AAV VECTORS FOR GENE EDITING
20250361525 · 2025-11-27
Inventors
- Fred DEITER (Alameda, CA, US)
- Wenyuan ZHOU (Dublin, CA, US)
- Katherine Baney (Berkeley, CA, US)
- Isabel Colin (Oakland, CA, US)
- Cécile FORTUNY (Oakland, CA, US)
- Addison WRIGHT (El Cerrito, CA, US)
- Brett T. Staahl (Tiburon, CA, US)
- Sean Higgins (Alameda, CA, US)
- Benjamin Oakes (El Cerrito, CA, US)
- Suraj MAKHIJA (San Francisco, CA, US)
- Sarah Denny (San Francisco, CA, US)
- Manuel MOHR (Berkeley, CA, US)
- Torrey BROWNELL (Oakland, CA, US)
- Angus SIDORE (Oakland, CA, US)
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N9/226
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N2750/14152
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
A61K48/005
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
International classification
C12N15/86
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N15/90
CHEMISTRY; METALLURGY
Abstract
Provided herein are recombinant adeno-associated virus (rAAV) compositions and methods for use of the rAAV encoding CasX proteins and guide ribonucleic acid (gRNA) sequences useful for nucleic acid sequence editing, and including transgene components. The rAAV may be delivered to cells to target a gene of interest.
Claims
1. A recombinant adeno-associated virus (rAAV) transgene wherein a. the transgene comprises: i) a polynucleotide sequence encoding a CasX protein comprising a sequence selected from the group consisting of SEQ ID NOS: 137-512, 9382-9542, and 9607-9609, or a sequence having at least about 70% sequence identity thereto; and ii) a polynucleotide sequence encoding a first guide RNA (gRNA) comprising a targeting sequence of 15 to 20 nucleotides complementary to a target nucleic acid of a cell; b. the transgene has less than about 4700 nucleotides; and c. the rAAV transgene is configured for incorporation into a rAAV capsid.
2. The rAAV transgene of claim 1, wherein the CasX protein comprises a sequence selected from the group consisting of SEQ ID NOS: 137-512, 9382-9542 and 9607-9609.
3. The rAAV of claim 1 or claim 2, wherein the wherein the CasX protein is a CasX variant selected from the group consisting of SEQ ID NOS: 9385, 9391, 9393, 9401, 9409, 9417, 9419, 9423, 9429, 9443, 9444, 9447, 9449, 9450, 9452, 9453, 9455, 9456, 9458, 9462, 9466, 9469, 9470, 9472, 9478, 9483, 9485, 9491, 9495, 9499, 9501, 9512, 9513, 9517, 9519, 9521, 9536, 9542, 9607, and 9609, wherein the encoded CasX variant exhibits improved editing of a target nucleic acid in an in vitro assay, compared to a CasX variant of SEQ ID NO: 197 and assayed under comparable conditions.
4. The rAAV of claim 1 or claim 2, wherein the wherein the CasX protein is a CasX variant selected from the group consisting of SEQ ID NOS: 9385, 9386, 9388, 9390, 9409, 9412, 9417, 9432, 9433, 9434, 9436, 9437, 9438, 9440, 9441, 9443, 9444, 9446, 9447, 9448, 9450, 9452, 9455, 9459, 9464, 9466, 9468, 9469, 9470, 9472, 9474, 9478, 9479, 9480, 9481, 9486, 9487, 9488, 9492, 9493, 9496, 9509, 9512, 9516, 9517, 9519, 9521, 9522, 9529, 9536, 9542, 9608, and 9609, wherein the encoded CasX variant exhibits improved editing specificity of a target nucleic acid in an in vitro assay, compared to a CasX variant of SEQ ID NO: 197 and assayed under comparable conditions.
5. The rAAV of claim 1 or claim 2, wherein the wherein the CasX protein is a CasX variant selected from the group consisting of SEQ ID NOS: 9385, 9386, 9388, 9390, 9393, 9409, 9412, 9417, 9432, 9433, 9434, 9436, 9437, 9438, 9440, 9441, 9443, 9444, 9446, 9447, 9448, 9450, 9452, 9455, 9459, 9464, 9466, 9468, 9469, 9470, 9472, 9474, 9478, 9479, 9480, 9481, 9483, 9486, 9488, 9491, 9492, 9493, 9495, 9496, 9509, 9512, 9513, 9516, 9517, 9519, 9521, 9522, 9529, 9536, 9542, 9608, and 9609, wherein the encoded CasX variant exhibits improved editing specificity ratio of a target nucleic acid in an in vitro assay, compared to a CasX variant of SEQ ID NO: 197 and assayed under comparable conditions.
6. The rAAV of claim 1 or claim 2, wherein the wherein the CasX protein is a CasX variant selected from the group consisting of SEQ ID NOS: 9385, 9409, 9417, 9443, 9444, 9447, 9450, 9452, 9455, 9466, 9469, 9470, 9472, 9478, 9512, 9513, 9517, 9519, 9521, 9536, 9542, and 9609, wherein the encoded CasX variant exhibits improved editing and improved specificity of a target nucleic acid in an in vitro assay, compared to a CasX variant of SEQ ID NO: 197 and assayed under comparable conditions.
7. The rAAV of claim 1 or claim 2, wherein the wherein the CasX protein is a CasX variant selected from the group consisting of SEQ ID NOS: 9385, 9393, 9409, 9417, 9443, 9444, 9447, 9450, 9452, 9455, 9466, 9469, 9470, 9472, 9478, 9483, 9491, 9495, 9512, 9513, 9517, 9519, 9521, 9536, 9542, and 9609, wherein the encoded CasX variant exhibits improved editing and improved specificity ratio of a target nucleic acid in an in vitro assay, compared to a CasX variant of SEQ ID NO: 197 and assayed under comparable conditions.
8. The rAAV transgene of claim 2, wherein the CasX protein comprises a sequence selected from the group consisting of SEQ ID NOS: 190 and 197.
9. The rAAV transgene of any one of claims 1-7, wherein the transgene further comprises one or more components selected from the group consisting of: a. a first and a second rAAV inverted terminal repeat (ITR) sequence; b. a first promoter sequence operably linked to the Type V CRISPR protein; c. a sequence encoding a nuclear localization signal (NLS); d. a 3 UTR; e. a poly(A) signal sequence; f. a second promoter operably linked to the first gRNA; and g. an accessory element.
10. The rAAV transgene of claim 9, wherein the first promoter is a pol II promoter selected from the group consisting of polyubiquitin C (UBC) promoter, cytomegalovirus (CMV) promoter, simian virus 40 (SV40) promoter, chicken beta-Actin promoter and rabbit beta-Globin splice acceptor site fusion (CAG), chicken -actin promoter with cytomegalovirus enhancer (CB7), PGK promoter, Jens Tornoe (JeT) promoter, GUSB promoter, CBA hybrid (CBh) promoter, elongation factor-1 alpha (EF-1alpha) promoter, beta-actin promoter, Rous sarcoma virus (RSV) promoter, silencing-prone spleen focus forming virus (SFFV) promoter, CMVd1 promoter, truncated human CMV (tCMVd2) promoter, minimal CMV promoter, hepB promoter, chicken j-actin promoter, HSV TK promoter, Mini-TK promoter, minimal IL-2 promoter, GRP94 promoter, Super Core Promoter 1, Super Core Promoter 2, Super Core Promoter 3, adenovirus major late (AdML) promoter, MLC promoter, MCK promoter, GRK1 protein promoter, Rho promoter, CAR protein promoter, hSyn Promoter, Ula promoter, Ribosomal Protein Large subunit 30 (Rpl30) promoter, Ribosomal Protein Small subunit 18 (Rps18) promoter, CMV53 promoter, minimal SV40 promoter, CMV53 promoter, SFCp promoter, Mecp2 promoter, pJB42CAT5 promoter, MLP promoter, EFS promoter, rhodopsin promoter, MeP426 promoter, MecP2 promoter, Desmin promoter, MHCK promoter, MHCK7 promoter, beta-glucuronidase (GUSB) promoter, CK7 promoter, and CK8e promoter.
11. The rAAV transgene of claim 9 or claim 10, wherein the first promoter is a pol II promoter selected from the group consisting of U1A, UbC, and JeT.
12. The rAAV transgene of any one of claims 9-11, wherein the first promoter comprises a sequence selected from the group consisting of SEQ ID NOS: 3532-3562, 3714-3739, 3773-3778, and 9344-9350, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
13. The polynucleotide of any one of claims 9-12, wherein the first promoter sequence has less than about 400 nucleotides, less than about 350 nucleotides, less than about 300 nucleotides, less than about 200 nucleotides, less than about 150 nucleotides, less than about 100 nucleotides, less than about 80 nucleotides, or less than about 40 nucleotides.
14. The rAAV transgene of any one of claims 9-13, wherein the second promoter is a pol III promoter selected from the group consisting of human U6 promoter, human U6 variant promoter, human U6 isoform variant promoter, mini U61 promoter, mini U62 promoter, mini U63 promoter, BiH1 (Bidrectional H1 promoter), BiU6 (Bidirectional U6 promoter), gorilla U6 promoter, rhesus U6 promoter, human 7sk promoter, and human HI promoter.
15. The rAAV transgene of claim 14, wherein the second promoter is a pol III promoter selected from the group consisting of human U6, human U6 variant, or human U6 isoform variant.
16. The rAAV transgene of claim 15, wherein the second promoter comprises a sequence selected from the group consisting of SEQ ID NOS: 3563, 3566-3582, 3599-3602, 3740-3746, 4025, 4029, 4032, and 4743 or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
17. The rAAV transgene of any one of claims 14-16, wherein the second promoter sequence has less than about 250 nucleotides, less than about 220 nucleotides, less than about 200 nucleotides, less than about 160 nucleotides, less than about 140 nucleotides, less than about 130 nucleotides, less than about 120 nucleotides, less than about 100 nucleotides, less than about 80 nucleotides, or less than about 70 nucleotides.
18. The rAAV transgene of any one of claims 9-17, wherein the poly(A) signal sequence is selected from the group consisting of SEQ ID NOS: 2401-3401, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
19. The rAAV transgene of any one of claims 9-18, wherein the encoded NLS comprises a sequence selected from the group consisting of SEQ ID NOS: 3411-3486, 3939-3971, and 4065-4111.
20. The rAAV transgene of any one of claims 1-19, wherein the transgene comprises a polynucleotide sequence encoding a second gRNA with a linked targeting sequence of 15 to 20 nucleotides complementary to a different or overlapping region of a target nucleic acid of a cell, as compared to the targeting sequence of the first gRNA.
21. The rAAV transgene of any one of claims 1-20, wherein the first and/or the second gRNA each comprise: a. a scaffold sequence selected from the group consisting of SEQ ID NOS: 2238-2400, 9257-9289 and 9588, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto; or b. a scaffold sequence selected from the group consisting of SEQ ID NOS: 2238-2400, 9257-9289 and 9588, further comprising at least 1, 2, 3, 4, or 5 mismatches thereto.
22. The rAAV transgene of claim 20 or claim 21, wherein the first and the second gRNA each comprise a scaffold sequence of SEQ ID NO: 2293 or SEQ ID NO: 9588.
23. The rAAV transgene of any one of claims 20-22, comprising a third promoter operably linked to the second gRNA.
24. The rAAV transgene of claim 23, wherein the third promoter is a pol III promoter selected from the group consisting of human U6, human U6 variant, human U6 isoform variant, mini U61, mini U62, mini U63, BiH1 (Bidirectional H1 promoter), BiU6 (Bidirectional U6 promoter), gorilla U6, rhesus U6, human 7sk, and human H1 promoters.
25. The rAAV transgene of claim 23, wherein the third promoter is a pol III promoter selected from the group consisting of human U6, human U6 variant, and human U6 isoform variant.
26. The rAAV transgene of claim any one of claims 23-25, wherein the third promoter comprises a sequence selected from the group consisting of SEQ ID NOS: 3563, 3566-3582, 3599-3602, 3740-3746, 4025, 4029, 4032, and 4743, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
27. The rAAV transgene of any one of claims 23-26, wherein the third promoter sequence has less than about 250 nucleotides, less than about 220 nucleotides, less than about 200 nucleotides, less than about 160 nucleotides, less than about 140 nucleotides, less than about 130 nucleotides, less than about 120 nucleotides, less than about 100 nucleotides, less than about 80 nucleotides, or less than about 70 nucleotides.
28. The rAAV transgene of any one of claims 20-27, wherein: a. the polynucleotide sequence encoding the first gRNA and the polynucleotide sequence encoding the second gRNA are 5 of the polynucleotide sequence encoding the CasX protein; b. the polynucleotide sequence encoding the first gRNA is 5 of the polynucleotide sequence encoding the CasX protein and the polynucleotide sequence encoding the second gRNA is 3 of the polynucleotide sequence encoding the CasX protein; c. the polynucleotide sequence encoding the first gRNA is 3 of the polynucleotide sequence encoding the CasX protein and the polynucleotide sequence encoding the second gRNA is 5 of the polynucleotide sequence encoding the CasX protein; or d. the polynucleotide sequence encoding the first gRNA and the polynucleotide sequence encoding the second gRNA are 3 of the polynucleotide sequence encoding the CasX protein.
29. The rAAV transgene of any one of claims 20-28, wherein: a. the polynucleotide sequence encoding the first gRNA and the polynucleotide sequence encoding the second gRNA are encoded in a forward orientation relative to the polynucleotide sequence encoding the CasX protein; b. the polynucleotide sequence encoding the first gRNA is encoded in a forward orientation relative to the polynucleotide sequence encoding the CasX protein and the polynucleotide sequence encoding the second gRNA is encoded in a reverse orientation relative to the polynucleotide sequence encoding the CasX protein; c. the polynucleotide sequence encoding the first gRNA is encoded in a reverse orientation relative to the polynucleotide sequence encoding the CasX protein and the polynucleotide sequence encoding the second gRNA is encoded in a forward orientation relative to the polynucleotide sequence encoding the CasX protein; or d. the polynucleotide sequence encoding the first gRNA and the polynucleotide sequence encoding the second gRNA are encoded in a reverse orientation relative to the polynucleotide sequence encoding the CasX protein.
30. The rAAV transgene of any one of claims 20-29, wherein the transgene has less than about 4800, less than about 4750, less than about 4700, less than about 4650 nucleotides, or less than about 4600 nucleotides.
31. The rAAV transgene of any one of claims 20-30, wherein the rAAV transgene is configured for incorporation into an rAAV capsid.
32. The rAAV transgene of any one of claims 1-31, wherein one or more components of the transgene are optimized to reduce or deplete CpG motifs.
33. The rAAV transgene of claim 32, wherein the one or more components comprise less than about 10%, less than about 5%, or less than about 1% CpG dinucleotides.
34. The rAAV transgene of claim 32 or claim 33, wherein the CpG-depleted polynucleotide sequence encoding the CasX protein is selected from the group consisting of SEQ ID NOS: 9327-9333 and 9369-9380.
35. The rAAV transgene of claim 32 or claim 33, wherein the CpG-depleted polynucleotide sequence encodes a gRNA scaffold, and is selected from the group consisting of SEQ ID NOS: 3751-3772.
36. The rAAV transgene of claim 32 or claim 33, wherein the CpG-depleted polynucleotide sequence of the ITR is selected from the group consisting of SEQ ID NOS: 3749 and 3750.
37. The rAAV transgene of claim 32 or claim 33, wherein the CpG-depleted polynucleotide sequence of the promoter is selected from the group consisting of SEQ ID NOS: 3735-3746.
38. The rAAV transgene of claim 32 or claim 33, wherein the CpG-depleted polynucleotide sequence of the poly(A) signal is SEQ ID NO: 3748.
39. The rAAV transgene of any one of claims 1-38, wherein the transgene has the configuration of a construct depicted in any one of
40. A recombinant adeno-associated virus (rAAV) comprising: a. an AAV capsid protein, and b. the transgene of any one of claims 1-39.
41. The rAAV of claim 40, wherein the AAV capsid protein is derived from serotype AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV 11, AAV12, AAV 9.45, AAV 9.61, AAV 44.9, AAV-Rh74, AAVRh10, MyoAAV 1Al, MyoAAV 1A2, or MyoAAV 2A.
42. The rAAV of claim 41, wherein the AAV capsid protein and the 5 and 3 ITR are derived from the same serotype of AAV.
43. The rAAV of claim 41, wherein the AAV capsid protein and the 5 and 3 ITR are derived from different serotypes of AAV.
44. The rAAV of claim 43, wherein the 5 and 3 ITR are derived from AAV serotype 2.
45. The rAAV of any one of claims 40-44, wherein upon transduction of a cell with the rAAV, the CasX protein and the first and/or the second gRNA encoded in the rAAV transgene are expressed.
46. The rAAV of claim 45, wherein upon expression, the first and/or the second gRNA is capable of forming a ribonucleoprotein (RNP) complex with the CasX protein.
47. The rAAV of claim 46, wherein the RNP is capable of binding and modifying a target nucleic acid of the cell.
48. The rAAV of any one of claims 40-47, wherein inclusion of a poly(A) signal in the transgene enhances expression of the CasX protein and editing efficiency of a target nucleic acid in a cell transduced by the rAAV.
49. The rAAV of any one of claims 40-48, wherein inclusion of a posttranscriptional regulatory element (PTRE) accessory element in the transgene enhances editing efficiency of a target nucleic acid in a cell transduced by the rAAV.
50. The rAAV of claim 49, wherein the PTRE comprises a sequence selected from the group consisting of SEQ ID NOS: 3615-3617, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
51. The rAAV of any one of claims 40-50, wherein components of the transgene modified for depletion of all or a portion of the CpG dinucleotides exhibit a lower potential for inducing an immune response in a cell transduced with the rAAV, compared to a rAAV wherein the components are not modified for depletion of the CpG dinucleotides.
52. The rAAV of claim 51, wherein the lower potential for inducing an immune response is exhibited in an in vitro mammalian cell assay designed to detect production of one or more markers of an inflammatory response selected from the group consisting of TLR9, interleukin-1 (IL-1), IL-6, IL-12, IL-18, tumor necrosis factor alpha (TNF-), interferon gamma (IFN), and granulocyte-macrophage colony stimulating factor (GM-CSF).
53. The rAAV of claim 51 or claim 52, wherein the rAAV comprising the component sequences modified for depletion of all or a portion of the CpG dinucleotides elicits reduced production of the one or more inflammatory markers of at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 80%, or at least about 90% less compared to the comparable rAAV that is not CpG depleted.
54. The rAAV of any one of claims 51-53, wherein the expressed CasX and the first and/or the second gRNA retain at least about 60%, at least about 70%, at least about 80%, or at least about 90% of the editing potential for a target nucleic acid compared to an rAAV wherein the transgene has not been optimized for depletion of CpG dinucleotides, when assayed in an in vitro assay under comparable conditions.
