subject transformed cells, and tissues and products that include the same is the presence of a subject nucleic acid integrated into the genome, and production by plant cells of a variant Cas12f4 polypeptide, or a variant Cas12f4 fusion polypeptide, of the present disclosure.
[0277] Recombinant plant cells of the present invention are useful as populations of recombinant cells, or as a tissue, seed, whole plant, stem, fruit, leaf, root, flower, stem, tuber, grain, animal feed, a field of plants, and the like.
[0278] Nucleotide sequences encoding a variant Cas12f4 polypeptide, or a variant Cas12f4 fusion polypeptide, of the present disclosure can be under the control of (i.e. operably linked to) an unknown promoter (e.g., when the nucleic acid randomly integrates into a host cell genome) or can be under the control of (i.e. operably linked to) a known promoter. Suitable known promoters can be any known promoter and include constitutively active promoters, inducible promoters, spatially restricted and/or temporally restricted promoters, etc.
Embodiments
[0279] The following numbered embodiments form part of the present disclosure.
[0280] 1. Variant Cas12f4 polypeptides comprising: [0281] (i) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 1 through 14 of the Cas12f4 sequence of SEQ ID NO: 1; [0282] (ii) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 15 through 178 of the Cas12f4 sequence of SEQ ID NO: 1; [0283] (iii) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 179 through 271 of the Cas12f4 sequence of SEQ ID NO: 1; [0284] (iv) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 272 through 328 of the Cas12f4 sequence of SEQ ID NO: 1; [0285] (v) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 329 through 449 of the Cas12f4 sequence of SEQ ID NO: 1; [0286] (vi) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 450 through 605 of the Cas12f4 sequence of SEQ ID NO: 1; [0287] (vii) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 606 through 656 of the Cas12f4 sequence of SEQ ID NO: 1; [0288] (viii) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 657 through 794 of the Cas12f4 sequence of SEQ ID NO: 1; [0289] (ix) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 795 through 836 of the Cas12f4 sequence of SEQ ID NO: 1; [0290] (x) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 837 through 911 of the Cas12f4 sequence of SEQ ID NO: 1; [0291] (xi) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 912 through 1014 of the Cas12f4 sequence of SEQ ID NO: 1; and/or [0292] (xii) an amino acid substitution of a wild-type amino acid residue at a position of the variant Cas12f4 polypeptide that corresponds to an amino acid from 1015 through 1045 of the Cas12f4 sequence of SEQ ID NO: 1; [0293] wherein the variant Cas12f4 polypeptide exhibits altered functionality relative to a wild-type Cas12f4 polypeptide and
wherein the variant Cas12f4 polypeptide has an amino acid sequence that is at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the Cas12f4 polypeptide comprising an amino acid sequence of SEQ ID NO: 1.
[0294] 2. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is an R (Arg) at position 8 of SEQ ID NO: 1.
[0295] 3. Variant Cas12f4 polypeptides of embodiments 1 or 2, comprising an amino acid substitution R8L (SEQ ID NO: 2).
[0296] 4. Variant Cas12f4 polypeptides of embodiments 1 through 3, wherein Cas12f4 amino acids 1 through 14 comprise at least a portion of the Cas12f4 WED-I domain (SEQ ID NO. 163).
[0297] 5. Variant Cas12f4 polypeptides of embodiments 1 through 4, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 functionality as compared to the wild-type Cas12f4 polypeptide.
[0298] 6. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of an H (His) at position 39, an R (Arg) at position 40, an F (Phe) at position 51, a D (Asp) at position 62, a V (Val) at position 67, an F (Phe) at position 70, an S (Ser) at position 84, an N (Asn) at position 110, an M (Met) at position 125, an S (Ser) at position 145, a Y (Tyr) at position 150, a W (Trp) at position 159, a D (Asp) at position 166, a W (Trp) at position 170, and a G (Gly) at position 171 of SEQ ID NO: 1.
[0299] 7. Variant Cas12f4 polypeptides of embodiments 1 or 6, comprising an amino acid substitution selected from the group consisting of H39F (SEQ ID NO: 3), R40H (SEQ ID NO: 4), F51Y (SEQ ID NO: 5), D62P (SEQ ID NO: 6), V67I (SEQ ID NO: 7), F70Y (SEQ ID NO: 8), S84R (SEQ ID NO: 9), N110I (SEQ ID NO: 10), M125K (SEQ ID NO: 11), S145E (SEQ ID NO: 12), Y150F (SEQ ID NO: 13), W159V (SEQ ID NO: 14), D166P (SEQ ID NO: 15), W170Y (SEQ ID NO: 16), W170N (SEQ ID NO: 17), W170K (SEQ ID NO: 18), G171R (SEQ ID NO: 19), G171K (SEQ ID NO: 20), G171A (SEQ ID NO: 21), and G171N (SEQ ID NO: 22).
[0300] 8. Variant Cas12f4 polypeptides of embodiments 1, 6, or 7, wherein Cas12f4 amino acids 15 through 178 comprise at least a portion of the Cas12f4 Helical-I domain (SEQ ID NO. 164).
[0301] 9. Variant Cas12f4 polypeptides of embodiments 1 or 6 through 8, wherein the Cas12f4 variant polypeptide exhibits an altered genome editing functionality as compared to the wild-type Cas12f4 polypeptide.
[0302] 10. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of an E (Glu) at position 179, an E (Glu) at position 183, a K (Lys) at position 188, a Y (Tyr) at position 207, an H (His) at position 223, a D (Asp) at position 233, an S (Ser) at position 234, a T (Thr) at position 235, a G (Gly) at position 236, an R (Arg) at position 237, a Y (Tyr) at position 241, a K (Lys) at position 245, a L (Leu) at position 252, and an M (Met) at position 253 of SEQ ID NO: 1.