55. The rAAV of claim 40, wherein incorporation of a Pol II promoter selected from the group consisting of CK8e, MHCK7, and MHCK in the transgene of a rAAV used to transduce a muscle cell results in higher expression of the CasX protein in the muscle cell compared to incorporation of a UbC promoter.
56. The rAAV of claim 40, wherein incorporation of a muscle enhancer sequence selected from the group consisting of SEQ ID NOS: 3779-3809 in the transgene of a rAAV used to transduce a muscle cell results in higher expression of the CasX protein in the muscle cell compared to a rAAV not incorporating the muscle enhancer.
57. A method for modifying a target nucleic acid of a gene in a population of mammalian cells, comprising contacting a plurality of the cells with an effective amount of the rAAV of any one of claims 40-5656, wherein the target nucleic acid of the gene targeted by the first and/or the second gRNA is modified by the expressed CasX protein.
58. The method of claim 57, wherein the gene comprises one or more mutations.
59. The method of claim 57 or claim 58, wherein the modifying comprises introducing an insertion, deletion, substitution, duplication, or inversion of one or more nucleotides in the target nucleic acid of the cells of the population.
60. The method of any one of claims 57-59, wherein the gene is knocked down or knocked out.
61. The method of any one of claims 57-59, wherein the gene is modified such that a functional gene product can be expressed.
62. The method of any one of claims 57-61, wherein the rAAV comprises the first and the second gRNA, wherein the second gRNA comprises a targeting sequence complementary to a different target site in a gene targeted by the targeting sequence of the first gRNA, wherein the nucleotides between the target sites are excised by cleavage of the target sites by the CasX protein.
63. The method of any one of claims 57-61, wherein the rAAV comprises the first and the second gRNA, wherein the second gRNA comprises a targeting sequence complementary to a target site in a different gene targeted by the targeting sequence of the first gRNA, wherein the target nucleic acid at each target site is modified by the CasX protein.
64. A method of treating a disease in a subject caused by one or more mutations in a gene of the subject, comprising administering a therapeutically effective dose of the rAAV of any one of claims 40-56 to the subject.
65. The method of claim 62, wherein the rAAV is administered to the subject by a route of administration selected from subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatical, intraocular and intraperitoneal routes, and wherein the administration method is injection, transfusion, or implantation.
66. The method of claim 64 or claim 65, wherein the subject is selected from the group consisting of mouse, rat, pig, and non-human primate.
67. The method of claim 64 or claim 65, wherein the subject is a human.
68. A method of making a rAAV, comprising: a. providing a population of packaging cells; and b. transfecting the population of cells with: i) a vector comprising the transgene of any one of claims 1-38; ii) a vector comprising an Assembly-Activating Protein (AAP) gene; and iii) a vector comprising rep and cap genomes.
69. The method of claim 68, wherein the packaging cell is selected from the group consisting of BHK cells, HEK293 cells, HEK293T cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells, hybridoma cells, NIH3T3 cells, COS cells, HeLa cells, and CHO cells.
70. The method of claim 68 or claim 69, the method further comprising recovering the rAAV.
71. The method of any one of claims 68-70, wherein the component sequences of the transgene are encompassed in a single recombinant adeno-associated virus particle.
72. A composition of a recombinant adeno-associated virus of any one of claims 40-56, for use in the manufacture of a medicament for the treatment of a disease in a human in need thereof.
73. A kit comprising the rAAV of any one of claim 40-56 and a suitable container.
74. The kit of claim 73, comprising a pharmaceutically acceptable carrier, diluent, buffer, or excipient.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0008] The novel features of the disclosure are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present disclosure will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the disclosure are utilized, and the accompanying drawings of which:
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
DETAILED DESCRIPTION
[0143] While exemplary embodiments have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the inventions claimed herein. It should be understood that various alternatives to the embodiments described herein may be employed in practicing the embodiments of the disclosure. It is intended that the claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.
[0144] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present embodiments, suitable methods and materials are described below. In case of conflict, the patent specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention.
Definitions
[0145] Hybridizable or complementary are used interchangeably to mean that a nucleic acid (e.g., RNA, DNA) comprises a sequence of nucleotides that enables it to non-covalently bind, i.e., form Watson-Crick base pairs and/or G/U base pairs, anneal, or hybridize, to another nucleic acid in a sequence-specific, antiparallel, manner (i.e., a nucleic acid specifically binds to a complementary nucleic acid) under the appropriate in vitro and/or in vivo conditions of temperature and solution ionic strength. It is understood that the sequence of a polynucleotide need not be 100% complementary to that of its target nucleic acid to be specifically hybridizable; it can have at least about 70%, at least about 80%, or at least about 90%, or at least about 95% sequence identity and still hybridize to the target nucleic acid. Moreover, a polynucleotide may hybridize over one or more segments such that intervening or adjacent segments are not involved in the hybridization event (e.g., a loop structure or hairpin structure, a bulge, bubble and the like). Thus, the skilled artisan will understand that while individual bases within a sequence may not be complementary to another sequence, the sequence as a whole is still considered to be complementary.
[0146] A gene, for the purposes of the present disclosure, includes a DNA region encoding a gene product (e.g., a protein, RNA), as well as all DNA regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. Accordingly, a gene may include accessory element sequences including, but not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions. Coding sequences encode a gene product upon transcription or transcription and translation; the coding sequences of the disclosure may comprise fragments and need not contain a full-length open reading frame. A gene can include both the strand that is transcribed as well as the complementary strand containing the anticodons.
[0147] The term downstream refers to a nucleotide sequence that is located 3 to a reference nucleotide sequence. In certain embodiments, downstream nucleotide sequences relate to sequences that follow the starting point of transcription. For example, the translation initiation codon of a gene is located downstream of the start site of transcription.
[0148] The term upstream refers to a nucleotide sequence that is located 5 to a reference nucleotide sequence. In certain embodiments, upstream nucleotide sequences relate to sequences that are located on the 5 side of a coding region or starting point of transcription. For example, most promoters are located upstream of the start site of transcription.
[0149] The term adjacent to with respect to polynucleotide or amino acid sequences refers to sequences that are next to, or adjoining each other in a polynucleotide or polypeptide. The skilled artisan will appreciate that two sequences can be considered to be adjacent to each other and still encompass a limited amount of intervening sequence, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 nucleotides or amino acids.
[0150] The term regulatory element is used interchangeably herein with the term regulatory sequence, and is intended to include promoters, enhancers, and other expression regulatory elements. It will be understood that the choice of the appropriate regulatory element will depend on the encoded component to be expressed (e.g., protein or RNA) or whether the nucleic acid comprises multiple components that require different polymerases or are not intended to be expressed as a fusion protein.
[0151] The term accessory element is used interchangeably herein with the term accessory sequence, and is intended to include, inter alia, polyadenylation signals (poly(A) signal), enhancer elements, introns, posttranscriptional regulatory elements (PTREs), nuclear localization signals (NLS), deaminases, DNA glycosylase inhibitors, factors that stimulate CRISPR-mediated homology-directed repair (e.g. in cis or in trans), activators or repressors of transcription, self-cleaving sequences, and fusion domains, for example a fusion domain fused to a CRISPR protein. It will be understood that the choice of the appropriate accessory element or elements will depend on the encoded component to be expressed (e.g., protein or RNA) or whether the nucleic acid comprises multiple components that require different polymerases or are not intended to be expressed as a fusion protein.
[0152] The term promoter refers to a DNA sequence that contains a transcription start site and additional sequences to facilitate polymerase binding and transcription. Exemplary eukaryotic promoters include elements such as a TATA box, and/or B recognition element (BRE) and assists or promotes the transcription and expression of an associated transcribable polynucleotide sequence and/or gene (or transgene). A promoter can be synthetically produced or can be derived from a known or naturally occurring promoter sequence or another promoter sequence. A promoter can also include a chimeric promoter comprising a combination of two or more heterologous sequences to confer certain properties. A promoter of the present disclosure can include variants of promoter sequences that are similar in composition, but not identical to, other promoter sequence(s) known or provided herein. A promoter can be classified according to criteria relating to the pattern of expression of an associated coding or transcribable sequence or gene operably linked to the promoter, such as constitutive, developmental, tissue-specific, inducible, etc. A promoter can also be classified according to its strength. As used in the context of a promoter, strength refers to the rate of transcription of the gene controlled by the promoter. A strong promoter means the rate of transcription is high, while a weak promoter means the rate of transcription is relatively low.
[0153] A promoter of the disclosure can be a Polymerase II (Pol II) promoter. Polymerase II transcribes all protein coding and many non-coding genes. A representative Pol II promoter includes a core promoter, which is a sequence of about 100 base pairs surrounding the transcription start site, and serves as a binding platform for the Pol II polymerase and associated general transcription factors. The promoter may contain one or more core promoter elements such as the TATA box, BRE, Initiator (INR), motif ten element (MTE), downstream core promoter element (DPE), downstream core element (DCE), although core promoters lacking these elements are known in the art. All Pol II promoters are envisaged as within the scope of the instant disclosure.
[0154] A promoter of the disclosure can be a Polymerase III (Pol III) promoter. Pol III transcribes DNA to synthesize small ribosomal RNAs such as the 5S rRNA, tRNAs, and other small RNAs. Representative Pol III promoters use internal control sequences (sequences within the transcribed section of the gene) to support transcription, although upstream elements such as the TATA box are also sometimes used. All Pol III promoters are envisaged as within the scope of the instant disclosure.
[0155] The term enhancer refers to regulatory DNA sequences that, when bound by specific proteins called transcription factors, regulate the expression of an associated gene. Enhancers may be located in the intron of the gene, or 5 or 3 of the coding sequence of the gene. Enhancers may be proximal to the gene (i.e., within a few tens or hundreds of base pairs (bp) of the promoter), or may be located distal to the gene (i.e., thousands of bp, hundreds of thousands of bp, or even millions of bp away from the promoter). A single gene may be regulated by more than one enhancer, all of which are envisaged as within the scope of the instant disclosure. Non-limiting examples of enhancers include CMV enhancer, muscle enhancer, cardiac muscle enhancer, skeletal muscle enhancer, myoblast muscle enhancer, and PTRE.
[0156] As used herein, a post-transcriptional regulatory element (PTRE, or TRE), such as a hepatitis PTRE, refers to a DNA sequence that, when transcribed creates a tertiary structure capable of exhibiting post-transcriptional activity to enhance or promote expression of an associated gene operably linked thereto.
[0157] Recombinant, as used herein, means that a particular nucleic acid (DNA or RNA) is the product of various combinations of cloning, restriction, and/or ligation steps resulting in a construct having a structural coding or non-coding sequence distinguishable from endogenous nucleic acids found in natural systems. Generally, DNA sequences encoding the structural coding sequence can be assembled from cDNA fragments and short oligonucleotide linkers, or from a series of synthetic oligonucleotides, to provide a synthetic nucleic acid which is capable of being expressed from a recombinant transcriptional unit contained in a cell or in a cell-free transcription and translation system. Such sequences can be provided in the form of an open reading frame uninterrupted by internal non-translated sequences, or introns, which are typically present in eukaryotic genes. Genomic DNA comprising the relevant sequences can also be used in the formation of a recombinant gene or transcriptional unit. Sequences of non-translated DNA may be present 5 or 3 from the open reading frame, where such sequences do not interfere with manipulation or expression of the coding regions, and may indeed act to modulate production of a desired product by various mechanisms (see enhancers and promoters, above).
[0158] The term recombinant polynucleotide or recombinant nucleic acid refers to one which is not naturally occurring, e.g., is made by the artificial combination of two otherwise separated segments of sequence through human intervention. This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques. Such is usually done to replace a codon with a redundant codon encoding the same or a conservative amino acid, while typically introducing or removing a sequence recognition site. Alternatively, it is performed to join together nucleic acid segments of desired functions to generate a desired combination of functions. This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques.
[0159] Similarly, the term recombinant polypeptide or recombinant protein refers to a polypeptide or protein which is not naturally occurring, e.g., is made by the artificial combination of two otherwise separated segments of amino sequence through human intervention. Thus, e.g., a protein that comprises a heterologous amino acid sequence is recombinant.
[0160] As used herein, the term contacting means establishing a physical connection between two or more entities. For example, contacting a target nucleic acid with a guide nucleic acid means that the target nucleic acid and the guide nucleic acid are made to share a physical connection; e.g., can hybridize if the sequences share sequence similarity.
[0161] Dissociation constant, or Ka, are used interchangeably and mean the affinity between a ligand L and a protein P; i.e., how tightly a ligand binds to a particular protein. It can be calculated using the formula K.sub.d=[L][P]/[LP], where [P], [L] and [LP] represent molar concentrations of the protein, ligand and complex, respectively.
[0162] The disclosure provides systems and methods useful for editing a target nucleic acid sequence. As used herein editing is used interchangeably with modifying and modification and includes but is not limited to cleaving, nicking, deleting, knocking in, knocking out, and the like. Modifying can also encompass epigenetic modifications to a nucleic acid, or chromatin containing the nucleic acid, such as, but not limited to, changes in DNA methylation, and histone methylation and acetylation.
[0163] By cleavage it is meant the breakage of the covalent backbone of a target nucleic acid molecule (e.g., RNA, DNA). Cleavage can be initiated by a variety of methods including, but not limited to, enzymatic or chemical hydrolysis of a phosphodiester bond. Both single-stranded cleavage and double-stranded cleavage are possible, and double-stranded cleavage can occur as a result of two distinct single-stranded cleavage events.
[0164] The term knock-out refers to the elimination of a gene or the expression of a gene. For example, a gene can be knocked out by either a deletion or an addition of a nucleotide sequence that leads to a disruption of the reading frame. As another example, a gene may be knocked out by replacing a part of the gene with an irrelevant sequence. The term knock-down as used herein refers to reduction in the expression of a gene or its gene product(s). As a result of a gene knock-down, the protein activity or function may be attenuated or the protein levels may be reduced or eliminated.
[0165] As used herein, homology-directed repair (HDR) refers to the form of DNA repair that takes place during repair of double-strand breaks in cells. This process requires nucleotide sequence homology, and uses a donor template to repair or knock-out a target DNA, and leads to the transfer of genetic information from the donor to the target. Homology-directed repair can result in an alteration of the sequence of the target sequence by insertion, deletion, or mutation if the donor template differs from the target DNA sequence and part or all of the sequence of the donor template is incorporated into the target DNA.
[0166] As used herein, non-homologous end joining (NHEJ) refers to the repair of double-strand breaks in DNA by direct ligation of the break ends to one another without the need for a homologous template (in contrast to homology-directed repair, which requires a homologous sequence to guide repair). NHEJ often results in the loss (deletion) of nucleotide sequence near the site of the double-strand break.
[0167] As used herein micro-homology mediated end joining (MMEJ) refers to a mutagenic DSB repair mechanism, which always associates with deletions flanking the break sites without the need for a homologous template (in contrast to homology-directed repair, which requires a homologous sequence to guide repair). MMEJ often results in the loss (deletion) of nucleotide sequence near the site of the double-strand break.
[0168] A polynucleotide or polypeptide has a certain percent sequence similarity or sequence identity to another polynucleotide or polypeptide, meaning that, when aligned, that percentage of bases or amino acids are the same, and in the same relative position, when comparing the two sequences. Sequence similarity (sometimes referred to as percent similarity, percent identity, or homology) can be determined in a number of different manners. To determine sequence similarity, sequences can be aligned using the methods and computer programs that are known in the art, including BLAST, available over the world wide web at ncbi.nlm.nih.gov/BLAST. Percent complementarity between particular stretches of nucleic acid sequences within nucleic acids can be determined using any convenient method. Example methods include BLAST programs (basic local alignment search tools) and PowerBLAST programs (Altschul et al., J. Mol. Biol., 1990, 215, 403-410; Zhang and Madden, Genome Res., 1997, 7, 649-656) or by using the Gap program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, Madison Wis.), e.g., using default settings, which uses the algorithm of Smith and Waterman (Adv. Appl. Math., 1981, 2, 482-489).
[0169] The terms polypeptide, and protein are used interchangeably herein, and refer to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones. The term includes fusion proteins, including, but not limited to, fusion proteins with a heterologous amino acid sequence.
[0170] A vector or expression vector comprises a replicon, such as plasmid, phage, virus, or cosmid, to which another DNA segment, (e.g., an expression cassette), may be attached so as to bring about the replication or expression of the attached segment in a cell.
[0171] The term naturally-occurring or unmodified or wild type as used herein as applied to a nucleic acid, a polypeptide, a cell, or an organism, refers to a nucleic acid, polypeptide, cell, or organism that is found in nature.
[0172] As used herein, a mutation refers to an insertion, deletion, substitution, duplication, or inversion of one or more amino acids or nucleotides as compared to a wild-type or reference amino acid sequence or to a wild-type or reference nucleotide sequence.
[0173] As used herein the term isolated is meant to describe a polynucleotide, a polypeptide, or a cell that is in an environment different from that in which the polynucleotide, the polypeptide, or the cell naturally occurs. An isolated genetically modified host cell may be present in a mixed population of genetically modified host cells.
[0174] A host cell, as used herein, denotes a eukaryotic cell, a prokaryotic cell, or a cell from a multicellular organism (e.g., a cell line) cultured as a unicellular entity, which eukaryotic or prokaryotic cells are used as recipients for a nucleic acid (e.g., an AAV vector), and include the progeny of the original cell which has been genetically modified by the nucleic acid. It is understood that the progeny of a single cell may not necessarily be completely identical in morphology or in genomic or total DNA complement as the original parent, due to natural, accidental, or deliberate mutation. A recombinant host cell (also referred to as a genetically modified host cell) is a host cell into which has been introduced a heterologous nucleic acid, e.g., an AAV vector.
[0175] The disclosure provides systems and methods useful for editing a target nucleic acid sequence. As used herein editing is used interchangeably with modifying and modification and includes but is not limited to cleaving, nicking, deleting, knocking in, knocking out, and the like.
[0176] By cleavage it is meant the breakage of the covalent backbone of a target nucleic acid molecule (e.g., RNA, DNA). Cleavage can be initiated by a variety of methods including, but not limited to, enzymatic or chemical hydrolysis of a phosphodiester bond. Both single-stranded cleavage and double-stranded cleavage are possible, and double-stranded cleavage can occur as a result of two distinct single-stranded cleavage events.
[0177] As used herein, a mutation refers to an insertion, deletion, substitution, duplication, or inversion of one or more amino acids or nucleotides as compared to a wild-type or reference amino acid sequence or to a wild-type or reference nucleotide sequence.
[0178] As used herein the term isolated is meant to describe a polynucleotide, a polypeptide, or a cell that is in an environment different from that in which the polynucleotide, the polypeptide, or the cell naturally occurs. An isolated genetically modified host cell may be present in a mixed population of genetically modified host cells.
[0179] A host cell, as used herein, denotes a eukaryotic cell, a prokaryotic cell, or a cell from a multicellular organism (e.g., in a cell line), which eukaryotic or prokaryotic cells are used as recipients for a nucleic acid (e.g., an expression vector), and include the progeny of the original cell which has been genetically modified by the nucleic acid. It is understood that the progeny of a single cell may not necessarily be completely identical in morphology or in genomic or total DNA complement as the original parent, due to natural, accidental, or deliberate mutation. A recombinant host cell (also referred to as a genetically modified host cell) is a host cell into which has been introduced a heterologous nucleic acid, e.g., an expression vector.
[0180] A target cell marker refers to a molecule expressed by a target cell including but not limited to cell-surface receptors, cytokine receptors, antigens, tumor-associated antigens, glycoproteins, oligonucleotides, enzymatic substrates, antigenic determinants, or binding sites that may be present in the on the surface of a target tissue or cell that may serve as ligands for an antibody fragment or glycoprotein tropism factor.
[0181] The term conservative amino acid substitution refers to the interchangeability in proteins of amino acid residues having similar side chains. For example, a group of amino acids having aliphatic side chains consists of glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains consists of serine and threonine; a group of amino acids having amide-containing side chains consists of asparagine and glutamine; a group of amino acids having aromatic side chains consists of phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains consists of lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains consists of cysteine and methionine. Exemplary conservative amino acid substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine.
[0182] The term antibody, as used herein, encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), nanobodies, single domain antibodies such as VHH antibodies, and antibody fragments so long as they exhibit the desired antigen-binding activity or immunological activity. Antibodies represent a large family of molecules that include several types of molecules, such as IgD, IgG, IgA, IgM and IgE.
[0183] An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody and that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab, Fab-SH, F(ab)2, diabodies, single chain diabodies, linear antibodies, a single domain antibody, a single domain camelid antibody, single-chain variable fragment (scFv) antibody molecules, and multispecific antibodies formed from antibody fragments.
[0184] As used herein, treatment or treating, are used interchangeably herein and refer to an approach for obtaining beneficial or desired results, including but not limited to a therapeutic benefit and/or a prophylactic benefit. By therapeutic benefit is meant eradication or amelioration of the underlying disorder or disease being treated. A therapeutic benefit can also be achieved with the eradication or amelioration of one or more of the symptoms or an improvement in one or more clinical parameters associated with the underlying disease such that an improvement is observed in the subject, notwithstanding that the subject may still be afflicted with the underlying disorder.
[0185] The terms therapeutically effective amount and therapeutically effective dose, as used herein, refer to an amount of a drug or a biologic, alone or as a part of a composition, that is capable of having any detectable, beneficial effect on any symptom, aspect, measured parameter or characteristics of a disease state or condition when administered in one or repeated doses to a subject such as a human or an experimental animal. Such effect need not be absolute to be beneficial.
[0186] As used herein, administering means a method of giving a dosage of a compound (e.g., a composition of the disclosure) or a composition (e.g., a pharmaceutical composition) to a subject.
[0187] A subject is a mammal. Mammals include, but are not limited to, domesticated animals, non-human primates, humans, dogs, rabbits, mice, rats and other rodents.
[0188] Some of the numerical results herein, for example multiplicity of infection (MOI), are expressed in scientific notation, in which a numerical value is expressed as a number multiplied by 10 raised to a certain exponent. There are various well-known ways to express a number in scientific notation. For example, each of 1E9, 1e9, 1e+9, or 110.sup.9 are variant formats of scientific notation, and is known to have the same meaning of 1 times 10 to the power of 9, or 1,000,000,000.
[0189] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference. The contents of WO 2020/247882, filed on Jun. 5, 2020, WO 2020/247883, filed Jun. 5, 2020, WO 2021/050593, filed on Sep. 9, 2020, WO 2021/050601, filed on Sep. 9, 2021, WO 2021/142342, filed on Jan. 8, 2021, WO 2021/113763, filed on Dec. 4, 2020, WO 2021/113769, filed on Dec. 4, 2020, WO 2021/113772, filed on Dec. 4, 2020, WO 2022/120095, filed Dec. 2, 2021, WO 2022/120094, filed on Dec. 2, 2021, WO 2022/125843, filed on Dec. 9, 2021, WO 2022/261150, filed on Jun. 7, 2022, WO 2023/049742, filed on Sep. 21, 2022, WO 2022/261149, filed on Jun. 7, 2022, PCT/US2023/067791, filed on Jun. 1, 2023, and PCT/US2023/067901, filed on Jun. 3, 2023 which disclose CasX variants and gRNA variants, are hereby incorporated by reference in their entirety.
I. General Methods
[0190] The practice of the present invention employs, unless otherwise indicated, conventional techniques of immunology, biochemistry, chemistry, molecular biology, microbiology, cell biology, genomics and recombinant DNA, which can be found in such standard textbooks as Molecular Cloning: A Laboratory Manual, 3rd Ed. (Sambrook et al., Harbor Laboratory Press 2001); Short Protocols in Molecular Biology, 4th Ed. (Ausubel et al. eds., John Wiley & Sons 1999); Protein Methods (Bollag et al., John Wiley & Sons 1996); Nonviral Vectors for Gene Therapy (Wagner et al. eds., Academic Press 1999); Viral Vectors (Kaplift & Loewy eds., Academic Press 1995); Immunology Methods Manual (I. Lefkovits ed., Academic Press 1997); and Cell and Tissue Culture: Laboratory Procedures in Biotechnology (Doyle & Griffiths, John Wiley & Sons 1998), the disclosures of which are incorporated herein by reference.
[0191] Where a range of values is provided, it is understood that endpoints are included and that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and are also encompassed, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included.
[0192] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.
[0193] It must be noted that as used herein and in the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise.
[0194] It will be appreciated that certain features of the disclosure, which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. In other cases, various features of the disclosure, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable sub-combination. It is intended that all combinations of the embodiments pertaining to the disclosure are specifically embraced by the present disclosure and are disclosed herein just as if each and every combination was individually and explicitly disclosed. In addition, all sub-combinations of the various embodiments and elements thereof are also specifically embraced by the present disclosure and are disclosed herein just as if each and every such sub-combination was individually and explicitly disclosed herein.
II. Recombinant AAV Vectors
[0195] In a first aspect, the present disclosure relates to recombinant AAV vectors (rAAV) optimized for the expression and delivery of CRISPR nucleases to target cells and/or tissues for genetic editing.
[0196] Wild-type AAV is a small, single-stranded DNA virus belonging to the parvovirus family. The wild-type AAV genome is made up of two genes that encode four replication proteins and three capsid proteins, respectively, and is flanked on either side by inverted terminal repeats (ITRs) having 130-145 nucleotides that fold into a hairpin shape important for replication. The virion is composed of three capsid proteins, Vp1, Vp2, and Vp3, produced in a 1:1:10 ratio from the same open reading frame but from differential splicing (Vp1) and alternative translational start sites (Vp2 and Vp3, respectively). The cap gene produces an additional, non-structural protein called the Assembly-Activating Protein (AAP). This protein is produced from ORF2 and is essential for the capsid-assembly process. The capsid forms a supramolecular assembly of approximately 60 individual capsid protein subunits into a non-enveloped, T-1 icosahedral lattice capable of protecting the AAV genome.
[0197] Being naturally replication-defective and capable of transducing nearly every cell type in the human body, AAV represents a suitable vector for therapeutic use in gene therapy or vaccine delivery. Typically, when producing a recombinant AAV vector, the sequence between the two ITRs is replaced with one or more sequences of interest as a part of the transgene, and the Rep and Cap sequences are provided in trans, making the ITRs the only viral DNA that remains in the vector. The resulting recombinant AAV vector genome construct comprises two cis-acting 130 to 145-nucleotide ITRs flanking an expression cassette encoding the transgene sequences of interest, providing at least 4.7 kb or more for packaging of foreign DNA such that the total size of the vector is below 4.8 to 5 kb, which is compatible with packaging within the AAV capsid (it being understood that as the size of the construct exceeds this threshold, the packaging efficiency of the vector decreases). As used herein, transgene includes ITRs and an expression cassette incorporated between the ITRs. In the context of CRISPR-mediated gene editing, however, the size limitation of the expression cassette is a challenge for most CRISPR systems for incorporation into an AAV, given the large size of the nucleases.
[0198] In one aspect, the present disclosure relates to rAAV transgene compositions. In some embodiments, the disclosure provides transgenes wherein the transgene comprises a polynucleotide sequence encoding a Class 2, Type V CRISPR nuclease protein and a polynucleotide sequence encoding a first guide RNA (gRNA) with a linked targeting sequence of 15 to 20 nucleotides complementary to a target nucleic acid of a cell. In some embodiments, the disclosure provides an rAAV transgene comprising a polynucleotide sequence encoding a CasX nuclease protein and a polynucleotide sequence encoding a first guide RNA (gRNA) with a linked targeting sequence of 15 to 20 nucleotides complementary to a target nucleic acid of a cell. In some embodiments, the disclosure provides an rAAV transgene comprising a polynucleotide sequence encoding a CasX nuclease protein, and a polynucleotide sequence encoding a first and a second guide RNA (gRNA), each with a linked targeting sequence of 15 to 20 nucleotides complementary to a target nucleic acid of a cell, wherein the targeting sequence of the second gRNA is complementary to a different or overlapping region of the target nucleic acid. In some embodiments, the transgene has less than about 4800, less than about 4700, less than about 4600, less than about 4500, less than about 4400 nucleotides, less than about 4300 nucleotides, or less than about 4250 nucleotides, and the rAAV transgene is configured for incorporation into an rAAV capsid. In some embodiments, the transgene has about 4250 to about 4800 nucleotides, or any integer in between. The CasX nuclease, gRNA, and other components of the rAAV transgene are described more fully, below.
[0199] In some embodiments, the transgene comprises components selected from a polynucleotide sequence encoding a CasX nuclease protein and a polynucleotide sequence encoding a first guide RNA (gRNA) with a linked targeting sequence of 15 to 20 nucleotides complementary to a target nucleic acid of a cell, a first and a second rAAV inverted terminal repeat (ITR) sequence, a first promoter sequence operably linked to the CasX protein, a sequence encoding a nuclear localization signal (NLS), a 3 UTR, a poly(A) signal sequence, a second promoter operably linked to the first gRNA, and, optionally, an accessory element, wherein the rAAV transgene is configured for incorporation into an rAAV capsid. In some embodiments, the transgene comprises components selected from a polynucleotide sequence encoding a CasX nuclease protein and a polynucleotide sequence encoding a first guide RNA (gRNA) with a linked targeting sequence of 15 to 20 nucleotides complementary to a target nucleic acid of a cell, a first and a second rAAV inverted terminal repeat (ITR) sequence, a first promoter sequence operably linked to the CasX protein, a sequence encoding a nuclear localization signal (NLS), a 3 UTR, a poly(A) signal sequence, a second promoter operably linked to the first gRNA, a second gRNA, a third promoter operably linked to the second gRNA, and, optionally, an accessory element, wherein the rAAV transgene is configured for incorporation into an rAAV capsid.
[0200] The promoter and accessory elements can be operably linked to components within the transgene, e.g., the CRISPR protein and/or gRNA, in a manner which permits its transcription, translation and/or expression in a cell transfected with the rAAV of the embodiments. As used herein, operably linked sequences include both accessory element sequences that are contiguous with the gene of interest and accessory element sequences that are at a distance to control the gene of interest.
[0201] In some embodiments, the disclosure provides accessory elements for inclusion in the rAAV that include, but are not limited to sequences that control transcription initiation, termination, enhancer elements, RNA processing signal sequences, enhancer elements, sequences that stabilize cytoplasmic mRNA, sequences that enhance translation efficiency (i.e., Kozak consensus sequence), an intron, a post-transcriptional regulatory element (PTRE), a deaminase, a DNA glycosylase inhibitor, a stimulator of CRISPR-mediated homology-directed repair, and an activator or repressor of transcription. In some cases, the PTRE is selected from the group consisting of cytomegalovirus immediate/early intronA, hepatitis B virus PRE (HPRE), Woodchuck Hepatitis virus PRE (WPRE), and 5 untranslated region (UTR) of human heat shock protein 70 mRNA (Hsp70). In some embodiments, the PTRE comprises a sequence selected from the group consisting of SEQ ID NOS: 3615-3617, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto. In the foregoing, the one or more accessory elements are operably linked to the CRISPR protein. It has been discovered that the inclusion of the accessory element(s) in the polynucleotide of the rAAV construct can enhance the expression, binding, activity, or performance of the CRISPR protein as compared to the CRISPR protein in the absence of said accessory element in the transgene of an rAAV vector. In one embodiment, the inclusion of the one or more accessory elements the transgene of the rAAV results in an increase in editing of a target nucleic acid by the CRISPR protein in an in vitro assay of at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, or at least about 300% as compared to the CRISPR protein in the absence of said accessory element in an rAAV vector.
[0202] By adeno-associated virus inverted terminal repeats or AAV ITRs is meant the art recognized regions found at each end of the AAV genome which function together in cis as origins of DNA replication and as packaging signals for the virus. AAV ITRs, together with the AAV rep coding region, provide for the efficient excision and rescue from, and integration of a nucleotide sequence interposed between two flanking ITRs into a mammalian cell genome.
[0203] The nucleotide sequences of AAV ITR regions are known. See, for example Kotin, R. M. (1994) Human Gene Therapy 5:793-801; Berns, K. I. Parvoviridae and their Replication in Fundamental Virology, 2nd Edition, (B. N. Fields and D. M. Knipe, eds.). As used herein, an AAV ITR need not have the wild-type nucleotide sequence depicted, but may be altered, e.g., by the insertion, deletion or substitution of nucleotides. Additionally, the AAV ITR may be derived from any of several AAV serotypes, including without limitation, AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV 9.45, AAV 9.61, AAV 44.9, AAV-Rh74, AAVRh10, MyoAAV 1A1, MyoAAV 1A2, and MyoAAV 2A, and modified capsids of these serotypes. Furthermore, 5 and 3 ITRs which flank a selected nucleotide sequence in an AAV vector need not necessarily be identical or derived from the same AAV serotype or isolate, so long as they function as intended, i.e., to allow for excision and rescue of the sequence of interest from a host cell genome or vector, and to allow integration of the heterologous sequence into the recipient cell genome when AAV Rep gene products are present in the cell. Use of AAV serotypes for integration of heterologous sequences into a host cell is known in the art (see, e.g., WO2018195555A1 and US20180258424A1, incorporated by reference herein). In some embodiments, the ITRs are derived from serotype AAV1. In other embodiments, the ITRs are derived from serotype AAV2, including the 5 ITR having sequence CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCGTCGGGCGAC CTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACT CCATCACTAGGGGTTCCT (SEQ ID NO: 17) and the 3 ITR having sequence AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCGCTCACTG AGGCCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCGGGCGGCCTCAGTG AGCGAGCGAGCGCGCAGCTGCCTGCAGG (SEQ ID NO: 18). In other embodiments, the ITR sequences are modified to remove CpG motifs to reduce immunogenic responses. In one embodiment, the modified AAV2 5 ITR sequence is the sequence of SEQ ID NO: 3749 and the 3 ITR sequence is the sequence of SEQ ID NO: 4047.
[0204] By AAV rep coding region is meant the region of the AAV genome which encodes the replication proteins Rep 78, Rep 68, Rep 52 and Rep 40. These Rep expression products have been shown to possess many functions, including recognition, binding and nicking of the AAV origin of DNA replication, DNA helicase activity and modulation of transcription from AAV (or other heterologous) promoters. The Rep expression products are collectively required for replicating the AAV genome.
[0205] By AAV cap coding region is meant the region of the AAV genome which encodes the capsid proteins VP1, VP2, and VP3, or functional homologues thereof. These Cap expression products supply the packaging functions which are collectively required for packaging the viral genome.
[0206] In some embodiments, the rAAV is of serotype 9 or of serotype 6, which have been demonstrated to effectively deliver polynucleotides to motor neurons and glia throughout the spinal cord in preclinical models of Amyotrophic lateral sclerosis (ALS) (Foust, K D. et al. Therapeutic AAV9-mediated suppression of mutant RHO slows disease progression and extends survival in models of inherited ALS. Mol Ther. 21(12):2148 (2013)). In some embodiments, the methods provide use of rAAV9 or rAAV6 for targeting of neurons via intraparenchymal brain injection. In some embodiments, the methods provide use of rAAV9 for intravenous administering of the vector wherein the rAAV9 has the ability to penetrate the blood-brain barrier and drive gene expression in the nervous system via both neuronal and glial tropism of the vector. In other embodiments, the rAAV is of serotype 8, which have been demonstrated to effectively deliver polynucleotides to retinal cells.
[0207] In a feature of the rAAV of the present disclosure, it has been discovered that utilization of certain Class 2 CRISPR systems of smaller size permit the inclusion of additional sequence space in the polynucleotides used in the making of the rAAV that can be utilized for the remaining components of the transgene, as described herein. In some embodiments, the encoded Class 2 CRISPR system comprises a Type V protein selected from the group consisting of Cas12a (Cpf1), Cas12b (C2c1), Cas12c (C2c3), Cas12d (CasY), Cas12e (CasX), Cas12f, Cas12g, Cas12h, Cas12i, Cas12j, Cas12k, Cas14, and/or Cas, and the associated guide RNA of the respective system. In some embodiments, the encoded Class 2, Type V CRISPR nuclease protein is a CasX protein. In some embodiments, the encoded Class 2, Type V CRISPR nuclease protein is a CasX, and the guide is a CasX guide; embodiments of which are described herein.
[0208] As described, supra, the smaller size of the Class 2, Type V proteins and gRNA contemplated for inclusion in the transgene of the rAAV permit inclusion of additional or larger components in a transgene that can be incorporated into a single rAAV particle. In some embodiments, the transgene encoding the Class 2, Type V proteins and a first gRNA with a linked targeting sequence complementary to a target nucleic acid and one or more accessory elements has less than about 4800, less than about 4700, less than about 4600, less than about 4500, less than about 4400 nucleotides, less than about 4300 nucleotides, or less than about 4250 nucleotides, wherein the rAAV transgene is configured for incorporation into a rAAV capsid. In other embodiments, the transgene encoding the Class 2, Type V proteins and a first and a second gRNA with linked targeting sequences complementary to a target nucleic acid and one or more accessory elements has less than about 4800, less than about 4700, less than about 4600, less than about 4500, less than about 4400 nucleotides, less than about 4300 nucleotides, or less than about 4250 nucleotides, wherein the rAAV transgene is configured for incorporation into a rAAV capsid. In some embodiments, the rAAV transgene has about 4250 to about 4800 nucleotides, or any integer in between.