[0303] 11. Variant Cas12f4 polypeptides of embodiments 1 or 10, comprising an amino acid substitution selected from the group consisting of E179R (SEQ ID NO: 23), E179K (SEQ ID NO: 24), E179H (SEQ ID NO: 25), E183Q (SEQ ID NO: 26), E183K (SEQ ID NO: 27), E183R (SEQ ID NO: 28), K188R (SEQ ID NO: 29), Y207W (SEQ ID NO: 30), H223W (SEQ ID NO: 31), H223L (SEQ ID NO: 32), H223Q (SEQ ID NO: 33), K228R (SEQ ID NO: 176), K228X (SEQ ID NO: 177), D233X (SEQ ID NO: 34), S234X (SEQ ID NO: 35), T235X (SEQ ID NO: 36), G236X (SEQ ID NO: 37), R237X (SEQ ID NO: 38), Y241F (SEQ ID NO: 39), K245R (SEQ ID NO: 40), L252E (SEQ ID NO: 41), M253E (SEQ ID NO: 42), and combinations thereof, wherein X designates any amino acid other than the wild-type amino acid.
[0304] 12. Variant Cas12f4 polypeptides of embodiments 1, 10, or 11, wherein Cas12f4 amino acids 179 through 271 comprise at least a portion of the Cas12f4 PI domain (SEQ ID NO. 165).
[0305] 13. Variant Cas12f4 polypeptides of embodiments 1 or 10 through 12, wherein the Cas12f4 variant polypeptide exhibits an altered DNA-binding affinity, an altered DNA-binding specificity, an altered R-loop lifetime, and/or an altered protein stability as compared to the wild-type Cas12f4 polypeptide.
[0306] 14. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a Y (Tyr) at position 283, an N (Asn) at position 295, an A (Ala) at position 305, and an F (Phe) at position 323 of SEQ ID NO: 1
[0307] 15. Variant Cas12f4 polypeptides of embodiments 1 or 14, comprising an amino acid substitution selected from the group consisting of Y283W (SEQ ID NO: 43), N295X (SEQ ID NO: 44), A305M (SEQ ID NO: 45), and F323Y (SEQ ID NO: 46), wherein X designates any amino acid other than the wild-type amino acid.
[0308] 16. Variant Cas12f4 polypeptides of embodiments 1, 14, or 15 wherein Cas12f4 amino acids 272 through 328 comprise at least a portion of the Cas12f4 Helical-I domain (SEQ ID NO. 166).
[0309] 17. Variant Cas12f4 polypeptides of embodiments 1 or 14-16 wherein the Cas12f4 variant polypeptide exhibits an altered DNA-binding affinity and/or an altered DNA-binding specificity as compared to the wild-type Cas12f4 polypeptide.
[0310] 18. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a F (Phe) at position 347, an H (His) at position 352, a K (Lys) at position 353, a V (Val) at position 359, an E (Glu) at position 363, an F (Phe) at position 367, an N (Asn) at position 368, an N (Asn) at position 369, an A (Ala) at position 375, an A (Ala) at position 384, a V (Val) at position 394, an I (Ile) at position 403, a K (Lys) at position 404, an E (Glu) at position 412, a V (Val) at position 419, a V (Val) at position 427, an S (Ser) at position 433, a T (Thr) at position 445, a E (Glu) at position 447, and a C (Cys) at position 448 of SEQ ID NO: 1.
[0311] 19. Variant Cas12f4 polypeptides of embodiments 1 or 18, comprising an amino acid substitution selected from the group consisting of F347Y (SEQ ID NO: 47), F347L (SEQ ID NO: 48), H352Y (SEQ ID NO: 49), K353W (SEQ ID NO: 50), V359T (SEQ ID NO: 51), E363R (SEQ ID NO: 52), F367V (SEQ ID NO: 53), N368T (SEQ ID NO: 54), N369P (SEQ ID NO: 55), A375E (SEQ ID NO: 56), A384G (SEQ ID NO: 57), V394I (SEQ ID NO: 58), I403L (SEQ ID NO: 59), K404X (SEQ ID NO: 60), E412K (SEQ ID NO: 61), V419I (SEQ ID NO: 62), V427M (SEQ ID NO: 63), V427C (SEQ ID NO: 64), S433V (SEQ ID NO: 65), T445V (SEQ ID NO: 66), T445Y (SEQ ID NO: 67), E447L (SEQ ID NO: 68), C448K (SEQ ID NO: 69), C448R (SEQ ID NO: 70), and C448X (SEQ ID NO: 71) wherein X designates any amino acid other than the wild-type amino acid.
[0312] 20. Variant Cas12f4 polypeptides of embodiments 1, 18, or 19, wherein Cas12f4 amino acids 329 through 449 comprise at least a portion of the Cas12f4 Helical-II domain.
[0313] 21. Variant Cas12f4 polypeptides of embodiments 1 or 18-20, wherein the Cas12f4 variant polypeptide exhibits an altered interaction with crRNA within a Cas12f4 heteroduplex.
[0314] 22. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of an S (Ser) at position 470, a K (Lys) at position 471, a K (Lys) at position 472, an A (Ala) at position 474, a V (Val) at position 476, an E (Glu) at position 479, a G (Gly) at position 481, an E (Glu) at position 494, an E (Glu) at position 504, a T (Thr) at position 505, an H (His) at position 507, a K (Lys) at position 514, a E (Glu) at position 517, a V (Val) at position 532, an L (Leu) at position 536, a C (Cys) at position 567, and an N (Asn) at position 586 of SEQ ID NO: 1.