[0209] In some embodiments, the polynucleotide of the transgene encoding the Class 2, Type V CRISPR nuclease protein sequence and the gRNA sequence are less than about 3100, about 3090, about 3080, about 3070, about 3060, about 3050, or less than about 3040 nucleotides in length. In other embodiments, the polynucleotide of the transgene encoding the Class 2, Type V CRISPR nuclease protein sequence and the gRNA sequence are less than about 3040 to about 3100 nucleotides in combined length. Thus, in light of the total length of the expression cassette that can be packaged into an rAAV particle, in some embodiments, the polynucleotide sequences of the transgene of a first promoter and the at least one accessory element have greater than at least about 1300, at least about 1350, at least about 1360, at least about 1370, at least about 1380, at least about 1390, at least about 1400, at least about 1500, at least about 1600 nucleotides, at least 1650, at least about 1700, at least about 1750, at least about 1800, at least about 1850, or at least about 1900 nucleotides in combined length. In other embodiments, the polynucleotide sequences of the transgene of the first promoter and the at least one accessory element have greater than at least about 1300 to at least about 1900 nucleotides in combined length. In one embodiment, the polynucleotide sequences of the transgene of the first promoter and the at least one accessory element have greater than 1314 nucleotides in combined length. In another embodiment, the polynucleotide sequences of the transgene of the first promoter and the at least one accessory element have greater than 1381 nucleotides in combined length. In other embodiments, the polynucleotide sequences of the transgene of the first promoter, the second promoter and the at least one accessory element have greater than at least about 1300, at least about 1350, at least about 1360, at least about 1370, at least about 1380, at least about 1390, at least about 1400, at least about 1500, at least about 1600 nucleotides, at least 1650, at least about 1700, at least about 1750, at least about 1800, at least about 1850, or at least about 1900 nucleotides in combined length. In other embodiments, the polynucleotide sequences of the transgene of the first promoter, the second promoter and the at least one accessory element have greater than at least about 1300 to at least about 1900 nucleotides in combined length. In one embodiment, the polynucleotide sequences of the transgene of the first promoter, the second promoter, and the at least one accessory element have greater than 1314 nucleotides in combined length. In other embodiments, the polynucleotide sequences of the transgene of the first promoter, the second promoter, and the at least one accessory element have greater than 1381 nucleotides in combined length. In still other embodiments, the polynucleotide sequences of the transgene of the first promoter, the second promoter, and the two or more accessory elements have greater than at least about 1300, at least about 1350, at least about 1360, at least about 1370, at least about 1380, at least about 1390, at least about 1400, at least about 1500, at least about 1600 nucleotides, at least 1650, at least about 1700, at least about 1750, at least about 1800, at least about 1850, or at least about 1900 nucleotides in combined length. In other embodiments, the polynucleotide sequences of the transgene of the first promoter, the second promoter, and the two or more accessory elements have greater than at least about 1300 to at least about 1900 nucleotides in combined length. In one embodiment, the polynucleotide sequences of the transgene of the first promoter, the second promoter, and the two or more accessory elements have greater than 1314 nucleotides in combined length. In another embodiment, the polynucleotide sequences of the transgene of the first promoter, the second promoter, and the two or more accessory elements have greater than 1381 nucleotides in combined length.
[0210] It has been discovered that use of shorter or truncated promoters in the rAAV transgene also permits a shorter total transgene size for inclusion of all the CRISPR and regulatory elements, while increasing the percentage of correctly packaged rAAV particles. In some embodiments, the total length of the transgene polynucleotide sequences of the first promoter and at least one accessory element are greater than at least about 1200, at least about 1300, at least about 1350, at least about 1360, at least about 1370, at least about 1380, at least about 1390, at least about 1400, at least about 1500, at least about 1600 nucleotides, at least 1650, at least about 1700 nucleotides in an rAAV construct with a total length of not more than 4700 nucleotides, wherein the transgene is capable of being integrated into an rAAV particle. In other embodiments, the total length of the transgene the polynucleotide sequences of the first promoter and at least one accessory element are greater than at least about 1300, at least about 1350, at least about 1360, at least about 1370, at least about 1380, at least about 1390, at least about 1400, at least about 1500, at least about 1600 nucleotides, at least 1650, at least about 1700 nucleotides in an rAAV construct with a total length of not more than 4800 nucleotides, wherein the transgene is configured for incorporation into an rAAV particle.
[0211] In some embodiments, the present disclosure provides a transgene polynucleotide comprising a first adeno-associated virus (AAV) inverted terminal repeat (ITR) sequence, a second AAV ITR sequence, a first promoter sequence, a sequence encoding a Class 2, Type V CRISPR nuclease protein, a second promoter sequence, a sequence encoding at least a first guide RNA (gRNA), and one or more accessory element sequences, wherein at least 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, or 35% or more of the nucleotides of the polynucleotide sequence comprise the first and second promoters and the one or more accessory element sequences in combined length. In other embodiments, the present disclosure provides a transgene polynucleotide comprising a first adeno-associated virus (AAV) inverted terminal repeat (ITR) sequence, a second AAV ITR sequence, a first promoter sequence, a sequence encoding a Class 2, Type V CRISPR nuclease protein, a second promoter sequence, a sequence encoding a first guide RNA (gRNA), a third promoter sequence, a sequence encoding a second gRNA, and one or more accessory element sequences, wherein at least 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, or 35% or more of the nucleotides of the polynucleotide sequences comprising the first, second, and third promoters and the one or more accessory element sequences in combined length. As detailed in the Examples, it has been discovered that the ability to devote more of the total polynucleotide of the expression cassette of an rAAV transgene to the promoters, a second gRNA, and/or the accessory elements results in enhanced expression of and/or performance of the CRISPR protein and gRNA, when expressed in the target host cell; either in an in vitro assay or in vivo in a subject. In some embodiments, the use of alternative or longer promoters and/or accessory elements (e.g., poly(A) signal, a gene enhancer element, an intron, a posttranscriptional regulatory element (PTRE), a nuclear localization signal (NLS), a deaminase, a DNA glycosylase inhibitor, a stimulator of CRISPR-mediated homology-directed repair, and an activator or repressor of transcription) in the rAAV polynucleotides and resulting rAAV results in an increase in editing of a target nucleic acid of at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, or at least about 300% when the rAAV is assessed in an in vitro assay compared to a construct not having the alternative or longer promoters and/or accessory elements. In one embodiment, a Pol II promoter sequence of the transgene polynucleotide has at least about 35, at least about 50, at least about 80, at least about 100, at least about 200, at least about 300, at least about 400, at least about 500, at least about 600, at least about 700, or at least about 800 nucleotides. In another embodiments, a Pol III promoter sequence of the transgene polynucleotide has at least about 50, at least about 80, at least about 100, at least about 200, at least about 300, at least about 400, at least about 500, at least about 600, at least about 700, or at least about 800 nucleotides. Embodiments of the promoters are described more fully, below.
[0212] In some embodiments, the present disclosure provides a transgene polynucleotide, wherein the polynucleotide comprises one or more sequences selected from the group of sequences set forth in Tables 7-10, 12-17, 19, 22-38, 39-43, 45-46, 50-55, 57-58, 60-61, and 78 or a sequence having at least 85%, at least 90%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto. In another embodiment, the present disclosure provides a polynucleotide, wherein the polynucleotide comprises a sequence selected from the group of sequences set forth in Tables 7-10, 12-17, 19, 22-38, 39-43, 45-46, 50-55, 57-58, 60-61, and 78. In some embodiments, the polynucleotide sequence differs from those set forth in Tables 7-10, 12-17, 19, 22-38, 39-43, 45-46, 50-55, 57-58, 60-61, and 78 only in the selection of the targeting sequences of the gRNA or gRNAs encoded by the polynucleotide, wherein the targeting sequence is a sequence having 15 to 20 nucleotides capable of hybridizing with the sequence of a target nucleic acid. In some embodiments, the present disclosure provides a transgene polynucleotide of any of the embodiments described herein, wherein the polynucleotide has the configuration of a construct of
III. Guide Nucleic Acids of the rAAV
[0213] In some embodiments, the disclosure relates to guide ribonucleic acids (gRNA) utilized in the rAAV that have utility in genome editing of a target nucleic acid in a cell. As used herein, the term gRNA covers naturally-occurring molecules and gRNA variants, including chimeric gRNA variants comprising domains from different gRNA. gRNAs of the disclosure comprise a scaffold and a targeting sequence complementary to a target nucleic acid of a cell.
[0214] The present disclosure provides gRNAs with targeting sequences that are complementary to (and are therefore able to hybridize with) the target nucleic acid as a component of the gene editing rAAV. It is envisioned that in some embodiments, multiple gRNAs are delivered in the rAAV for the modification of a target nucleic acid. For example, a pair of gRNAs with targeting sequences to different or overlapping regions of the target nucleic acid sequence can be used, when each is complexed with a CRISPR nuclease, in order to bind and cleave at two different or overlapping sites within the gene, which is then edited by non-homologous end joining (NHEJ), homology-directed repair (HDR), homology-independent targeted integration (HITI), micro-homology mediated end joining (MMEJ), single strand annealing (SSA) or base excision repair (BER). For example, when an editing event designed to delete one or more exons of a gene is desired, a pair of gRNAs can be used in order to bind and cleave at two different sites 5 and 3 of the targeted exon(s) within the gene in order to excise the intervening sequence. In other cases, a pair of gRNAs can be used in order to bind, cleave, and modify two different genes. Both single-stranded cleavage and double-stranded cleavage are possible, and double-stranded cleavage can occur as a result of two distinct single-stranded cleavage events by the CRISPR nuclease.
a. Reference gRNA and gRNA Variants
[0215] As used herein, a reference gRNA refers to a CRISPR guide ribonucleic acid comprising a wild-type sequence of a naturally-occurring gRNA. In some embodiments, a gRNA scaffold of the disclosure may be subjected to one or more mutagenesis methods, such as the mutagenesis methods described in WO2022120095A1 and WO2020247882A1, incorporated by reference herein, which may include Deep Mutational Evolution (DME), deep mutational scanning (DMS), error prone PCR, cassette mutagenesis, random mutagenesis, staggered extension PCR, gene shuffling, domain swapping, or chemical modification to generate one or more gRNA variants with enhanced or varied properties relative to the gRNA scaffold that was modified. The activity of the gRNA scaffold from which a gRNA variant was derived may be used as a benchmark against which the activity of the gRNA variant is compared, thereby measuring improvements in function or other characteristics of the gRNA scaffold.
[0216] Table 1 provides the sequences of reference gRNAs tracr and scaffold sequences. In some embodiments, the disclosure provides gRNA variant sequences wherein the gRNA has a scaffold comprising a sequence having one or more nucleotide modifications relative to a reference gRNA sequence having a sequence of any one of SEQ ID NOS:4-16 of Table 1.
TABLE-US-00001 TABLE1 ReferencegRNAtracrandscaffoldsequences SEQIDNO. NucleotideSequence 4 ACAUCUGGCGCGUUUAUUCCAUUACUUUGGAGCCAGUCCCAGCGACUAUGUCGUAUGGACGAAG CGCUUAUUUAUCGGAGAGAAACCGAUAAGUAAAACGCAUCAAAG 5 UACUGGCGCUUUUAUCUCAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUAAAGC GCUUAUUUAUCGGAGAGAAAUCCGAUAAAUAAGAAGCAUCAAAG 6 ACAUCUGGCGCGUUUAUUCCAUUACUUUGGAGCCAGUCCCAGCGACUAUGUCGUAUGGACGAAG CGCUUAUUUAUCGGAGA 7 ACAUCUGGCGCGUUUAUUCCAUUACUUUGGAGCCAGUCCCAGCGACUAUGUCGUAUGGACGAAG CGCUUAUUUAUCGG 8 UACUGGCGCUUUUAUCUCAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUAAAGC GCUUAUUUAUCGGAGA 9 UACUGGCGCUUUUAUCUCAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUAAAGC GCUUAUUUAUCGG 10 GUUUACACACUCCCUCUCAUAGGGU 11 GUUUACACACUCCCUCUCAUGAGGU 12 UUUUACAUACCCCCUCUCAUGGGAU 13 GUUUACACACUCCCUCUCAUGGGGG 14 CCAGCGACUAUGUCGUAUGG 15 GCGCUUAUUUAUCGGAGAGAAAUCCGAUAAAUAAGAAGC 16 GGCGCUUUUAUCUCAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUAAAGCGCUU AUUUAUCGGA
b. GRNA Domains and their Function
[0217] The gRNAs of the rAAV of the disclosure comprise two segments: a targeting sequence and a protein-binding segment. The targeting segment of a gRNA includes a nucleotide sequence (referred to interchangeably as a guide sequence, a spacer, a targeter, or a targeting sequence) that is complementary to (and therefore hybridizes with) a specific sequence (a target site) within the target nucleic acid sequence (e.g., a strand of a double stranded target DNA, a target ssRNA, a target ssDNA, etc.), described more fully below. The targeting sequence of a gRNA is capable of binding to a target nucleic acid sequence, including, in the context of the present disclosure, a coding sequence, a complement of a coding sequence, a non-coding sequence, and to accessory elements. The protein-binding segment (or activator or protein-binding sequence) interacts with (e.g., binds to) a CasX protein as a complex, forming an RNP (described more fully, below). The protein-binding segment is alternatively referred to herein as a scaffold, which is comprised of several regions, described more fully, below. The properties and characteristics of CasX gRNA, both wild-type and variants, are described in WO2020247882A1, US20220220508A1, and WO2022120095A1, incorporated by reference herein.
[0218] In the case of a reference gRNA, the gRNA occurs naturally as a dual guide RNA (dgRNA), wherein the targeter and the activator portions each have a duplex-forming segment that have complementarity with one another and hybridize to one another to form a double stranded duplex (dsRNA duplex for a gRNA). The term targeter or targeter RNA is used herein to refer to a crRNA-like molecule (crRNA: CRISPR RNA) of a CasX dual guide RNA (and therefore of a CasX single guide RNA when the activator and the targeter are linked together, e.g., by intervening nucleotides). The crRNA has a 5 region that anneals with the tracrRNA followed by the nucleotides of the targeting sequence. In the case of the gRNA for use in the systems of the disclosure, the scaffolds are designed such that the activator and targeter portions are covalently linked to one another (rather than hybridizing to one another) and comprise a single molecule, and can be referred to as a single-molecule gRNA, single guide RNA, a single-molecule guide RNA, a one-molecule guide RNA, or a sgRNA. In some embodiments, the gRNA utilized in the rAAV are single molecule versions.
[0219] Collectively, the assembled gRNAs of the disclosure comprise distinct structured regions, or domains: the RNA triplex, the scaffold stem loop, the extended stem loop, the pseudoknot, and the targeting sequence that, in the embodiments of the disclosure is specific for a target nucleic acid and is located on the 3 end of the gRNA. The RNA triplex, the scaffold stem loop, the pseudoknot and the extended stem loop, together with the unstructured triplex loop that bridges portions of the triplex, together, are referred to as the scaffold of the gRNA. In some cases, the scaffold stem further comprises a bubble. In other cases, the scaffold further comprises a triplex loop region. In still other cases, the scaffold further comprises a 5 unstructured region. In some embodiments, the gRNA scaffolds of the disclosure for use in the CasX:gRNA systems comprise a scaffold stem loop having the sequence of CCAGCGACUAUGUCGUAGUGG (SEQ ID NO: 14), or a sequence having 1, 2, 3, 4, or 5 mismatches thereto.
[0220] Each of the structured domains contribute to establishing the global RNA fold of the guide and retain functionality of the guide; particularly the ability to properly complex with the CasX protein. For example, the guide scaffold stem interacts with the helical I domain of CasX protein, while residues within the triplex, triplex loop, and pseudoknot stem interact with the OBD of the CasX protein. Together, these interactions confer the ability of the guide to bind and form an RNP with the CasX that retains stability, while the spacer (or targeting sequence) directs and defines the specificity of the RNP for binding a specific sequence of DNA.
[0221] Site-specific binding and/or cleavage of a target nucleic acid sequence (e.g., genomic DNA) by the CasX protein can occur at one or more locations (e.g., a sequence of a target nucleic acid) determined by base-pairing complementarity between the targeting sequence of the gRNA and the target nucleic acid sequence. Thus, for example, the gRNA of the disclosure have sequences complementarity to and therefore can hybridize with the target nucleic acid that is adjacent to a sequence complementary to a TC protospacer adjacent motif (PAM) motif or a PAM sequence, such as ATC, CTC, GTC, or TTC. Because the targeting sequence of a guide sequence hybridizes with a sequence of a target nucleic acid sequence, a targeting sequence can be modified by a user to hybridize with a specific target nucleic acid sequence, so long as the location of the PAM sequence is considered. In some embodiments, the target nucleic acid comprises a PAM sequence located 5 of the targeting sequence with at least a single nucleotide separating the PAM from the first nucleotide of the targeting sequence. In some embodiments, the PAM is located on the non-targeted strand of the target region, i.e. the strand that is complementary to the target nucleic acid. By selection of the targeting sequences of the gRNA, defined regions of the target nucleic acid sequence or sequences bracketing a particular location within the target nucleic acid can be modified or edited using the gRNA and CRISPR nuclease proteins described herein. In some embodiments, the targeting sequence of the gRNA has between 15 and 20 consecutive nucleotides. In some embodiments, the targeting sequence has 15, 16, 17, 18, 19, and 20 consecutive nucleotides. In some embodiments, the targeting sequence consists of 20 consecutive nucleotides. In some embodiments, the targeting sequence consists of 19 consecutive nucleotides. In some embodiments, the targeting sequence consists of 18 consecutive nucleotides. In some embodiments, the targeting sequence consists of 17 consecutive nucleotides. In some embodiments, the targeting sequence consists of 16 consecutive nucleotides. In some embodiments, the targeting sequence consists of 15 consecutive nucleotides. In some embodiments, the gRNA and linked targeting sequence exhibit a low degree of off-target effects to the DNA of a cell. As used herein, off-target effects refers to effects of unintended cleavage, such as mutations and indel formation, at untargeted genomic sites showing a similar but not an identical sequence compared to the target site (i.e., the sequence complementary to the targeting sequence of the gRNA). In some embodiments, the off-target effects exhibited by the gRNA and linked targeting sequence are less than about 5%, less than about 4%, less than 3%, less than about 2%, less than about 1%, less than about 0.5%, less than 0.1% in cells. In some embodiments, the off-target effects are determined in silico. In some embodiments, the off-target effects are determined in an in vitro cell-free assay. In some embodiments, the off-target effects are determined in a cell-based assay.
[0222] In another aspect, the disclosure relates to gRNA variants for use in the rAAV systems, which comprise one or more modifications relative to a reference gRNA scaffold or to another gRNA variant from which it was derived. All gRNA variants that have one or more improved functions, characteristics, or add one or more new functions when the gRNA variant is compared to a reference gRNA or to another gRNA variant from which it was derived, while retaining the functional properties of being able to complex with the CasX and guide the CasX ribonucleoprotein holo complex to the target nucleic acid are envisaged as within the scope of the disclosure. In some embodiments, the gRNA variant has an improved characteristic selected from the group consisting of increased editing activity, increased pseudoknot stem stability, increased triplex region stability, increased scaffold stem stability, extended stem stability, reduced off-target folding intermediates, and increased binding affinity to a Class 2, Type V CRISPR protein, or any combination thereof. In some cases of the foregoing, the improved characteristic is assessed in an in vitro assay, including the assays of the Examples. In other cases of the foregoing, the improved characteristic is assessed in vivo.
[0223] In some embodiments, a reference gRNA of the disclosure may be subjected to one or more mutagenesis methods, such as the mutagenesis methods described herein (as well as in PCT/US20/36506 and WO2020247883A2, incorporated by reference herein), which may include Deep Mutational Evolution (DME), deep mutational scanning (DMS), error prone PCR, cassette mutagenesis, random mutagenesis, staggered extension PCR, gene shuffling, or domain swapping, in order to generate one or more guide nucleic acid variants (referred to herein as gRNA variant) with enhanced or varied properties relative to the reference gRNA. gRNA variants also include variants comprising one or more exogenous sequences, for example fused to either the 5 or 3 end, or inserted internally. The activity of reference gRNAs may be used as a benchmark against which the activity of gRNA variants are compared, thereby measuring improvements in function or other characteristics of the gRNA variants. In other embodiments, a reference gRNA may be subjected to one or more deliberate, specifically-targeted mutations in order to produce a gRNA variant, for example a rationally designed variant. Exemplary gRNA variants produced by such methods are described in the Examples and representative sequences of gRNA scaffolds are presented in Table 2.
[0224] In some embodiments, a gRNA variant for use in the rAAV systems of the disclosure comprises one or more nucleotide substitutions, insertions, deletions, or swapped or replaced regions relative to a reference gRNA sequence of the disclosure that improve a characteristic relative to the reference gRNA. A representative example of such a gRNA variant is guide 235 (SEQ ID NO: 2292). Exemplary regions for modifications include the RNA triplex, the pseudoknot, the scaffold stem loop, and the extended stem loop. In some cases, the variant scaffold stem further comprises a bubble. In other cases, the variant scaffold further comprises a triplex loop region. In still other cases, the variant scaffold further comprises a 5 unstructured region. In one embodiment, the gRNA variant scaffold comprises a scaffold stem loop having the sequence of CCAGCGACUAUGUCGUAGUGG (SEQ ID NO:14). In another embodiment, the disclosure provides a gRNA scaffold comprising, relative to SEQ ID NO:5, a C18G substitution, a G55 insertion, a U1 deletion, and a modified extended stem loop in which the original 6 nt loop and 13 most-loop-proximal base pairs (32 nucleotides total) are replaced by a Uvsx hairpin (4 nt loop and 5 loop-proximal base pairs; 14 nucleotides total) and the loop-distal base of the extended stem was converted to a fully base-paired stem contiguous with the new Uvsx hairpin by deletion of the A99 and substitution of G64U. In the foregoing embodiment, the gRNA scaffold comprises the sequence
TABLE-US-00002 (SEQIDNO:2238) ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGU CGUAGUGGGUAAAGCUCCCUCUUCGGAGGGAGCAUCAAAG.
[0225] In exemplary embodiments, a gRNA variant for use in the rAAV systems comprises one or more modifications relative to gRNA scaffold variant 215 (SEQ ID NO:2275), wherein the resulting gRNA variant exhibits an improved functional characteristic compared to the parent 215, when assessed in an in vitro or in vivo assay under comparable conditions.
[0226] In exemplary embodiments, a gRNA variant for use in the rAAV systems comprises one or more modifications relative to gRNA scaffold variant 221 (SEQ ID NO: 2281), wherein the resulting gRNA variant exhibits an improved functional characteristic compared to the parent 221, when assessed in an in vitro or in vivo assay under comparable conditions.
[0227] In exemplary embodiments, a gRNA variant for use in the rAAV systems comprises one or more modifications relative to gRNA scaffold variant 225 (SEQ ID NO: 2285), wherein the resulting gRNA variant exhibits an improved functional characteristic compared to the parent 225, when assessed in an in vitro or in vivo assay under comparable conditions.
[0228] In exemplary embodiments, a gRNA variant for use in the rAAV systems comprises one or more modifications relative to gRNA scaffold variant 235 (SEQ ID NO: 2292), wherein the resulting gRNA variant exhibits an improved functional characteristic compared to the parent 225, when assessed in an in vitro or in vivo assay under comparable conditions.
[0229] In exemplary embodiments, a gRNA variant for use in the rAAV systems comprises one or more modifications relative to gRNA scaffold variant 251 (SEQ ID NO: 2308), wherein the resulting gRNA variant exhibits an improved functional characteristic compared to the parent 251, when assessed in an in vitro or in vivo assay under comparable conditions.
[0230] In exemplary embodiments, a gRNA variant for use in the rAAV systems comprises one or more modifications relative to gRNA scaffold 316 (SEQ ID NO: 9588), wherein the resulting gRNA variant exhibits an improved functional characteristic compared to the parent 235, when assessed in an in vitro or in vivo assay under comparable conditions.
[0231] Table 2 provides exemplary gRNA scaffold sequences of the disclosure for use in the rAAV. In some embodiments, the rAAV comprises a first and a second gRNA, wherein the first and/or the second gRNA are identical. In other embodiments, the rAAV comprises a first and a second gRNA, wherein the first and/or the second gRNA are different. In both cases, the first and the second gRNA would comprise targeting sequences complementary to different target nucleic acid sequences. In some embodiments, the encoded gRNA scaffold for use in the rAAV comprises a sequence selected from the group consisting of SEQ ID NOS: 2238-2400, 9257-9289 and 9588, (of which 2238-2285, 2287-2352, 2376, 2378, 2383-2400, and 9588 are presented in Table 2), wherein the gRNA variant retains the ability to form an RNP with a CasX and to bind a target nucleic acid. In other embodiments, the encoded gRNA variant scaffold for use in the rAAV of the disclosure comprises a sequence having at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity to a sequence selected from the group consisting of SEQ ID NOS: 2238-2400, 9257-9289 and 9588, wherein the gRNA variant retains the ability to form an RNP with a CasX of the disclosure and to bind a target nucleic acid. In other embodiments, the encoded gRNA variant scaffold for use in the rAAV of the disclosure comprises a sequence selected from the group consisting of SEQ ID NOS: 2238-2400, 9257-9289 and 9588, further comprising 1, 2, 3, 4, or 5 mismatches thereto, wherein the gRNA variant retains the ability to form an RNP with a CasX of the disclosure and to bind a target nucleic acid, whereupon the RNP modifies the target nucleic acid. In one embodiment, the encoded gRNA variant scaffold for use in the rAAV of the disclosure comprises a sequence of SEQ ID NO: 2292. In another embodiment, the encoded gRNA variant scaffold for use in the rAAV of the disclosure comprises a sequence of SEQ ID NO: 9588. It will be understood that in those embodiments wherein the rAAV transgene comprises a DNA encoding sequence for a gRNA, that thymine (T) bases can be substituted for the uracil (U) bases of any of the gRNA sequence embodiments described herein.
TABLE-US-00003 TABLE2 ExemplarygRNAScaffoldSequences SEQID NO: Name NUCLEOTIDESEQUENCEORDESCRIPTIONOFMODIFICATION 2238 174 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2239 175 ACUGGCGCCUUUAUCUCAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAAAG 2240 176 GCUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2241 177 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2242 181 ACUGGCGCCUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAAAG 2243 182 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAAAG 2244 183 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAAAG 2245 184 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2246 185 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUUGGGU AAAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAAAG 2247 186 ACUGGCGCCUUUAUCAUCAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGU AAAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAAAG 2248 187 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCGCCCUCUUCGGAGGGAAGCAUCAAAG 2249 188 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCACAUGAGGAUCACCCAUGUGAGCAUCAAAG 2250 189 ACUGGCACUUUUACCUGAUUACUUUGAGAGCCAACACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2251 190 ACUGGCACUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2252 191 ACUGGCCCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2253 192 ACUGGCGCUUUUACCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2254 193 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAACACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2255 195 ACUGGCACCUUUACCUGAUUACUUUGAGAGCCAACACCAGCGACUAUGUCGUAUGGGUA AAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAAAG 2256 196 ACUGGCACCUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAAAG 2257 197 ACUGGCCCCUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAAAG 2258 198 ACUGGCGCCUUUAUCUGAUUACUUUGAGAGCCAACACCAGCGACUAUGUCGUAUGGGUA AAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAAAG 2259 199 GCUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2260 200 GACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGG UAAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2261 201 ACUGGCGCCUUUAUCUGAUUACUUUGGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGG UAAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2262 202 ACUGGCGCAUUUAUCUGAUUACUUUGUGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2263 203 ACUGGCGCCUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2264 204 ACUGGCGCUUUUAUCUGAUUACUUUGGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGG UAAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2265 205 ACUGGCGCAUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2266 206 ACUGGCGCUUUUAUCUGAUUACUUUGUGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2267 207 ACUGGCGCUUUUAUUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGG UAAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2268 208 ACGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGUA AAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2269 209 ACUGGCGCUUUUAUAUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2270 210 ACUGGCGCUUUUAUCUUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGG UAAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2271 211 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAGCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2272 212 ACUGGCGCUGUUAUCUGAUUACUUCGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCGAAG 2273 213 ACUGGCGCUCUUAUCUGAUUACUUCGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCGAAG 2274 214 ACUGGCGCUUGUAUCUGAUUACUCUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAGAG 2275 215 ACUGGCGCUUCUAUCUGAUUACUCUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAGAG 2276 216 ACUGGCGCUUUGAUCUGAUUACCUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAGG 2277 217 ACUGGCGCUUUCAUCUGAUUACCUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAGG 2278 218 ACUGGCGCUGUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2279 219 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCGAAG 2280 220 ACUGGCGCUUUUAUCUGAUUACUUCGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAAAG 2281 221 ACUGGCACUUCUAUCUGAUUACUCUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCCGCUUACGGACUUCGGUCCGUAAGAGGCAUCAGAG 2282 222 ACUGGCACUUCUAUCUGAUUACUCUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAGAG 2283 223 ACUGGCACCUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCCGCUUACGGACUUCGGUCCGUAAGAGGCAUCAAAG 2284 224 ACUGGCACUUGUAUCUGAUUACUCUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCCGCUUACGGACUUCGGUCCGUAAGAGGCAUCAGAG 2285 225 ACUGGCACUUGUAUCUGAUUACUCUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAGAG 2287 230 ACUGGCACUUCUAUCUGAUUACUCUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCGCUUACGGACUUCGGUCCGUAAGAAGCAUCAGAG 2288 231 ACUGGCGCUUCUAUCUGAUUACUCUGAGAGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCCGCUUACGGACUUCGGUCCGUAAGAGGCAUCAGAG 2289 232 ACUGGCACUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCCGCUUACGGACUUCGGUCCGUAAGAGGCAUCAGAG 2290 233 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCCGCUUACGGACUUCGGUCCGUAAGAGGCAUCAGAG 2291 234 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAUGGGUA AAGCGCCUUACGGACUUCGGUCCGUAAGGAGCAUCAGAG 2292 235 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCGCUUACGGACUUCGGUCCGUAAGAGGCAUCAGAG 2293 236 ACGGGACUUUCUAUCUGAUUACUCUGAAGUCCCUCACCAGCGACUAUGUCGUAUGGGUA AAGCCGCUUACGGACUUCGGUCCGUAAGAGGCAUCAGAG 2294 237 ACCUGUAGUUCUAUCUGAUUACUCUGACUACAGUCACCAGCGACUAUGUCGUAUGGGUA AAGCCGCUUACGGACUUCGGUCCGUAAGAGGCAUCAGAG 2295 238 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACGGUGGGCGCAGCUUCGGCUGACGGUACACCGUGCAGCAUCAAAG 2296 239 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACGGUGGGCGCAGCUUCGGCUGACGGUACACCGGUGGGCGCAGCUUCGGCU GACGGUACACCGUGCAGCAUCAAAG 2297 240 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACGGUGGGCGCAGCUUCGGCUGACGGUACACCGGUGGGCGCAGCUUCGGCU GACGGUACACCGGUGGGCGCAGCUUCGGCUGACGGUACACCGUGCAGCAUCAAAG 2298 241 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACGGUGGGCGCAGCUUCGGCUGACGGUACACCGGUGGGCGCAGCUUCGGCU GACGGUACACCGGUGGGCGCAGCUUCGGCUGACGGUACACCGGUGGGCGCAGCUUCGGC UGACGGUACACCGUGCAGCAUCAAAG 2299 242 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACGGUGGGCGCAGCUUCGGCUGACGGUACACCGGUGGGCGCAGCUUCGGCU GACGGUACACCGGUGGGCGCAGCUUCGGCUGACGGUACACCGGUGGGCGCAGCUUCGGC UGACGGUACACCGGUGGGCGCAGCUUCGGCUGACGGUACACCGUGCAGCAUCAAAG 2300 243 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACCUAGCGGAGGCUAGGUGCAGCAUCAAAG 2301 244 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACCUCGGCUUGCUGAAGCGCGCACGGCAAGAGGCGAGGUGCAGCAUCAAAG 2302 245 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACCUCUCUCGACGCAGGACUCGGCUUGCUGAAGCGCGCACGGCAAGAGGCG AGGGGCGGCGACUGGUGAGUACGCCAAAAAUUUUGACUAGCGGAGGCUAGAAGGAGAGA GGUGCAGCAUCAAAG 2303 246 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACGGUGCCCGUCUGUUGUGUCGAGAGACGCCAAAAAUUUUGACUAGCGGAG GCUAGAAGGAGAGAGAUGGGUGCCGUGCAGCAUCAAAG 2304 247 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACAUGGAGAGGAGAUGUGCAGCAUCAAAG 2305 248 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACAUGGAGAUGUGCAGCAUCAAAG 2306 249 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUUGGGCGCAGCGUCAAUGACGCUGACGGUACAAGCAUCAAAG 2307 250 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCGUCAAUGACGCUGACGGUACAGGCCACAUGAGGAUCA CCCAUGUGGUAUAGUGCAGCAUCAAAG 2308 251 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCUCAUGAGGAUCACCCAUGAGCUGACGGUACAGGCCAC AUGAGGAUCACCCAUGUGGUAUAGUGCAGCAUCAAAG 2309 252 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCGUCAAUGACGCUGACGGUACAGGCCACAUGGCAGUCG UAACGACGCGGGUGGUAUAGUGCAGCAUCAAAG 2310 253 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCAAACAUGGCAGUCCUAAGGACGCGGGUUUUGCUGACG GUACAGGCCACAUGGCAGUCGUAACGACGCGGGUGGUAUAGUGCAGCAUCAAAG 2311 254 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGACAUGGCAGUCGUAACGACGCGGGUCUGACGGUACAGG CCACAUGAGGAUCACCCAUGUGGUAUAGUGCAGCAUCAAAG 2312 255 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAAGGAGUUUAUAUGGAAACCCUUAGUGCAGCAUCAAAG 2313 256 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCAGGAAGCACUAUGGGCGCAGCGUCAAUGACGCUGACGGUACAGGCCAGACAA UUAUUGUCUGGUAUAGUGCAGCAGCAGAACAAUUUGCUGAGGGCUAUUGAGGCGCAACA GCAUCUGUUGCAACUCACAGUCUGGGGCAUCAAGCAGCUCCAGGCAAGAAUCCUGAGCA UCAAAG 2314 257 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACGCCCUGAAGAAGGGCGUGCAGCAUCAAAG 2315 258 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACGGCUCGUGUAGCUCAUUAGCUCCGAGCCGUGCAGCAUCAAAG 2316 259 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACCCGUGUGCAUCCGCAGUGUCGGAUCCACGGGUGCAGCAUCAAAG 2317 260 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACGGAAUCCAUUGCACUCCGGAUUUCACUAGGUGCAGCAUCAAAG 2318 261 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACAUGCAUGUCUAAGACAGCAUGUGCAGCAUCAAAG 2319 262 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACAAAACAUAAGGAAAACCUAUGUUGUGCAGCAUCAAAG 2320 263 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCGCUUACGGACUAUGGGCGCAGCGUCAAUGACGCUGACGGUACAGGCCAGACAA UUAUUGUCUGGUAUAGUCCGUAAGAGGCAUCAGAG 2321 264 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCGCUUACGGGUGGGCGCAGCGUCAAUGACGCUGACGGUACAGGCCAGACAAUUA UUGUCUGGUACCCGUAAGAGGCAUCAGAG 2322 265 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCGCUUACGGACUAUGGGCGCAGCGUCAAUGACGCUGACGGUACAGGCCACAUGA GGAUCACCCAUGUGGUAUAGUCCGUAAGAGGCAUCAGAG 2323 266 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUAUGGGCGCAGCGUCAAUGACGCUGACGGUACAGGCCACAUGAGGAUCAC CCAUGUGGUAUAGGGAGCAUCAAAG 2324 267 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCGCUUACGGACUAUGGGCGCAGCUCAUGAGGAUCACCCAUGAGCUGACGGUACA GGCCACAUGAGGAUCACCCAUGUGGUAUAGUCCGUAAGAGGCAUCAGAG 2325 268 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUAUGGGCGCAGCUCAUGAGGAUCACCCAUGAGCUGACGGUACAGGCCACA UGAGGAUCACCCAUGUGGUAUAGGGAGCAUCAAAG 2326 269 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCGCUUACGGACUAUGGGCGCAGCGUCAAUGACGCUGACGGUACAGGCCACAUGG CAGUCGUAACGACGCGGGUGGUAUAGUCCGUAAGAGGCAUCAGAG 2327 270 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUAUGGGCGCAGCGUCAAUGACGCUGACGGUACAGGCCACAUGGCAGUCGU AACGACGCGGGUGGUAUAGGGAGCAUCAAAG 2328 27 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCGCUUACGGACUAUGGGCGCAGCAAACAUGGCAGUCCUAAGGACGCGGGUUUUG CUGACGGUACAGGCCACAUGGCAGUCGUAACGACGCGGGUGGUAUAGUCCGUAAGAGGC AUCAGAG 2329 272 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUAUGGGCGCAGCAAACAUGGCAGUCCUAAGGACGCGGGUUUUGCUGACGG UACAGGCCACAUGGCAGUCGUAACGACGCGGGUGGUAUAGGGAGCAUCAAAG 2330 273 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCGCUUACGGACUAUGGGCGCAGACAUGGCAGUCGUAACGACGCGGGUCUGACGG UACAGGCCACAUGAGGAUCACCCAUGUGGUAUAGUCCGUAAGAGGCAUCAGAG 2331 274 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUAUGGGCGCAGACAUGGCAGUCGUAACGACGCGGGUCUGACGGUACAGGC CACAUGAGGAUCACCCAUGUGGUAUAGGGAGCAUCAAAG 2332 275 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACCUGAGGAUCACCCAGGUGCUGACGGUACAGGCCAC