[0315] 23. Variant Cas12f4 polypeptides of embodiments 1 or 22, comprising an amino acid substitution selected from the group consisting of S470D (SEQ ID NO: 72), K471X (SEQ ID NO: 73), K472X (SEQ ID NO: 74), A474K (SEQ ID NO: 75), V476K (SEQ ID NO: 76), E479T (SEQ ID NO: 77), G481K (SEQ ID NO: 78), G481N (SEQ ID NO: 79), E494T (SEQ ID NO: 80), E494Q (SEQ ID NO: 81), E494N (SEQ ID NO: 82), E504K (SEQ ID NO: 83), E504R (SEQ ID NO: 84), T505K (SEQ ID NO: 85), H507R (SEQ ID NO: 86), K514R (SEQ ID NO: 87), E517R (SEQ ID NO: 88), E517Q (SEQ ID NO: 89), V532I (SEQ ID NO: 90), L536F (SEQ ID NO: 91), L536K (SEQ ID NO: 92), L536R (SEQ ID NO: 93), C567R (SEQ ID NO: 94), and N586R (SEQ ID NO: 95), wherein X designates any amino acid other than the wild-type amino acid.
[0316] 24. Variant Cas12f4 polypeptides of embodiments 1, 22, or 23 wherein Cas12f4 amino acids 450 through 605 comprise at least a portion of the Cas12f4 WED-II domain.
[0317] 25. Variant Cas12f4 polypeptides of embodiments 1 or 22-24, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 DNA-binding affinity, Cas12f4 DNA presentation, Cas12f4 nonspecific DNA recognition, Cas12f4 interaction with the PAM minor groove, Cas12f4 DNA contact adjacent to PAM, and/or Cas12f4 interactions with BPs and BB.
[0318] 26. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a D (Asp) at position 619, an F (Phe) at position 644, and an F (Phe) at position 651 of SEQ ID NO: 1.
[0319] 27. Variant Cas12f4 polypeptides of embodiments 1 or 26, comprising an amino acid substitution D619A (SEQ ID NO: 96), F644Y (SEQ ID NO: 97), and F651M (SEQ ID NO: 98).
[0320] 28. Variant Cas12f4 polypeptides of embodiments 1, 26, or 27 wherein Cas12f4 amino acids 606 through 656 comprise at least a portion of the Cas12f4 RuvC-I domain.
[0321] 29. Variant Cas12f4 polypeptides of embodiments 1 or 26-28, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 RuvC catalytic activity.
[0322] 30. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of an L (Leu) at position 662, an N (Asn) at position 673, an H (His) at position 674, an I (Ile) at position 682, an F (Phe) at position 695, an H (His) at position 702, an A (Ala) at position 717, a W (Trp) at position 764, a T (Thr) at position 766, a G (Gly) at position 771, and an E (Glu) at position 788 of SEQ ID NO: 1.
[0323] 31. Variant Cas12f4 polypeptides of embodiments 1 or 30, comprising an amino acid substitution selected from the group consisting of L662R (SEQ ID NO: 99), L662K (SEQ ID NO: 100), L662H (SEQ ID NO: 101), N673S (SEQ ID NO: 102), H674Y (SEQ ID NO: 103), I682S (SEQ ID NO: 104), F695L (SEQ ID NO: 105), H702N (SEQ ID NO: 106), H702K (SEQ ID NO: 107), H702R (SEQ ID NO: 108), A717V (SEQ ID NO: 110), A717L (SEQ ID NO: 111), W764R (SEQ ID NO: 112), T766H (SEQ ID NO: 113), G771E (SEQ ID NO: 114), and E788T (SEQ ID NO: 115).
[0324] 32. Variant Cas12f4 polypeptides of embodiments 1, 30, or 31, wherein Cas12f4 amino acids 657 through 794 comprise at least a portion of the Cas12f4 Helical-III domain.
[0325] 33. Variant Cas12f4 polypeptides of embodiments 1 or 30-32, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 crRNA interactions and/or RuvC catalytic activity.
[0326] 34. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of an F (Phe) at position 800, an A (Ala) at position 805, an S (Ser) at position 811, a K (Lys) at position 813, an R (Arg) at position 814, an E (Glu) at position 815, an L (Leu) at position 825 of SEQ ID NO: 1, a T (Thr) at position 827, and a Q (Gln) at position 830.
[0327] 35. Variant Cas12f4 polypeptides of embodiments 1 or 34, comprising an amino acid substitution selected from the group consisting of F800Y (SEQ ID NO: 116), A805E (SEQ ID NO: 117), S811R (SEQ ID NO: 118), K813R (SEQ ID NO: 119), R814K (SEQ ID NO: 120), E815K (SEQ ID NO: 121), L825V (SEQ ID NO: 122), L825I (SEQ ID NO: 123), L825A (SEQ ID NO: 124), L825F (SEQ ID NO: 125), T827K (SEQ ID NO: 126), T827R (SEQ ID NO: 127), and Q830L (SEQ ID NO: 128).
[0328] 36. Variant Cas12f4 polypeptides of embodiments 1, 34, or 35 wherein Cas12f4 amino acids 795 through 836 comprise at least a portion of the Cas12f4 BH domain.
[0329] 37. Variant Cas12f4 polypeptides of embodiments 1 or 34-36, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 crRNA interaction and/or RuvC catalytic activity.
[0330] 38. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a V (Val) at position 841, a V (Val) at position 843, an E (Glu) at position 844, an S (Ser) at position 853, a C (Cys) at position 866, as S (Ser) at position 867, an M (Met) at position 877, an I (Ile) at position 885, an A (Ala) at position 890, an S (Ser) at position 894, and an L (Leu) at position 899 of SEQ ID NO: 1.
[0331] 39. Variant Cas12f4 polypeptides of embodiments 1 or 38, comprising an amino acid substitution selected from the group consisting of V841I (SEQ ID NO: 129), V843G (SEQ ID NO: 130), V843C (SEQ ID NO: 131), E844A (SEQ ID NO: 132), E844V (SEQ ID NO: 133), S853W (SEQ ID NO: 134), C866I (SEQ ID NO: 135), C866V (SEQ ID NO: 136), S867A (SEQ ID NO: 137), M877L (SEQ ID NO: 138), 1885L (SEQ ID NO: 139), 1885F (SEQ ID NO: 140), A890P (SEQ ID NO: 141), S894A (SEQ ID NO: 142), and L899F (SEQ ID NO: 143).