CUGAGGAUCACCCAGGUGGUAUAGUGCAGCAUCAAAG 2333 276 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCGCAUGAGGAUCACCCAUGCGCUGACGGUACAGGCCGC AUGAGGAUCACCCAUGCGGUAUAGUGCAGCAUCAAAG 2334 277 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCGCCUGAGGAUCACCCAGGCGCUGACGGUACAGGCCGC CUGAGGAUCACCCAGGCGGUAUAGUGCAGCAUCAAAG 2335 278 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCGCCUGAGCAUCAGCCAGGCGCUGACGGUACAGGCCGC CUGAGCAUCAGCCAGGCGGUAUAGUGCAGCAUCAAAG 2336 279 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUGAGCAUCAGCCAUGUGCUGACGGUACAGGCCAC AUGAGCAUCAGCCAUGUGGUAUAGUGCAGCAUCAAAG 2337 280 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUGAGUAUCAACCAUGUGCUGACGGUACAGGCCAC AUGAGUAUCAACCAUGUGGUAUAGUGCAGCAUCAAAG 2338 281 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUGAGAAUCAGCCAUGUGCUGACGGUACAGGCCAC AUGAGAAUCAGCCAUGUGGUAUAGUGCAGCAUCAAAG 2339 282 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCCCUUGAGGAUCACCCAUGUGCUGACGGUACAGGCCCC UUGAGGAUCACCCAUGUGGUAUAGUGCAGCAUCAAAG 2340 283 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACUUGAGGAUCACCCAUGUGCUGACGGUACAGGCCAC UUGAGGAUCACCCAUGUGGUAUAGUGCAGCAUCAAAG 2341 284 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACCUGAGGAUCACCCAUGUGCUGACGGUACAGGCCAC CUGAGGAUCACCCAUGUGGUAUAGUGCAGCAUCAAAG 2342 285 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUGAGGAUCACCUAUGUGCUGACGGUACAGGCCAC AUGAGGAUCACCUAUGUGGUAUAGUGCAGCAUCAAAG 2343 286 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUUAGGAUCACCAAUGUGCUGACGGUACAGGCCAC AUUAGGAUCACCAAUGUGGUAUAGUGCAGCAUCAAAG 2344 287 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUUAGGAUCACCGAUGUGCUGACGGUACAGGCCAC AUUAGGAUCACCGAUGUGGUAUAGUGCAGCAUCAAAG 2345 288 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUUAGGAUCACCUAUGUGCUGACGGUACAGGCCAC AUUAGGAUCACCUAUGUGGUAUAGUGCAGCAUCAAAG 2346 289 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUGAGGAUUACCCAUGUGCUGACGGUACAGGCCAC AUGAGGAUUACCCAUGUGGUAUAGUGCAGCAUCAAAG 2347 290 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUGAGGAUAACCCAUGUGCUGACGGUACAGGCCAC AUGAGGAUAACCCAUGUGGUAUAGUGCAGCAUCAAAG 2348 291 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUGAGGAUGACCCAUGUGCUGACGGUACAGGCCAC AUGAGGAUGACCCAUGUGGUAUAGUGCAGCAUCAAAG 2349 292 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUGAGGACCACCCAUGUGCUGACGGUACAGGCCAC AUGAGGACCACCCAUGUGGUAUAGUGCAGCAUCAAAG 2350 293 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCAGAUGAGGAUCACCCAUGGGCUGACGGUACAGGCCAG AUGAGGAUCACCCAUGGGGUAUAGUGCAGCAUCAAAG 2351 294 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUGGGGAUCACCCAUGUGCUGACGGUACAGGCCAC AUGGGGAUCACCCAUGUGGUAUAGUGCAGCAUCAAAG 2352 295 ACUGGCGCUUUUAUCUGAUUACUUUGAGAGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUGCACUAUGGGCGCAGCACAUGAGGAUCACCCAUGUGCUGACGGUACAGGCCAC AUGAGGAUCACCCAUGUGGUAUAGUGCAGCAUCAAAG 9588 316 ACUGGCGCUUCUAUCUGAUUACUCUGAGCGCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAGAG 2376 320 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCGCUUAGGGACUUCGGUCCCUAAGAGGCAUCAGAG 2378 321 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCCUUAGGGACUUCGGUCCCUAAGGGCAUCAGAG 2382 323 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCGGAGGGAGCAUCAGAG 2383 324 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCCUUAGGGACCUUGGUCCCUAAGGGCAUCAGAG 2384 325 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCUCUUAGGGACCUUGGUCCCUAAGAGGCAUCAGAG 2385 326 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCCUUGGAGGGAGCAUCAGAG 2386 327 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCCUUAGGGAGGAAACUCCCUAAGGGCAUCAGAG 2387 328 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCUCUUAGGGAGGAAACUCCCUAAGAGGCAUCAGAG 2388 329 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUGGAAACAGGGAGCAUCAGAG 2389 330 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCCUUAGGGACUUCAGGUCCCUAAGGGCAUCAGAG 2390 331 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCCUCUUAGGGACUUCAGGUCCCUAAGAGGCAUCAGAG 2391 332 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGCGACUAUGUCGUAGUGGGU AAAGCUCCCUCUUCAGGAGGGAGCAUCAGAG 2392 333 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGGCACUAUGUGCUAGUGGGU AAAGCCCUUAGGGACCUUGGUCCCUAAGGGCAUCAGAG 2393 334 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGGCACUAUGUGCUAGUGGGU AAAGCCUCUUAGGGACCUUGGUCCCUAAGAGGCAUCAGAG 2394 335 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGGCACUAUGUGCUAGUGGGU AAAGCUCCCUCCUUGGAGGGAGCAUCAGAG 2395 336 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGGCACUAUGUGCUAGUGGGU AAAGCCCUUAGGGAGGAAACUCCCUAAGGGCAUCAGAG 2396 337 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGGCACUAUGUGCUAGUGGGU AAAGCCUCUUAGGGAGGAAACUCCCUAAGAGGCAUCAGAG 2397 338 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGGCACUAUGUGCUAGUGGGU AAAGCUCCCUGGAAACAGGGAGCAUCAGAG 2398 339 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGGCACUAUGUGCUAGUGGGU AAAGCCCUUAGGGACUUCAGGUCCCUAAGGGCAUCAGAG 2399 340 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGGCACUAUGUGCUAGUGGGU AAAGCCUCUUAGGGACUUCAGGUCCCUAAGAGGCAUCAGAG 2400 341 ACUGGGCCUUCUAUCUGAUUACUCUGAGGCCCAUCACCAGGCACUAUGUGCUAGUGGGU AAAGCUCCCUCUUCAGGAGGGAGCAUCAGAG
[0232] Additional gRNA variants are presented in the attached sequence listing, as SEQ ID NOS: 2101-2237 and 9257-9289 and 9588.
[0233] In some embodiments, a gRNA variant comprises one or more additional modifications to a sequence of SEQ ID NO:2238, SEQ ID NO:2239, SEQ ID NO:2240, SEQ ID NO:2241, SEQ ID NO:2243, SEQ ID NO:2256, SEQ ID NO:2274, SEQ ID NO:2275, SEQ ID NO:2279, SEQ ID NO:2281, SEQ ID NO: 2285, SEQ ID NO: 2289, SEQ ID NO: 2292, SEQ ID NO: 2308, or 9588 of Table 2.
c. Complex Formation with CasX Protein
[0234] In some embodiments, upon expression of the components of the rAAV vector, a gRNA variant of the disclosure has an improved ability to form an RNP complex with a Class 2, Type V protein and bind a target nucleic acid, including CasX variant proteins comprising any one of the sequences SEQ ID NOS: 190, 197, 348, 351, 355, 484, 9382-9542, and 9607-9609, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto. In some embodiments of the rAAV vector, upon expression, the gRNA variant is complexed as an RNP with a CasX variant protein comprising any one of the sequences SEQ ID NOS: 190, 197, 348, 351, 355, 484, 9382-9542, or 9607-9609, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
[0235] In some embodiments of the rAAV vector, a gRNA variant has an improved ability to form a complex with a CasX variant protein when compared to a reference gRNA, thereby improving its ability to form a cleavage-competent ribonucleoprotein (RNP) complex with the CasX protein, as described in the Examples. Improving ribonucleoprotein complex formation may, in some embodiments, improve the efficiency with which functional RNPs are assembled. In some embodiments, greater than 90%, greater than 93%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% of RNPs comprising a gRNA variant and its targeting sequence are competent for gene editing of a target nucleic acid.
d. gRNA Scaffold 316
[0236] In order to generate a gRNA scaffold with improved characteristics, but that had a scaffold length shorter than 90 nucleotides, a gRNA variant scaffold was designed wherein the gRNA scaffold 174 (SEQ ID NO: 2238) sequence, was modified by introducing one, two, three, four or more mutations at positions selected from the group consisting of U11, U24, A29, and A87. In some embodiments, the gRNA variant comprises a sequence of SEQ ID NO: 2238, or a sequence having at least about 70% sequence identity thereto, and four mutations at positions selected from the group consisting of U11, U24, A29, and A87. In one embodiment of the foregoing, the mutations consist of U11C, U24C, A29C, and A87G, resulting in the gRNA scaffold 316 sequence of SEQ ID NO: 9588, having 89 nucleotides.
[0237] In another embodiments, the gRNA sequence was generated wherein the scaffold 235 sequence (SEQ ID NO: 2292) was modified by a domain swap in which the extended stemloop of gRNA scaffold 174 replaced the extended stemloop of the 235 scaffold, resulting in the gRNA scaffold 316 sequence of SEQ ID NO: 9588, having 89 nucleotides in the scaffold, compared with the 99 nucleotides of gRNA scaffold235. The 316 scaffold was determined to perform comparably or more favorably than gRNA scaffold 174 in editing assays, as described in the Examples. The resulting 316 scaffold had the further advantage in that the extended stemloop did not contain CpG motifs; an enhanced property described more fully, below.
e. Complex Formation with CasX Protein
[0238] Upon delivery of the rAAV to a target cell and expression of the encoded components, the gRNA variant is capable of complexing as an RNP with a CasX protein and binding to the target nucleic acid. In some embodiments, a gRNA variant has an improved ability to form an RNP complex with a CasX protein when compared to a reference gRNA or another gRNA variant from which it was derived. Improving ribonucleoprotein complex formation may, in some embodiments, improve the efficiency with which functional RNPs are assembled. In some embodiments, greater than 90%, greater than 93%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% of RNPs comprising a gRNA variant and its targeting sequence are competent for gene editing or modification of a target nucleic acid.
IV. CRISPR Proteins of the rAAV
[0239] The present disclosure provides rAAV encoding a CRISPR nuclease that have utility in genome editing of eukaryotic cells. In some embodiments, the CRISPR nuclease employed in the genome editing systems is a Class 2, Type V nuclease. Although members of Class 2, Type V CRISPR-Cas systems have differences, they share some common characteristics that distinguish them from the Cas9 systems. Firstly, the Class 2, Type V nucleases possess a single RNA-guided RuvC domain-containing effector but no HNH domain, and they recognize T-rich PAM 5 upstream to the target region on the non-targeted strand, which is different from Cas9 systems which rely on G-rich PAM at 3 side of target sequences. Type V nucleases generate staggered double-stranded breaks distal to the PAM sequence, unlike Cas9, which generates a blunt end in the proximal site close to the PAM. In addition, Type V nucleases degrade ssDNA in trans when activated by target dsDNA or ssDNA binding in cis. In some embodiments, the Type V nucleases of the embodiments recognize a 5-TC PAM motif and produce staggered ends cleaved solely by the RuvC domain. In some embodiments, the Type V nuclease is selected from the group consisting of Cas12a (Cpf1), Cas12b (C2c1), Cas12c (C2c3), Cas12d (CasY), Cas12e (CasX), Cas12f, Cas12g, Cas12h, Cas12i, Cas12j, Cas12k, Cas14, and Cas(D. In some embodiments, the present disclosure provides rAAV encoding a CasX variant protein and one or more gRNAs that upon expression in a transfected cell are able to form an RNP complex and modify a target nucleic acid sequence in eukaryotic cells.
[0240] The term CasX protein, as used herein, refers to a family of proteins, and encompasses all naturally occurring CasX proteins, proteins that share at least 50% identity to naturally occurring CasX proteins, as well as CasX variants possessing one or more improved characteristics relative to a naturally-occurring reference CasX protein, described more fully, below.
[0241] The present disclosure provides highly-modified CasX proteins having multiple mutations relative to one or more reference CasX proteins. Any changes in the amino acid sequence of a reference CasX protein which results in a CasX and that leads to an improved characteristic relative to the reference CasX protein is considered a CasX variant protein of the disclosure, provided the CasX retains the ability to form an RNP with a gRNA and retains nuclease activity.
[0242] CasX proteins of the disclosure comprise at least one of the following domains: a non-target strand binding (NTSB) domain, a target strand loading (TSL) domain, a helical I domain (which is further divided into helical I-I and I-II subdomains), a helical II domain, an oligonucleotide binding domain (OBD, which is further divided into OBD-I and OBD-II subdomains), and a RuvC DNA cleavage domain (which is further divided into RuvC-I and II subdomains). The RuvC domain may be modified or deleted in a catalytically-dead CasX variant, described more fully, below.
[0243] In some embodiments, a CasX variant protein can bind and/or modify (e.g., nick, catalyze a double-strand break, methylate, demethylate, etc.) a target nucleic acid at a specific sequence targeted by an associated gRNA, which hybridizes to a sequence within the target nucleic acid sequence. In some embodiments, the CasX comprises a nuclease domain having double-stranded cleavage activity that generates a double-stranded break within 18-26 nucleotides 5 of a PAM site on the target strand and 10-18 nucleotides 3 on the non-target strand, resulting in overhangs that can facilitate a higher degree of editing efficiency or insertion of a donor template nucleic acid by HDR or HITI repair mechanisms of the host cell, compared to other CRISPR systems.
a. Reference CasX Proteins
[0244] The disclosure provides naturally-occurring CasX proteins (referred to herein as a reference CasX protein), which were subsequently modified to create the CasX variants of the disclosure. For example, reference CasX proteins can be isolated from naturally occurring prokaryotes, such as Deltaproteobacteria, Planctomycetes, or Candidatus sungbacteria species. A reference CasX protein is a type V CRISPR/Cas endonuclease belonging to the CasX (interchangeably referred to as Cas12e) family of proteins that interacts with a guide RNA to form a ribonucleoprotein (RNP) complex.
[0245] In some cases, a reference CasX protein is isolated or derived from Deltaproteobacter. In some embodiments, a reference CasX protein comprises a sequence identical to a sequence of:
TABLE-US-00004 (SEQIDNO:1) 1 MEKRINKIRKKLSADNATKPVSRSGPMKTLLVRVMTDDLKKRLEKRRKKPEVMPQVISNN 61 AANNLRMLLDDYTKMKEAILQVYWQEFKDDHVGLMCKFAQPASKKIDQNKLKPEMDEKGN 121 LTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDEA 181 VTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASFL 241 SKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIARV 301 RMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPVVERRENEVDWWNTINEVKKLIDAKRDM 361 GRVFWSGVTAEKRNTILEGYNYLPNENDHKKREGSLENPKKPAKRQFGDLLLYLEKKYAG 421 DWGKVFDEAWERIDKKIAGLTSHIEREEARNAEDAQSKAVLTDWLRAKASFVLERLKEMD 481 EKEFYACEIQLQKWYGDLRGNPFAVEAENRVVDISGFSIGSDGHSIQYRNLLAWKYLENG 541 KREFYLLMNYGKKGRIRFTDGTDIKKSGKWQGLLYGGGKAKVIDLTFDPDDEQLIILPLA 601 FGTRQGREFIWNDLLSLETGLIKLANGRVIEKTIYNKKIGRDEPALFVALTFERREVVDP 661 SNIKPVNLIGVDRGENIPAVIALTDPEGCPLPEFKDSSGGPTDILRIGEGYKEKQRAIQA 721 AKEVEQRRAGGYSRKFASKSRNLADDMVRNSARDLFYHAVTHDAVLVFENLSRGFGRQGK 781 RTFMTERQYTKMEDWLTAKLAYEGLTSKTYLSKTLAQYTSKTCSNCGFTITTADYDGMLV 841 RLKKTSDGWATTLNNKELKAEGQITYYNRYKRQTVEKELSAELDRLSEESGNNDISKWTK 901 GRRDEALFLLKKRFSHRPVQEQFVCLDCGHEVHADEQAALNIARSWLFLNSNSTEFKSYK 961 SGKQPFVGAWQAFYKRRLKEVWKPNA.
[0246] In some cases, a reference CasX protein is isolated or derived from Planctomycetes. In some embodiments, a reference CasX protein comprises a sequence identical to a sequence of:
TABLE-US-00005 (SEQIDNO:2) 1 MQEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPIS 61 NTSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPAPKNIDQRKLIPVKDGN 121 ERLTSSGFACSQCCQPLYVYKLEQVNDKGKPHTNYFGRCNVSEHERLILLSPHKPEANDE 181 LVTYSLGKFGQRALDFYSIHVTRESNHPVKPLEQIGGNSCASGPVGKALSDACMGAVASF 241 LTKYQDIILEHQKVIKKNEKRLANLKDIASANGLAFPKITLPPQPHTKEGIEAYNNVVAQ 301 IVIWVNLNLWQKLKIGRDEAKPLQRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 361 DGKVFWQNLAGYKRQEALLPYLSSEEDRKKGKKFARYQFGDLLLHLEKKHGEDWGKVYDE 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNENFDDPNLIILPLAFGKRQGREFIWND 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALEVALTFERREVLDSSNIKPMNLIGIDR 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAAKEVEQRRAGGYS 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 961 TWQSFYRKKLKEVWKPAV.
[0247] In some cases, a reference CasX protein is isolated or derived from Candidatus Sungbacteria. In some embodiments, a reference CasX protein comprises a sequence identical to a sequence of
TABLE-US-00006 (SEQIDNO:3) 1 MDNANKPSTKSLVNTTRISDHFGVTPGQVTRVFSFGIIPTKRQYAIIERWFAAVEAARER 61 LYGMLYAHFQENPPAYLKEKFSYETFFKGRPVLNGLRDIDPTIMTSAVFTALRHKAEGAM 121 AAFHTNHRRLFEEARKKMREYAECLKANEALLRGAADIDWDKIVNALRTRLNTCLAPEYD 181 AVIADFGALCAFRALIAETNALKGAYNHALNOMLPALVKVDEPEEAEESPRLRFENGRIN 241 DLPKFPVAERETPPDTETIIRQLEDMARVIPDTAEILGYIHRIRHKAARRKPGSAVPLPQ 301 RVALYCAIRMERNPEEDPSTVAGHELGEIDRVCEKRRQGLVRTPEDSQIRARYMDIISER 361 ATLAHPDRWTEIQFLRSNAASRRVRAETISAPFEGFSWTSNRTNPAPQYGMALAKDANAP 421 ADAPELCICLSPSSAAFSVREKGGDLIYMRPTGGRRGKDNPGKEITWVPGSFDEYPASGV 481 ALKLRLYFGRSQARRMLINKTWGLLSDNPRVFAANAELVGKKRNPODRWKLFFHMVISGP 541 PPVEYLDFSSDVRSRARTVIGINRGEVNPLAYAVVSVEDGQVLEEGLLGKKEYIDOLIET 601 RRRISEYQSREQTPPRDLRQRVRHLODTVLGSARAKIHSLIAFWKGILAIERLDDQFHGR 661 EQKIIPKKTYLANKTGFMNALSFSGAVRVDKKGNPWGGMIEIYPGGISRTCTQCGTVWLA 721 RRPKNPGHRDAMVVIPDIVDDAAATGFDNVDCDAGTVDYGELFTLSREWVRLTPRYSRVM 781 RGTLGDLERAIRQGDDRKSRQMLELALEPQPOWGOFFCHRCGENGQSDVLAATNLARRAI 841 SLIRRLPDTDTPPTP.
b. Class 2, Type V CasX Variant Proteins
[0248] The present disclosure provides Class 2, Type V, CasX variants of a reference CasX protein or variants derived from other CasX variants (interchangeably referred to herein as Class 2, Type V CasX variant, CasX variant or CasX variant protein) for use in the rAAV, wherein the Class 2, Type V CasX variants comprise at least one modification in at least one domain relative to the reference CasX protein, including but not limited to the sequences of SEQ ID NOS:1-3, or at least one modification relative to another CasX variant. Any change in amino acid sequence of a reference CasX protein or to another CasX variant protein that leads to an improved characteristic of the CasX protein is considered a CasX variant protein of the disclosure. For example, CasX variants can comprise one or more amino acid substitutions, insertions, deletions, or swapped domains, or any combinations thereof, relative to a reference CasX protein sequence.