[0332] 40. Variant Cas12f4 polypeptides of embodiments 1, 38, or 39, wherein Cas12f4 amino acids 834 through 908 comprise at least a portion of the Cas12f4 RuvC-II domain.
[0333] 41. Variant Cas12f4 polypeptides of embodiments 1 or 38-40, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 crRNA interaction and/or RuvC catalytic activity.
[0334] 42. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a C (Cys) at position 914, a Y (Tyr) at position 916, an S (Ser) at position 917, a Q (Gln) at position 929, an A (Ala) at position 933, a V (Val) at position 936, a W (Trp) at position 938, a C (Cys) at position 947, a G (Gly) at position 951, an H (His) at position 959, an L (Leu) at position 967, a V (Val) at position 990, a T (Thr) at position 993, and a C (Cys) at position 1014 of SEQ ID NO: 1.
[0335] 43. Variant Cas12f4 polypeptides of embodiments 1 or 42, comprising an amino acid substitution selected from the group consisting of C914A (SEQ ID NO: 144), Y916F (SEQ ID NO: 145), S917K (SEQ ID NO: 146), Q929L (SEQ ID NO: 147), A933K (SEQ ID NO: 148), A933R (SEQ ID NO: 149), V936L (SEQ ID NO: 150), W938L (SEQ ID NO: 151), C947A (SEQ ID NO: 152), C947Y (SEQ ID NO: 153), G951A (SEQ ID NO: 154), H959Y (SEQ ID NO: 155), L967Y (SEQ ID NO: 156), V990K (SEQ ID NO: 157), T993S (SEQ ID NO: 158), C1014E (SEQ ID NO: 159), and C1014N (SEQ ID NO: 160).
[0336] 44. Variant Cas12f4 polypeptides of embodiments 1, 42, or 43 wherein Cas12f4 amino acids 912 through 1014 comprise at least a portion of the Cas12f4 Nuc domain.
[0337] 45. Variant Cas12f4 polypeptides of embodiments 1 or 42-44, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 RuvC catalytic activity.
[0338] 46. Variant Cas12f4 polypeptides of embodiment 1, wherein the wild-type amino acid residue within Cas12f4 is selected from the group consisting of a D (Asp) at position 1017 and a C (Cys) at position 1025 of SEQ ID NO: 1.
[0339] 47. Variant Cas12f4 polypeptides of embodiments 1 or 46, comprising an amino acid substitution selected from the group consisting of D1017A (SEQ ID NO: 161) and C1025A (SEQ ID NO: 162).
[0340] 48. Variant Cas12f4 polypeptides of embodiments 1, 46, or 47 wherein Cas12f4 amino acids 1015 through 1045 comprise at least a portion of the Cas12f4 RuvC-III domain.
[0341] 49. Variant Cas12f4 polypeptides of embodiments 1 or 46-48, wherein the Cas12f4 variant polypeptide exhibits an altered Cas12f4 RuvC catalytic activity.
[0342] 50. Compositions comprising: [0343] a) variant Cas12f4 polypeptides of any one of embodiments 1 to 49 or a nucleic acid molecule encoding variant Cas12f4 polypeptides of any one of embodiments 1 to 49 and [0344] b) a Cas12f4 guide RNA or one or more nucleic acids encoding a Cas12f4 guide RNA.
[0345] 51. Compositions of embodiment 50, wherein the Cas12f4 guide RNA is a single guide RNA.
[0346] 52. Composition of embodiment 50, wherein the Cas12f4 guide RNA comprises: [0347] (i) a targeting sequence of a variable RNA of about 20 or 21 to about 23 or 24 nucleotides at the 5 end that is complementary to editing/cleavage target; and [0348] (ii) a crRNA of about 16, 17, or 18 to about 20 or 21 nucleotides at the 3 end that can be bound by the Cas12 polypeptide, optionally wherein the crRNA molecule comprises the polyribonucleotide sequence of SEQ ID NO: 175.
[0349] 53. Compositions of embodiment 50, wherein the composition comprises a lipid.
[0350] 54. Compositions of embodiments 50, wherein the variant Cas12f4 polypeptide or nucleic acid encoding the variant Cas12f4 polypeptide and the Cas12f4 guide RNA or nucleic acid(s) encoding the Cas12f4 guide RNA are within a liposome.
[0351] 55. Compositions of embodiment 50, wherein the variant Cas12f4 polypeptide or nucleic acid encoding the variant Cas12f4 polypeptide and the Cas12f4 guide RNA or nucleic acid(s) encoding the Cas12f4 guide RNA are within and/or at least partially coat a particle.
[0352] 56. Compositions of embodiment 50, comprising a buffer, a nuclease inhibitor, and/or a protease inhibitor.
[0353] 57. Compositions of embodiment 50, wherein the variant Cas12f4 polypeptide is a nickase that cleaves only one strand of a double-stranded target nucleic acid molecule.
[0354] 58. Compositions of embodiment 50, wherein the mutant Cas12f4 polypeptide is a catalytically inactive mutant Cas12f4 polypeptide.
[0355] 59. Compositions of embodiment 50, further comprising a DNA donor template.
[0356] 60. Variant Cas12f4 fusion polypeptides comprising variant Cas12f4 polypeptides of any one of embodiments 1 to 49 fused to a heterologous polypeptide.
[0357] 61. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the variant Cas12f4 polypeptide is a nickase that cleaves only one strand of a double-stranded target nucleic acid molecule.
[0358] 62. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the variant Cas12f4 polypeptide is a catalytically inactive mutant Cas12f4 polypeptide.
[0359] 63. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide is operably linked to the N-terminus and/or the C-terminus of the variant Cas12f4 polypeptide.
[0360] 64. Variant Cas12f4 fusion polypeptides of embodiment 60, comprising a nuclear localization signal (NLS).
[0361] 65. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide is a targeting polypeptide that binds to a cell surface moiety on a target cell or target cell type.
[0362] 66. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide exhibits an enzymatic activity that modifies a target DNA.
[0363] 67. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a nuclease activity, a methyltransferase activity, a demethylase activity, a DNA repair activity, a DNA damage activity, a deamination activity, a dismutase activity, an alkylation activity, a depurination activity, an oxidation activity, a pyrimidine dimer forming activity, an integrase activity, a transposase activity, a recombinase activity, a polymerase activity, a ligase activity, a helicase activity, a photolyase activity, and a glycosylase activity.
[0364] 68. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a nuclease activity, a methyltransferase activity, a demethylase activity, a deamination activity, a depurination activity, an integrase activity, a transposase activity, and a recombinase activity.
[0365] 69. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide exhibits an enzymatic activity that modifies a target polypeptide associated with a target nucleic acid.
[0366] 70. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide exhibits histone modification activity.
[0367] 71. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide exhibits an enzymatic activities selected from the group consisting of a methyltransferase activity, a demethylase activity, an acetyltransferase activity, a deacetylase activity, a kinase activity, a phosphatase activity, a ubiquitin ligase activity, a deubiquitinating activity, an adenylation activity, a deadenylation activity, a SUMOylating activity, a deSUMOylating activity, a ribosylation activity, a deribosylation activity, a myristoylation activity, a demyristoylation activity, a glycosylation activity (e.g., from O-GlcNAc transferase), and a deglycosylation activity.
[0368] 72. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a methyltransferase activity, a demethylase activity, an acetyltransferase activity, and a deacetylase activity.
[0369] 73. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide is an endosomal escape polypeptide.
[0370] 74. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide is a chloroplast transit peptide.
[0371] 75. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide increases or decreases transcription of a gene when the variant Cas12f4 fusion polypeptide is bound to the gene and a guide RNA.
[0372] 76. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide is a transcriptional repressor domain.
[0373] 77. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide is a transcriptional activation domain.
[0374] 78. Variant Cas12f4 fusion polypeptides of embodiment 60, wherein the heterologous polypeptide comprises a protein binding domain.
[0375] 79. Nucleic acid molecules encoding variant Cas12f4 fusion polypeptides of any one of embodiments 60 to 78.
[0376] 80. Nucleic acid molecules of embodiment 79, wherein the nucleotide sequence encoding the mutant Cas12f4 fusion polypeptide is operably linked to a promoter.
[0377] 81. Nucleic acid molecules of embodiments 79 or 80, wherein the promoter is functional in a eukaryotic cell.
[0378] 82. Nucleic acid molecule of embodiments 79, 80, or 81, wherein the eukaryotic cell is selected from the group consisting of a plant cell, a fungal cell, an animal cell, cell of an invertebrate, a fly cell, a cell of a vertebrate, a mammalian cell, a primate cell, a non-human primate cell, and a human cell.
[0379] 83. Nucleic acid molecules of embodiments 79 through 82, wherein the promoter is selected from the group consisting of a constitutive promoter, an inducible promoter, a cell type-specific promoter, and a tissue-specific promoter.
[0380] 84. Nucleic acid molecules of embodiments 79 through 83, wherein the nucleic acid molecule is a DNA molecule.
[0381] 85. Nucleic acid molecules of embodiments 79 through 84, wherein the DNA molecule is an expression vector.
[0382] 86. Nucleic acid molecules of embodiments 79 through 85, wherein the expression vector is selected from the group consisting of an adeno-associated viral vector, a retroviral vector, and a lentiviral vector.
[0383] 87. Nucleic acid molecules of embodiments 79 through 86, wherein the promoter is functional in a prokaryotic cell.
[0384] 88. Nucleic acid molecules of embodiments 79 through 87, wherein the nucleic acid molecule is an mRNA.
[0385] 89. Nucleic acid molecules encoding: [0386] (a) a Cas12f4 guide RNA, which comprises a crRNA and a spacer RNA; and [0387] (b) variant Cas12f4 polypeptides of any one of embodiments 1 to 49 or a variant Cas12f4 fusion polypeptide of any one of embodiments 60 to 78.
[0388] 90. Nucleic acid molecules of embodiment 89, wherein the variant Cas12f4 polypeptides are catalytically inactive.
[0389] 91. Nucleic acid molecules of embodiment 89, wherein the crRNA molecule comprises the polyribonucleotide sequence of SEQ ID NO: 175.
[0390] 92. Nucleic acid molecules of embodiment 89, wherein the catalytically inactive variant Cas12f4 polypeptide comprises an amino acid substitution within a nuclease (NUC) lobe that decreases or inactivates a Cas12f4 nuclease activity.
[0391] 93. Nucleic acid molecules of embodiment 89, wherein the Cas12f4 guide RNA is a single guide RNA.
[0392] 94. Nucleic acid molecules of embodiment 89, wherein the nucleic acid molecule comprises a nucleotide sequence encoding an crRNA and a nucleotide sequence encoding a spacer, and wherein the nucleotide sequence encoding the crRNA and the nucleotide sequence encoding the spacer are on different DNA molecules.
[0393] 95. Nucleic acid molecules of embodiment 89, wherein the nucleic acid molecule comprises a nucleotide sequence that (a) encodes the variant Cas12f4 and (2) is operably linked to a promoter.
[0394] 96. Nucleic acid molecules of embodiment 95, wherein the promoter is functional in a eukaryotic cell.
[0395] 97. Nucleic acid molecules of embodiment 96, wherein the eukaryotic cell is selected from the group consisting of a plant cell, a fungal cell, an animal cell, a cell of an invertebrate, a fly cell, a cell of a vertebrate, a mammalian cell, a primate cell, a non-human primate cell, and a human cell.
[0396] 98. Nucleic acid molecules of embodiment 95, wherein the promoter is selected from the group consisting of a constitutive promoter, an inducible promoter, a cell type-specific promoter, and a tissue-specific promoter.
[0397] 99. Nucleic acid molecules of embodiment 89, wherein the nucleic acid molecules is an expression vector.