[0249] The CasX variants of the disclosure have one or more improved characteristics compared to a reference CasX protein of SEQ ID NO:1, SEQ ID NO:2 or SEQ ID NO:3. Exemplary improved characteristics are described in WO2020247882A1 and PCT/US20/36505, incorporated by reference herein.
[0250] Exemplary improved characteristics of the CasX variant embodiments include, but are not limited to improved folding of the variant, increased binding affinity to the gRNA, increased binding affinity to the target nucleic acid, improved ability to utilize a greater spectrum of PAM sequences in the editing and/or binding of target nucleic acid, improved unwinding of the target DNA, improved editing activity, improved editing efficiency, improved editing specificity for the target nucleic acid, improved specificity ratio for the target nucleic acid, decreased off-target editing or cleavage, increased percentage of a eukaryotic genome that can be efficiently edited, increased activity of the nuclease, increased target strand loading for double strand cleavage, decreased target strand loading for single strand nicking, increased binding of the non-target strand of DNA, improved protein stability, improved protein:gRNA (RNP) complex stability, and improved fusion characteristics. In particular, the CasX variant proteins of the disclosure have an enhanced ability to efficiently edit and/or bind target DNA, when complexed with a guide RNA scaffold as an RNP, utilizing a PAM TC motif, including PAM sequences selected from TTC, ATC, GTC, or CTC, compared to an RNP of a reference CasX protein and a reference gRNA. In the foregoing, the PAM sequence is located at least 1 nucleotide 5 to the non-target strand of the protospacer having identity with the targeting sequence of the gRNA in an assay system compared to the editing efficiency and/or binding of an RNP comprising the reference CasX protein and reference gRNA in a comparable assay system. In the foregoing embodiments, the one or more of the improved characteristics of the CasX variant is at least about 1.1 to about 100,000-fold improved relative to the reference CasX protein of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3, when assayed in a comparable fashion. In other embodiments, the improvement is at least about 1.1-fold, at least about 2-fold, at least about 5-fold, at least about 10-fold, at least about 50-fold, at least about 100-fold, at least about 500-fold, at least about 1000-fold, at least about 5000-fold, at least about 10,000-fold, or at least about 100,000-fold compared to the reference CasX protein of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3. In some embodiments, an RNP comprising the CasX variant protein and a gRNA variants of the disclosure, at a concentration of 20 pM or less, is capable of cleaving a double stranded DNA target with an efficiency of at least 80%. In some embodiments, the RNP at a concentration of 20 pM or less is capable of cleaving a double stranded DNA target with an efficiency of at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90% or at least 95%. In some embodiments, the RNP at a concentration of 50 pM or less, 40 pM or less, 30 pM or less, 20 pM or less, 10 pM or less, or 5 pM or less, is capable of cleaving a double stranded DNA target with an efficiency of at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90% or at least 95%. These improved characteristics are described in more detail, below.
[0251] In some embodiments, the modification of the CasX variant is a mutation in one or more amino acids of the reference CasX. In other embodiments, the modification is an insertion or substitution of a part or all of a domain from a different CasX protein. Mutations can be introduced in any one or more domains of the reference CasX protein or in a CasX variant to result in a CasX variant, and may include, for example, deletion of part or all of one or more domains, or one or more amino acid substitutions, deletions, or insertions in any domain of the reference CasX protein or the CasX variant from which it was derived.
[0252] In other embodiments, the disclosure provides CasX variants wherein the CasX variants comprise one or more modifications relative to another CasX variant; e.g., CasX variant 515 and 527 is a variant of CasX variant 491 and CasX variants 668 and 672 are variants of CasX 535.
[0253] In some embodiments, a CasX variant protein comprises between 500 and 1500 amino acids, between 700 and 1200 amino acids, between 800 and 1100 amino acids, or between 900 and 1000 amino acids.
c. CasX Variant Proteins with Domains from Multiple Source Proteins
[0254] Also contemplated within the scope of the disclosure are chimeric CasX proteins for use in the rAAV. As used herein, a chimeric CasX protein refers to both a CasX protein containing at least two domains from different sources, as well a CasX protein containing at least one domain that itself is chimeric. Accordingly, in some embodiments, a chimeric CasX protein is one that includes at least two domains isolated or derived from different sources, such as from two different naturally occurring CasX proteins, (e.g., from two different CasX reference proteins), or from two different CasX variant proteins. In other embodiments, the chimeric CasX protein is one that contains at least one domain that is a chimeric domain, e.g., in some embodiments, part of a domain comprises a substitution from a different CasX protein (from a reference CasX protein, or another CasX variant protein).
[0255] In some embodiments, a CasX variant protein of the disclosure comprises a modification, and the modification is an insertion or substitution of a part or all of a domain from a different CasX protein. In particular embodiments, the CasX variants 514-840 and SEQ ID NOS: 9382-9542 and 9607-9609 have a NTSB and helical 1-I domain derived from the sequence of SEQ ID NO: 1, while the other domains are derived from SEQ ID NO: 2, it being understood that the variants may have 1, 2, 3, 4 or more amino acid changes at select locations. In one embodiment, the CasX variant of 494 has a NTSB domain derived from the sequence of SEQ ID NO: 1, while the other domains are derived from SEQ ID NO: 2.
[0256] In some embodiments, a CasX variant protein for use in the rAAV comprises at least one chimeric domain comprising a first part from a first CasX protein and a second part from a second, different CasX protein. As used herein, a chimeric domain refers to a domain containing at least two parts isolated or derived from different sources, such as two naturally occurring proteins or portions of domains from two reference CasX proteins, or even portions of two CasX variant proteins. The at least one chimeric domain can be any of the NTSB, TSL, helical I, helical II, OBD or RuvC domains as described herein. As an example of the foregoing, a chimeric RuvC domain comprises amino acids 660 to 823 of SEQ ID NO: 1 and amino acids 921 to 978 of SEQ ID NO: 2. As an alternative example of the foregoing, a chimeric RuvC domain comprises amino acids 647 to 810 of SEQ ID NO: 2 and amino acids 934 to 986 of SEQ ID NO: 1. In the case of split or non-contiguous domains such as helical I, RuvC and OBD, a portion of the non-contiguous domain can be replaced with the corresponding portion from any other source. For example, the helical I-I domain in SEQ ID NO: 2 can be replaced with the corresponding helical I-I sequence from SEQ ID NO: 1, and the like. Domain sequences from reference CasX proteins, and their coordinates, are shown in Table 4.
[0257] Representative examples of chimeric CasX proteins of the disclosure include the CasX variants of SEQ ID NOS: 184-190, 197, 484, 9382-9542 and 9607-9609.
TABLE-US-00007 TABLE 3 Domain coordinates in Reference CasX proteins Coordinates in Coordinates in Domain Name SEQ ID NO: 1 SEQ ID NO: 2 OBD-I 1-55 1-57 helical I-I 56-99 58-101 NTSB 100-190 102-191 helical I_II 191-331 192-332 helical II 332-508 333-500 OBD_II 509-659 501-646 RuvC-I 660-823 647-810 TSL 824-933 811-920 RuvC-II 934-986 921-978
[0258] Exemplary domain sequences are provided in Table 4 below.
TABLE-US-00008 TABLE4 ExemplaryDomainSequencesinReferenceCasXproteins Deltaproteobactersp.(referenceCasXofSEQIDNO:1) SEQ ID Domain Sequence 567 OBD-I EKRINKIRKKLSADNATKPVSRSGPMKTLLVRVMTDDLKKRLEKRRKKPEVMPQ 568 helicalI-I VISNNAANNLRMLLDDYTKMKEAILQVYWQEFKDDHVGLMCKFA 569 NTSB QPASKKIDQNKLKPEMDEKGNLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNV AEHEKLILLAQLKPEKDSDEAVTYSLGKFGQ 570 helicalI-II RALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASFLSKYQDIIIEH QKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIARVRMWVNLNLWQ KLKLSRDDAKPLLRLKGFPSF 571 helicalII PVVERRENEVDWWNTINEVKKLIDAKRDMGRVFWSGVTAEKRNTILEGYNYLPNENDHKK REGSLENPKKPAKRQFGDLLLYLEKKYAGDWGKVFDEAWERIDKKIAGLTSHIEREEARN AEDAQSKAVLTDWLRAKASFVLERLKEMDEKEFYACEIQLQKWYGDLRGNPFAVEAE 572 OBD-II NRVVDISGFSIGSDGHSIQYRNLLAWKYLENGKREFYLLMNYGKKGRIRFTDGTDIKKSG KWQGLLYGGGKAKVIDLTFDPDDEQLIILPLAFGTRQGREFIWNDLLSLETGLIKLANGR VIEKTIYNKKIGRDEPALFVALTFERREVVD 573 RuvC-I PSNIKPVNLIGVDRGENIPAVIALTDPEGCPLPEFKDSSGGPTDILRIGEGYKEKORAIQ AAKEVEQRRAGGYSRKFASKSRNLADDMVRNSARDLFYHAVTHDAVLVFENLSRGFGROG KRTFMTERQYTKMEDWLTAKLAYEGLTSKTYLSKTLAQYTSKTC 574 TSL SNCGFTITTADYDGMLVRLKKTSDGWATTLNNKELKAEGQITYYNRYKRQTVEKELSAEL DRLSEESGNNDISKWTKGRRDEALFLLKKRFSHRPVQEQFVCLDCGHEVH 575 RuvC-II ADEQAALNIARSWLFLNSNSTEFKSYKSGKQPFVGAWQAFYKRRLKEVWKPNA Planctomycetessp.(ReferenceCasXofSEQIDNO:2) SEQ ID Domain Sequence 576 OBD-I QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQ 577 helicalI-II PISNTSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVA 578 NTSB QPAPKNIDORKLIPVKDGNERLTSSGFACSQCCQPLYVYKLEQVNDKGKPHTNYFGRCNV SEHERLILLSPHKPEANDELVTYSLGKFGQ 579 helicalI-II RALDFYSIHVTRESNHPVKPLEQIGGNSCASGPVGKALSDACMGAVASFLTKYQDIILEH QKVIKKNEKRLANLKDIASANGLAFPKITLPPQPHTKEGIEAYNNVVAQIVIWVNLNLWQ KLKIGRDEAKPLQRLKGFPSF 580 helicalII PLVERQANEVDWWDMVCNVKKLINEKKEDGKVFWQNLAGYKRQEALLPYLSSEEDRKKGK KFARYQFGDLLLHLEKKHGEDWGKVYDEAWERIDKKVEGLSKHIKLEEERRSEDAQSKAA LTDWLRAKASFVIEGLKEADKDEFCRCELKLQKWYGDLRGKPFAIEAE 581 OBD-II NSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGKLRFKKIKPEAFEANRFYTVI NKKSGEIVPMEVNENFDDPNLIILPLAFGKROGREFIWNDLLSLETGSLK LANGRVIEKTLYNRRTRQDEPALFVALTFERREVLD 582 RuvC-I SSNIKPMNLIGIDRGENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKORTIQ AAKEVEQRRAGGYSRKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQG KRTEMAERQYTRMEDWLTAKLAYEGLPSKTYLSKTLAQYTSKTC 583 TSL SNCGFTITSADYDRVLEKLKKTATGWMTTINGKELKVEGQITYYNRYKRONVVKDLSVEL DRLSEESVNNDISSWTKGRSGEALSLLKKRFSHRPVQEKFVCLNCGFETH 584 RuvC-II ADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVETWQSFYRKKLKEVWKPAV
d. Exemplary CasX Variants
[0259] In some embodiments, a CasX variant protein for use in the rAAV comprises a sequence set forth in Table 5 (SEQ ID NOS: 190, 197, 348, 351, 355, and 484). In some embodiments, a CasX variant protein for use in the rAAV comprises a sequence of SEQ ID NO: 197. In some embodiments, a CasX variant protein for use in the rAAV comprises a sequence of SEQ ID NO: 484. In other embodiments, a CasX variant protein comprises a sequence at least 70% identical, at least 75% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical to a sequence selected from the group consisting of the sequences as set forth in SEQ ID NOS: 137-512, 9382-9542, and 9607-9609, wherein the variant retains the functional properties of the ability to form an RNP with a gRNA and to bind and cleave a target nucleic acid. In some embodiments, a CasX variant protein comprises a sequence selected from the group consisting of SEQ ID NOS: 9382-9542, and 9607-9609, or a sequence having at least about 70%, at least about 80%, at least about 90%, or at least about 95%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity thereto, wherein the variant retains the functional properties of the ability to form an RNP with a gRNA and to bind and cleave a target nucleic acid. In some embodiments, a CasX variant protein comprises a sequence selected from the group consisting of SEQ ID NOS: 9382-9542, and 9607-9609. In other embodiments, a CasX variant comprises a sequence at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 81% identical, at least 82% identical, at least 83% identical, at least 84% identical, at least 85% identical, at least 86% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, or at least 99.5% identical to a sequence selected from the group consisting of SEQ ID NOS: 197, 484, 9382-9542, and 9607-9609, and comprises a P at position 793 relative to SEQ ID NO: 2, wherein the CasX variant protein retains the functional properties of the ability to form an RNP with a gRNA and retains nuclease activity. In some embodiments, a CasX variant comprises a P at position 793 relative to SEQ TD NO: 2. In some embodiments, a CasX variant protein comprises a sequence of SEQ ID NO: 5. In some embodiments, a CasX variant protein consists of a sequence of SEQ ID NO: 5. As the results of the Examples demonstrate, despite changes in amino acid composition amongst the variants, the CasX variants retain the functional properties of the ability to form an RNP with a gRNA and retains nuclease activity, underscoring that the variants collectively have the ability to be utilized for a common use; the genetic editing of DNA.
TABLE-US-00009 TABLE5 CasXVariantSequences SEQ IDNO Variant DescriptionofVariant 190 491 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISNTSR ANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKGNLTTAG FACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDEAVTYSLGKF GQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASFLSKYQDIIIEHQ KVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIARVRMWVNLNLWQKLKL SRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKEDGKVFWQNLAGYKRQEAL RPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDEAWERIDKKVEGLSKHIKLEEE RRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCELKLQKWYGDLRGKPFAIEAENSIL DISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGKLRFKKIKPEAFEANRFYTVINKKSGEI VPMEVNENFDDPNLIILPLAFGKRQGREFIWNDLLSLETGSLKLANGRVIEKTLYNRRTRQDE PALFVALTFERREVLDSSNIKPMNLIGVDRGENIPAVIALTDPEGCPLSRFKDSLGNPTHILR IGESYKEKQRTIQAKKEVEQRRAGGYSRKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFE NLSRGFGRQGKRTEMAERQYTRMEDWLTAKLAYEGLSKTYLSKTLAQYTSKTCSNCGFTITSA DYDRVLEKLKKTATGWMTTINGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDIS SWTKGRSGEALSLLKKRFSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQT NKTTGNTDKRAFVETWQSFYRKKLKEVWKPAV 197 515 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISNTSR ANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKGNLTTAG FACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDEAVTYSLGKF GQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASFLSKYQDIIIEHQ KVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIARVRMWVNLNLWQKLKL SRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKEDGKVFWQNLAGYKRQEAL RPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDEAWERIDKKVEGLSKHIKLEEE RRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCELKLQKWYGDLRGKPFAIEAENSIL DISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGKLRFKKIKPEAFEANRFYTVINKKSGEI VPMEVNENFDDPNLIILPLAFGKRQGREFIWNDLLSLETGSLKLANGRVIEKTLYNRRTRQDE PALFVALTFERREVLDSSNIKPMNLIGVDRGENIPAVIALTDPEGCPLSRFKDSLGNPTHILR IGESYKEKQRTIQAKKEVEQRRAGGYSRKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFE NLSRGFGRQGKRTFMAERQYTRMEDWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITS ADYDRVLEKLKKTATGWMTTINGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDI SSWTKGRSGEALSLLKKRFSHRPVQEKFVCLNCGFETHADEQAALNIARSWLELRSQEYKKYQ TNKTTGNTDKRAFVETWQSFYRKKLKEVWKPAV 348 668 QEIKRINKIRRRLVKDSNTKKAGKTRGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISNTS RANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKGNLTTA GFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDEAVTYSLGK FGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASSPVGKALSDACMGTIASFLSKYQDIIIEH QKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIARVRMWVNLNLWQKLK LSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKEDGKVFWQNLAGYKRQEA LRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDEAWERIDKKVEGLSKHIKLEE ERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCELKLQKWYGDLRGKPFAIEAENSI LDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGKLRFKKIKPEAFEANRFYTVINKKSGE IVPMEVNENFDDPNLIILPLAFGKRQGREFIWNDLLSLETGSLKLANGRVIEKTLYNRRTRQD EPALFVALTFERREVLDSSNIKPMNLIGVDRGENIPAVIALTDPEGCPLSRFKDSLGNPTHIL RIGESYKEKQRTIQAKKEVEQRRAGGYSRKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIF ENLSRGFGRQGKRTFMAERQYTRMEDWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTIT SADYDRVLEKLKKTATGWMTTINGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNND ISSWTKGRSGEALSLLKKRFSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKY QTNKTTGNTDKRAFVETWQSFYRKKLKEVWKPAV 351 672 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISNTSR ANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKGNLTTAG FACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLIKLAQLKPEKDSDEAVTYSLGKF GQRALDFYSIHVTKESTHPVKPLAQIAGNRYASSPVGKALSDACMGTIASFLSKYQDIIIEHQ KVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIARVRMWVNLNLWQKLKL SRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKEDGKVFWQNLAGYKRQEAL RPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDEAWERIDKKVEGLSKHIKLEEE RRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCELKLQKWYGDLRGKPFAIEAENSIL DISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGKLRFKKIKPEAFEANRFYTVINKKSGEI VPMEVNENFDDPNLIILPLAFGKRQGREFIWNDLLSLETGSLKLANGRVIEKTLYNRRTRQDE PALFVALTFERREVLDSSNIKPMNLIGVDRGENIPAVIALTDPEGCPLSRFKDSLGNPTHILR IGESYKEKQRTIQAKKEVEQRRAGGYSRKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFE NLSRGFGRQGKRTEMAERQYTRMEDWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITS ADYDRVLEKLKKTATGWMTTINGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDI SSWTKGRSGEALSLLKKRFSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQ TNKTTGNTDKRAFVETWQSFYRKKLKEVWKPAV 355 676 QEIKRINKIRRRLVKDSNTKKAGKTRGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISNTS RANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKGNLTTA GFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLIKLAQLKPEKDSDEAVTYSLGK FGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASSPVGKALSDACMGTIASFLSKYQDIIIEH QKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIARVRMWVNLNLWQKLK LSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKEDGKVFWQNLAGYKRQEA LRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDEAWERIDKKVEGLSKHIKLEE ERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCELKLQKWYGDLRGKPFAIEAENSI LDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGKLRFKKIKPEAFEANRFYTVINKKSGE IVPMEVNENFDDPNLIILPLAFGKRQGREFIWNDLLSLETGSLKLANGRVIEKTLYNRRTRQD EPALFVALTFERREVLDSSNIKPMNLIGVDRGENIPAVIALTDPEGCPLSRFKDSLGNPTHIL RIGESYKEKQRTIQAKKEVEQRRAGGYSRKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIF ENLSRGFGRQGKRTFMAERQYTRMEDWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTIT SADYDRVLEKLKKTATGWMTTINGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNND ISSWTKGRSGEALSLLKKRFSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKY QTNKTTGNTDKRAFVETWQSFYRKKLKEVWKPAV 484 812 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISNTSR ANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKGNLTTAG FACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDEAVTYSLGKF GQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASFLSKYQDIIIEHQ KVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIARVRMWVNLNLWQKLKL SRDDAKPLLRLKKFPSFPLVERQANEVDWWDMVCNVKKLINEKKEDGKVFWQNLAGYKRQEAL RPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDEAWERIDKKVEGLSKHIKLEEE RRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCELKLQKWYGDLRGKPFAIEAENSIL DISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGKLRFKKIKPEAFEANRFYTVINKKSGEI VPMEVNENFDDPNLIILPLAFGKRQGREFIWNDLLSLETGSLKLANGRVIEKTLYNRRTRQDE PALFVALTFERREVLDSSNIKPMNLIGVDRGENIPAVIALTDPEGCPLSRFKDSLGNPTHILR IGESYKEKQRTIQAKKEVEQRRAGGYSRKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFE NLSRGFGRQGKRTEMAERQYTRMEDWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITS ADYDRVLEKLKKTATGWMTTINGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDI SSWTKGRSGEALSLLKKRFSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQ TNKTTGNTDKRAFVETWQSFYRKKLKEVWKPAV
[0260] Further CasX variants contemplated for use in the vectors of the disclosure are described in International Publication Nos. WO2020247882 and WO2022120095, which are hereby incorporated by reference in their entirety.