[0398] 100. Nucleic acid molecules of embodiment 99, wherein the expression vector is selected from the group consisting of an adeno-associated viral vector, a retroviral vector, and a lentiviral vector.
[0399] 101. Nucleic acid molecules of embodiment 95, wherein the promoter is functional in a prokaryotic cell.
[0400] 102. Cell comprising: variant Cas12f4 polypeptides of any one of embodiments 1 to 49, variant Cas12f4 fusion polypeptides of any one of embodiments 60 to 78, nucleic acid molecules encoding variant Cas12f4 polypeptides, or nucleic acid molecules encoding variant Cas12f4 fusion polypeptides.
[0401] 103. Cells of embodiment 102, further comprising a Cas12f4 guide RNA or a nucleic acid molecule encoding a Cas12f4 guide RNA, optionally wherein the Cas12f4 guide RNA comprises a crRNA molecule comprising the polyribonucleotide sequence of SEQ ID NO: 175.
[0402] 104. Cell of embodiment 102, wherein the cell comprises a nucleic acid molecule encoding a variant Cas12f4 polypeptide or a variant Cas12f4 fusion polypeptide, wherein the nucleic acid molecule is integrated into the genomic DNA of the cell.
[0403] 105. Cells of embodiment 102, wherein the cell is a eukaryotic cell.
[0404] 106. Cells of embodiment 105, wherein the eukaryotic cell is selected from the group consisting of a plant cell, a mammalian cell, an insect cell, an arachnid cell, a fungal cell, a bird cell, a reptile cell, an amphibian cell, an invertebrate cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, and a human cell.
[0405] 107. Cells of embodiments 102, wherein the cell is a prokaryotic cell.
[0406] 108. Methods for modifying target nucleic acids, comprising: contacting a target nucleic acid with: (a) variant Cas12f4 polypeptides of any one of embodiments 1 to 49 or variant Cas12f4 fusion polypeptides of any one of embodiments 60 to 78 and (b) Cas12f4 guide RNAs comprising a guide sequence that hybridize to a target sequence of the target nucleic acid, wherein the contacting results in modification of the target nucleic acid by the variant Cas12f4 polypeptide or variant Cas12f4 fusion polypeptide.
[0407] 109. Method of embodiment 108, wherein the modification comprises cleavage of the target nucleic acid.
[0408] 110. Methods of embodiment 108, wherein the target nucleic acid is selected from the group consisting of a double-stranded DNA, a single-stranded DNA, an RNA, a genomic DNA, and an extrachromosomal DNA.
[0409] 111. Methods of embodiment 108, wherein the contacting takes place in vitro outside of a cell.
[0410] 112. Method of embodiment 108, wherein the contacting takes place inside of a cell in culture.
[0411] 113. Methods of embodiments 108, wherein the contacting takes place inside of a cell
[0412] in vivo.
[0413] 114. Methods of embodiments 112 or 113, wherein the cell is a eukaryotic cell.
[0414] 115. Methods of embodiments 114, wherein the eukaryotic cell is selected from the group consisting of a plant cell, a fungal cell, a mammalian cell, a reptile cell, an insect cell, an avian cell, a fish cell, a parasite cell, an arthropod cell, a cell of an invertebrate, a cell of a vertebrate, a rodent cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, and a human cell.
[0415] 116. Methods of embodiments 112 or 113, wherein the cell is a prokaryotic cell. 117. Methods of embodiment 108, wherein the contacting results in genome editing.
[0416] 118. Methods of embodiment 108, wherein the contacting comprises introducing into a cell: (a) variant Cas12f4 polypeptides, variant Cas12f4 fusion polypeptides, nucleic acid molecules encoding variant Cas12f4 polypeptides, or nucleic acid molecules encoding variant Cas12f4 fusion polypeptides; and (b) Cas12f4 guide RNAs or nucleic acid molecules encoding Cas12f4 guide RNAs.
[0417] 119. Method of embodiment 108, wherein the Cas12f4 guide RNA comprises a crRNA molecule comprising the polyribonucleotide sequence of SEQ ID NO: 175.
[0418] 120. Method of embodiments 112 or 113, wherein the contacting further comprises introducing a DNA donor template into the cell.
[0419] 121. Methods of embodiments 108 through 120, wherein the Cas12f4 guide RNA is a single guide RNA.
[0420] 122. Methods of any one of embodiments 108 through 120, wherein the Cas12f4 guide RNA comprises: (i) targeting sequences of variable RNA of about 20 or 21 to about 23 or 24 nucleotides at the 5 end that is complementary to an editing/cleavage target; and (ii) a crRNA of about 16, 17, or 18 to about 20 or 21 nucleotides at the 3 end that is bound by the Cas12f4 polypeptide.
[0421] 123. Methods for modulating transcription from a target DNA, modifying a target nucleic acid, or modifying a protein associated with a target nucleic acid, the method comprising contacting the target nucleic acid with (a) a variant Cas12f4 fusion polypeptide, which fusion polypeptide comprises a variant Cas12f4 polypeptide of any one of embodiments 1 to 49 fused to a heterologous polypeptide; and (b) a Cas12f4 guide RNA comprising a guide sequence that hybridizes to a target sequence of the target nucleic acid.
[0422] 124. Methods of embodiment 123, wherein the Cas12f4 guide RNA comprises a crRNA molecule comprising the polyribonucleotide sequence of SEQ ID NO: 175.
[0423] 125. Methods of embodiment 123, wherein the Cas12f4 guide RNA is a single guide RNA.
[0424] 126. Methods of embodiment 123, wherein the Cas12f4 guide RNA comprises: (i) a targeting sequence comprising a variable RNA of about 20 or 21 to about 23 or 24 nucleotides at the 5 end that is complementary to an editing/cleavage target; and (ii) a crRNA of about 16, 17, or 18 to about 20 or 21 nucleotides at the 3 end that is bound by the Cas12f4 polypeptide.
[0425] 127. Methods of embodiment 126, wherein the crRNA comprises an RNA molecule comprising the polyribonucleotide sequence of SEQ ID NO: 175.
[0426] 128. Methods of embodiment 123, wherein the modification is not cleavage of the target nucleic acid.
[0427] 129. Methods of embodiment 123, wherein the target nucleic acid is selected from the group consisting of a double stranded DNA, a single stranded DNA, an RNA, a genomic DNA, and an extrachromosomal DNA.
[0428] 130. Methods of embodiment 123, wherein the contacting takes place in vitro outside of a cell.
[0429] 131. Methods of embodiment 123, wherein the contacting takes place inside of a cell in culture.
[0430] 132. Methods of embodiment 123, wherein the contacting takes place inside of a cell in vivo.
[0431] 133. Methods of embodiments 131 or 132, wherein the cell is a eukaryotic cell.
[0432] 134. Methods of embodiment 133, wherein the eukaryotic cell is selected from the group consisting of a plant cell, a fungal cell, a mammalian cell, a reptile cell, an insect cell, an avian cell, a fish cell, a parasite cell, an arthropod cell, a cell of an invertebrate, a cell of a vertebrate, a rodent cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, or a human cell.
[0433] 135. Methods of embodiments 131 or 132, wherein the cell is a prokaryotic cell.
[0434] 136. Methods of embodiment 123, wherein the contacting comprises: introducing into a cell (a) the variant Cas12f4 fusion polypeptide or a nucleic acid molecule encoding the mutant Cas12f4 fusion polypeptide and (b) the Cas12f4 guide RNA or a nucleic acid molecule encoding the Cas12f4 guide RNA.
[0435] 137. Methods of embodiment 123, wherein the variant Cas12f4 polypeptide is catalytically inactive.
[0436] 138. Methods of embodiment 123, wherein the catalytically inactive variant Cas12f4 polypeptide comprises an amino acid substitution that decreases or inactivates the nuclease activity.
[0437] 139. Methods of embodiment 123, wherein the heterologous polypeptide exhibits an enzymatic activity that modifies a target DNA.
[0438] 140. Methods of embodiment 123, wherein the heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a nuclease activity, a methyltransferase activity, a demethylase activity, a DNA repair activity, a DNA damage activity, a deamination activity, a dismutase activity, an alkylation activity, a depurination activity, an oxidation activity, a pyrimidine dimer forming activity, an integrase activity, a transposase activity, a recombinase activity, a polymerase activity, a ligase activity, a helicase activity, a photolyase activity, and a glycosylase activity.
[0439] 141. Methods of embodiment 123, wherein the heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a nuclease activity, a methyltransferase activity, a demethylase activity, a deamination activity, a depurination activity, an integrase activity, a transposase activity, and a recombinase activity.
[0440] 142. Methods of embodiment 123, wherein the heterologous polypeptide exhibits an enzymatic activity that modifies a target polypeptide associated with a target nucleic acid.
[0441] 143. Methods of embodiments 123, wherein the heterologous polypeptide exhibits histone modification activity.
[0442] 144. Methods of embodiments 123, wherein the heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a methyltransferase activity, a demethylase activity, an acetyltransferase activity, a deacetylase activity, a kinase activity, a phosphatase activity, a ubiquitin ligase activity, a deubiquitinating activity, an adenylation activity, a deadenylation activity, a SUMOylating activity, a deSUMOylating activity, a ribosylation activity, a deribosylation activity, a myristoylation activity, a demyristoylation activity, a glycosylation activity (e.g., from O-GlcNAc transferase), and a deglycosylation activity.
[0443] 145. Methods of embodiment 123, wherein the heterologous polypeptide exhibits an enzymatic activity selected from the group consisting of a methyltransferase activity, a demethylase activity, an acetyltransferase activity, and a deacetylase activity.
[0444] 146. Methods of embodiment 123, wherein the heterologous polypeptide is a protein that increases or decreases transcription of a gene when the mutant Cas12f4 fusion polypeptide is bound to the gene and a guide RNA.
[0445] 147. Methods of embodiment 123, wherein the heterologous polypeptide comprises a transcriptional repressor domain.
[0446] 148. Methods of embodiment 123, wherein the heterologous polypeptide comprises a transcriptional activation domain.
[0447] 149. Methods of embodiment 123, wherein the heterologous polypeptide comprises a protein binding domain.
[0448] 150. Transgenic, multicellular, non-human organisms comprising transgenes comprising a nucleotide sequence encoding: (a) a variant Cas12f4 polypeptide of any one of embodiments 1 to 49 or a variant Cas12f4 fusion polypeptide of any one of embodiments 60 to 78 and, optionally, (b) a Cas12f4 guide RNA.
[0449] 151. Transgenic, multicellular, non-human organisms of embodiments 150, wherein the variant Cas12f4 polypeptide is catalytically inactive or wherein the variant Cas12f4 fusion polypeptide comprises a dCas12f4 polypeptide.
[0450] 152. Transgenic, multicellular, non-human organisms of embodiment 150, wherein the variant Cas12f4 polypeptide comprises an amino acid substitution that decreases or inactivates the Cas12f4 nuclease activity.
[0451] 153. Transgenic, multicellular, non-human organisms of embodiment 150, wherein the organism is selected from the group consisting of a plant, a monocotyledon plant, a dicotyledon plant, an invertebrate animal, an insect, an arthropod, an arachnid, a parasite, a worm, a cnidarian, a vertebrate animal, a fish, a reptile, an amphibian, an ungulate, a bird, a pig, a horse, a sheep, a rodent, a mouse, a rat, and a non-human primate.
[0452] 154. Systems comprising a combination of components selected from the group consisting of (a) a variant Cas12f4 polypeptide of any one of embodiments 1 to 49 and a Cas12f4 single guide RNA; (b) a variant Cas12f4 polypeptide of any one of embodiments 1 to 49, a Cas12f4 guide RNA, and a DNA donor template; (c) a variant Cas12f4 fusion polypeptide of any one of embodiments 60 to 78 and a Cas12f4 guide RNA; (d) a variant Cas12f4 fusion polypeptide of any one of embodiments 60 to 78, a Cas12f4 guide RNA, and a DNA donor template; (e) an mRNA encoding a variant Cas12f4 polypeptide of any one of embodiments 1 to 49 and a Cas12f4 single guide RNA; (f) an mRNA encoding a variant Cas12f4 polypeptide of any one of embodiments 1 to 49, a Cas12f4 guide RNA, and a DNA donor template; (g) an mRNA encoding a variant Cas12f4 fusion polypeptide of any one of embodiments 60 to 78 and a Cas12f4 guide RNA; (h) an mRNA encoding the mutant Cas12f4 fusion polypeptide of any one of embodiments 60 to 78, a Cas12f4 guide RNA, and a DNA donor template; (i) an expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of any one of embodiments 1 to 49 and a nucleotide sequence encoding a Cas12f4 guide RNA; (j) an expression vector comprising a nucleotide sequence encoding a variant Cas12f4 polypeptide of any one of embodiments 1 to 49, a nucleotide sequence encoding a Cas12f4 guide RNA, and a DNA donor template; (k) an expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of any one of embodiments 60 to 78 and a nucleotide sequence encoding a Cas12f4 guide RNA; and (1) an expression vector comprising a nucleotide sequence encoding a variant Cas12f4 fusion polypeptide of any one of embodiments 60 to 78, a nucleotide sequence encoding a Cas12f4 guide RNA, and a DNA donor template.
[0453] 155. Systems of embodiment 154, wherein the Cas12f4 guide RNA or Cas12f4 single gRNA comprises a crRNA and a spacer RNA; optionally wherein the crRNA molecule comprises the polyribonucleotide sequence of SEQ ID NO: 175.
[0454] 156. Compositions of embodiment 50, methods of embodiment 108, or systems of embodiment 154, wherein the DNA donor template has a length of 8 nucleotides to 1000 nucleotides or 8 base pairs to 1000 base pairs; or wherein the DNA donor template has a length of 25 nucleotides to 500 nucleotides or 25 base pairs to 500 base pairs.
[0455] The term and/or where used herein is to be taken as specific disclosure of each of the two or more specified features or components with or without the other specified features. Thus, the term and/or as used in a phrase such as A and/or B herein is intended to include A and B, A or B, A (alone), and B (alone). Likewise, the term and/or as used in a phrase such as A, B, and/or C is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
[0456] Words and phrases using the singular or plural number also include the plural and singular number, respectively. For example, terms such as a or an and phrases such as at least one and one or more include both the singular and the plural. Terms that are intended to be open (including, for example, the words comprise, comprising, include, including, have, and having, and the like) are to be construed in an inclusive sense as opposed to an exclusive or exhaustive sense. That is, the term including should be interpreted as including but not limited to, the term includes should be interpreted as includes but is not limited to, the term having should be interpreted as having at least. The use of the term or in the claims is used to mean and/or unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives and and/or.
[0457] Thus, for example, reference to a Cas12f4 polypeptide includes a plurality of such polypeptides and reference to the guide RNA includes reference to one or more guide RNAs and equivalents thereof known to those skilled in the art, and so forth. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as solely, only and the like in connection with the recitation of claim elements, or use of a negative limitation.
[0458] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and are also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
[0459] Additionally, the terms herein, above, and below, and words of similar import, when used in this application, shall refer to this application as a whole and not to any particular portion of the application.
[0460] It will be further understood that where features or aspects of the disclosure are described in terms of Markush groups, the disclosure is also intended to be described in terms of any individual member or subgroup of members of the Markush group. Similarly, all ranges disclosed herein also encompass all possible sub-ranges and combinations of sub-ranges and that language such as between, up to, at least, greater than, less than, and the like include the number recited in the range and includes each individual member.
[0461] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.
[0462] Certain features of the disclosure, which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the invention, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable sub-combination. All combinations of the embodiments pertaining to the invention are specifically embraced by the present invention and are disclosed herein just as if each and every combination was individually and explicitly disclosed. In addition, all sub-combinations of the various embodiments and elements thereof are also specifically embraced by the present invention and are disclosed herein just as if each and every such sub-combination was individually and explicitly disclosed herein.
[0463] To the extent to which any of the preceding definitions is inconsistent with definitions provided in any patent or non-patent reference incorporated herein by reference, any patent or non-patent reference cited herein, or in any patent or non-patent reference found elsewhere, it is understood that the preceding definition will be used herein.
[0464] The practice of the present disclosure will employ, unless indicated specifically to the contrary, conventional methodology and techniques that are in common use in the fields of virology, oncology, immunology, microbiology, molecular biology, and recombinant DNA, which methodology and techniques are well known by and readily available to those having skill of the art. Such methodology and techniques are explained fully in laboratory manuals as well as the scientific and patent literature. See, e.g., Sambrook, et al., Molecular Cloning: A Laboratory Manual (2nd Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989); Maniatis et al., Molecular Cloning: A Laboratory Manual (1982); DNA Cloning: A Practical Approach, vol. I & II (Glover, ed.); Oligonucleotide Synthesis (Gait, ed., 1984); Ausubel et al. (eds.), Current Protocols in Molecular Biology (John Wiley & Sons, 1994); Nucleic Acid Hybridization (Hames & Higgins, eds., 1985); Transcription and Translation (Hames & Higgins, eds., 1984); Animal Cell Culture (Freshney, ed., 1986); and Perbal, A Practical Guide to Molecular Cloning (1984). All publications, patents and patent applications cited herein, whether supra or infra, are hereby incorporated by reference in their entirety.
[0465] All references cited herein, whether supra or infra, including, but not limited to, patents, patent applications, and patent publications, whether U.S., PCT, or non-U.S. foreign, and all technical, medical, and/or scientific publications are hereby incorporated by reference in their entirety.