e. CasX Variants Derived from Other CasX Variants
[0261] In further iterations of the generation of variant proteins, a variant protein can be utilized to generate additional CasX variants of the disclosure. For example, CasX 119 (SEQ ID NO: 124), CasX 491 (SEQ ID NO: 190), and CasX 515 (SEQ ID NO: 197) are exemplary variant proteins that are modified to generate additional CasX variants of the disclosure having improvements or additional properties relative to a reference CasX or CasX variants from which they were derived. CasX 119 contains a substitution of L379R, a substitution of A708K and a deletion of P at position 793 of SEQ ID NO: 2. CasX 491 contains an NTSB and Helical 1B domain swap from SEQ ID NO: 1. CasX 515 was derived from CasX 491 by insertion of P at position 793 (relative to SEQ ID NO: 2) and was used to create additional CasX variants. For example, CasX 668 has an insertion of R at position 26 and a substitution of G223S relative to CasX 515. CasX 672 has substitutions of L169K and G223S relative to CasX 515. CasX 676 has substitutions of L169K and G223S and an insertion of R at position 26 relative to CasX 515. For purposes of the disclosure, the sequences of the domains of CasX 515 are provided in Table 6 and include an OBD-I domain having the sequence of SEQ ID NO: 585, an OBD-II domain having the sequence of SEQ ID NO: 590, NTSB domain having the sequence of SEQ ID NO: 587, a helical I-I domain having the sequence of SEQ ID NO: 586, a helical I-II domain having the sequence of SEQ ID NO: 588, a helical II domain having the sequence of SEQ ID NO: 589, a RuvC-I domain having the sequence of SEQ ID NO: 591, a RuvC-II domain having the sequence of SEQ ID NO: 593, and a TSL domain having the sequence of SEQ ID NO: 592.
[0262] Mutations can be introduced in any one or combinations of domains of the CasX variant to result in a CasX variant. These alterations can be amino acid insertions, deletions, substitutions, or any combinations thereof. Any amino acid can be substituted for any other amino acid in the substitutions described herein. The substitution can be a conservative substitution (e.g., a basic amino acid is substituted for another basic amino acid). The substitution can be a non-conservative substitution (e.g., a basic amino acid is substituted for an acidic amino acid or vice versa). For example, a proline in a CasX protein can be substituted for any of arginine, histidine, lysine, aspartic acid, glutamic acid, serine, threonine, asparagine, glutamine, cysteine, glycine, alanine, isoleucine, leucine, methionine, phenylalanine, tryptophan, tyrosine or valine to generate a CasX variant protein of the disclosure.
[0263] In some embodiments, a CasX variant comprises two mutations relative to the CasX protein from which it was derived. In some embodiments, a CasX variant comprises three mutations relative to the CasX protein from which it was derived. In some embodiments, a CasX variant comprises 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mutations relative to the CasX protein from which it was derived. In some embodiments, the 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mutations are made in locations of the CasX protein sequence separated from one another. In other embodiments, the 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mutations can be made in adjacent amino acids in the CasX protein sequence. In some embodiments, a CasX variant comprises two or more mutations relative to two or more different CasX proteins from which they were derived. The methods utilized for the design and creation of the CasX variant are described below, including the methods of the Examples.
[0264] Suitable mutagenesis methods for generating CasX variant proteins of the disclosure may include, for example, random mutagenesis, site-directed mutagenesis, Markov Chain Monte Carlo (MCMC)-directed evolution, staggered extension PCR, gene shuffling, rational design, or domain swapping (described in PCT/US2021/061673 and WO2020247882A1, incorporated by reference herein). In some embodiments, the CasX variant are designed, for example by selecting multiple desired mutations in a CasX variant identified, for example, using the approaches described in the Examples. In certain embodiments, the activity of the CasX variant protein prior to mutagenesis is used as a benchmark against which the activity of one or more resulting CasX variant are compared, thereby measuring improvements in function of the CasX variant.
k. CasX Variants Derived from CasX 515 (SEQ ID NO: 197)
[0265] The present disclosure provides highly-modified CasX variant proteins having multiple mutations relative to CasX 515. The mutations can be in one or more domains of the parental CasX 515 from which it was derived. The CasX domains and their positions, relative to CasX 515 (SEQ ID NO: 197) are presented in Table 5.
TABLE-US-00010 TABLE6 CasX515domainsequences Domain SEQIDNO AminoAcidSequence OBD-I 585 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRK KPENIPQ HelicalI-I 586 PISNTSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVA NTSB 587 QPASKKIDQNKLKPEMDEKGNLTTAGFACSQCGQPLFVYKLEQVSEKGK AYTNYFGRCNVAEHEKLILLAQLKPEKDSDEAVTYSLGKFGQ HelicalI-II 588 RALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKE GVDAYNEVIARVRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSF HelicalII 589 PLVERQANEVDWWDMVCNVKKLINEKKEDGKVFWQNLAGYKRQEALRPY LSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDEAWERIDKKVE GLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRC ELKLQKWYGDLRGKPFAIEAE OBD-II 590 NSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGKLRFKKIKPE AFEANRFYTVINKKSGEIVPMEVNENEDDPNLIILPLAFGKROGREFIW NDLLSLETGSLKLANGRVIEKTLYNRRTRQDEPALEVALTFERREVLD RuvC-I 591 SSNIKPMNLIGVDRGENIPAVIALTDPEGCPLSREKDSLGNPTHILRIG ESYKEKQRTIQAKKEVEQRRAGGYSRKYASKAKNLADDMVRNTARDLLY YAVTQDAMLIFENLSRGFGRQGKRTEMAERQYTRMEDWLTAKLAYEGLP SKTYLSKTLAQYTSKTC TSL 592 SNCGFTITSADYDRVLEKLKKTATGWMTTINGKELKVEGQITYYNRYKR QNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKRFSHRPVQE KFVCLNCGFETH RuvC-II 593 ADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVETWQSFYRKK LKEVWKPAV
[0266] In some embodiments of the CasX variant described herein, the approach to design the CasX variant utilizes a directed evolution method adapted from a Markov Chain Monte Carlo (MCMC)-directed evolution simulation (Biswas N., et al. Coupled Markov Chain Monte Carlo for high-dimensional regression with Half-t priors. arViV: 2012.04798v2 (2021)), as described in the Examples.
[0267] In further iterations of the generation of the CasX variant proteins, CasX 515 protein can be mutagenized to generate sequences resulting in amino acid substitutions, deletions, or insertions at one or more positions in one or more domains of the parental CasX 515 protein that are screened to identity CasX variants having improved or enhanced characteristics. Exemplary methods used to generate and evaluate CasX variants derived from the CasX 515 protein are described in the Examples. In some embodiments, the resulting mutagenized sequences are screened to identify those having enhanced nuclease activity. In other embodiments, the mutagenized sequences are screened to identify those having enhanced editing specificity and reduced off-target editing. In other embodiments, the mutagenized sequences are screened to identify those having enhanced PAM utilization; i.e., the ability to utilize non-canonical PAM sequences. In still other embodiments, the mutagenized sequences are screened to identify those having improved properties of any two or three of the foregoing categories; i.e., increased nuclease activity, increased specificity (reduced off-target editing), and enhanced PAM utilization. In other embodiments, libraries of sequence variants having one, two, three or more mutations at select positions relative to a parental CasX protein can be generated and screened in assays such as an E. coli CcdB toxin assay or a multiplexed pooled approach using a PASS assay to identify those CasX variants that had improved nuclease activity, improved specificity, and/or increased PAM utilization compared to the cleavage of the E. coli nucleic acid compared to the parental CasX 515 protein, as described in the Examples. In addition, the CasX variant can be screened for increased percentage of a eukaryotic genome that can be efficiently edited, improved ability to form cleavage-competent RNP with an gRNA, and improved stability of an RNP complex. In some embodiments, the improved characteristic compared to the parental CasX 515 is at least about 0.1-fold improved, at least about 0.5-fold improved, at least about 1-fold improved, at least about 1-fold improved, at least about 1-fold improved, at least about 1.5-fold improved, at least about 2-fold improved, at least about 3-fold improved, at least about 4-fold improved, at least about 5-fold improved, at least about 6-fold improved, at least about 7-fold improved, at least about 8-fold improved, at least about 9-fold improved, at least about 10-fold improved, or any integer in between the foregoing. In some embodiments, the characteristics are assayed in an in vitro assay.
[0268] In some embodiments, the disclosure provides CasX variants derived from CasX 515 (SEQ ID NO: 197) comprising two or more modifications; an insertion, a deletion, or a substitution of amino acid(s) in one or more domains (see Table 6 for CasX 515 domain sequences). In some embodiments, the disclosure provides CasX variant proteins comprising a pair of mutations relative to CasX 515 (SEQ ID NO: 9590) as depicted in Table 71, or further variations thereof. In some embodiments, a CasX variant comprising two or more modifications comprises a sequence selected from the group consisting of SEQ ID NOS: 9382-9542, and 9607-9609, or a sequence having at least about 70%, at least about 80%, at least about 90%, or at least about 95%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity thereto. In a particular approach, as detailed in Example 38, single mutations of CasX 515 (SEQ ID NO: 9590) that demonstrated enhanced activity and/or specificity, were selected based on locations deemed to be potentially complementary, and combined (i.e., having two or three mutations) to make CasX variants that were then screened for activity and specificity in in vitro assays. The positions of the mutations within domains of CasX are described in detail in Table 72 in the Examples, below.
[0269] In some embodiments, the CasX variant derived from CasX 515 for use in the rAAV comprises a pair of mutations selected from the group consisting of 4.I.G & 64.R.Q, 4.I.G & 169.L.K, 4.I.G & 169.L.Q, 4.I.G & 171.A.D, 4.I.G & 171.A.Y, 41G & 171.A.S, 41G & 224.G.T, 4.I.G & 304.M.T, 4.1G & 398.Y.T, 4.I.G & 826.V.M, 4.I.G & 887.T.D, 4.I.G & 891.S.Q, 5.-.G & 64.R.Q, 5.-.G & 169.L.K, 5.-.G & 169.L.Q, 5.-.G & 171.A.D, 5.-.G & 171.A.Y, 5.-.G & 171.A.S, 5.-.G & 224.G.T, 5.-.G & 304.M.T, 5.-.G & 398.Y.T, 5.-.G & 826.V.M, 5.-.G & 887.T.D, 5.-.G & 891.S.Q, 9.K.G & 64.R.Q, 9.K.G & 169.L.K, 9.K.G & 169.L.Q, 9.K.G & 171.A.D, 9.K.G & 171AY, 9.K.G & 171.A.S, 9.K.G & 224.G.T, 9.K.G & 304.M.T, 9.K.G & 398.Y.T, 9.K.G & 826.V.M, 9.K.G & 887.T.D, 9.K.G & 891.S.Q, 27.-.R & 64.R.Q, 27.-.R & 169.L.K, 27.-.R & 169.L.Q, 27.-.R & 171.A.D, 27.-.R & 171AY, 27.-.R & 171.A.S, 27.-.R & 224.G.T, 27.-.R & 304.M. T, 27.-.R & 398.Y. T, 27.-.R & 826.V.M, 27.-.R & 887.T.D, 27.-.R & 891.S.Q, 35.R.P & 64.R.Q, 35.R.P & 169.L.K, 35.R.P & 169.L.Q, 35.R.P & 171.AD,35RP&71 AY, 35.R.P & 171.A.S, 35.R.P & 224.G.T, 35.R.P & 304.M.T, 35.R.P & 398.Y.T, 35.R.P & 826.V.M, 35.R.P & 887.T.D, 35.R.P & 891.S.Q, 887.T.D & 891.S.Q, 64.R.Q & 169.L.K, 64.R.Q & 169.L.Q, 64.R.Q & 171.A.D, 64.R.Q & 171.AY, 64.R.Q & 171.A.S, 64.R.Q & 224.G.T, 64.R.Q & 304.M.T, 64.R.Q & 398.Y.T, 64.R.Q & 826.V.M, 64.R.Q & 887.T.D, 64.R.Q & 891.S.Q, 169.L.K & 171.A.D, 169.L.K & 171AY, 169.L.K & 171.A.S, 169.L.K & 224.G.T, 169.L.K & 304.M.T, 169.L.K & 398.Y.T, 169.L.K & 826.V.M, 169.L.K & 887.T.D, 169.L.K & 891.S.Q, 169.L.Q & 171.A.D, 169.L.Q & 171.A.Y, 169.L.Q & 171.A.S, 169.L.Q & 224.G.T, 169.L.Q & 304.M.T, 169.L.Q & 398.Y.T, 169.L.Q & 826.V.M, 169.L.Q & 887.T.D, 169.L.Q & 891.S.Q, 171.A.D & 224.G.T, 171.A.D & 304.M.T, 171.A.D & 398.Y.T, 171AD & 826.V.M, 171.A.D & 887.T.D, 171AD & 891.S.Q, 171.A.Y & 224.G.T, 171.A.Y & 304.M.T, 171.A.Y & 398.Y.T, 171.A.Y & 826.V.M, 171.A.Y & 887.T.D, 171.A.Y & 891.S.Q, 171.A.S & 224.G.T, 171.A.S & 304.M.T, 171.A.S & 398.Y.T, 171.A.S & 826.V.M, 171.A.S & 887.T.D, 171.A.S & 891.S.Q, 4.1.G& 35.R.P, 224.G.T & 304.M.T, 224.G.T & 398.Y.T, 224.G.T & 826.V.M, 224.G.T & 887.T.D, 224.G.T & 891.S.Q, 5.-.G & 35.R.P, 4.I.G & 27.-.R, 304.M.T & 398.Y.T, 304.M.T & 826.V.M, 304.M.T & 887.T.D, 304.M.T & 891.S.Q, 9.K.G & 35.R.P, 5.-.G & 27.-.R, 41G & 9.K.G, 398.Y.T & 826.V.M, 398.Y.T & 887.T.D, 398.Y.T & 891.S.Q, 27.-.R & 35.R.P, 9.K.G & 27.-.R, 5.-.G & 9.K.G, 41G & 5.-.G, 826.V.M & 887.T.D, 826.V.M & 891.S.Q, 5.K.G & 27.-.R, 5.K.G & 169.L.K, 5.K.G & 171.A.D, 5.K.G & 304.M.T, 5.K.G & 398.Y.T, 5.K.G & 891.S.Q, 6.-.G & 27.-.R, 6.-.G & 169.L.K, 6.-.G & 171.A.D, 6.-.G & 304.M.T, 6.-.G & 398.Y.T, 6.-.G & 891.S.Q, 304.M.W & 27.-.R, 304.M.W & 169.L.K, 304.M.W & 171.A.D, 304.M.W & 398.Y.T, 304.M.W & 891.S.Q, 481.E.D & 27.-.R, 481.E.D & 169.L.K, 481.E.D & 171.A.D, 481.E.D & 304.M.T, 481.E.D & 398.Y.T, 481.E.D & 891.S.Q, 698.S.R & 27.-.R, 698.S.R & 169.L.K, 698.S.R & 171.A.D, 698.S.R & 304.M.T, 698.S.R & 398.Y.T, and 698.S.R & 891.S.Q, as provided in Table 22, wherein the position of the mutations is relative to the CasX sequence of SEQ ID NO: 9590. In some embodiments, the CasX variant comprises one or more mutations from Table 22, wherein the one or more mutations result in an improved characteristic when expressed from an rAAV in a target cell compared to unmodified CasX 515 (SEQ ID NO: 197). In some embodiments, the improved characteristics is determined in an in vitro assay comprising a target nucleic acid, with the CasX complexed with a gRNA having a targeting sequence complementary to the target nucleic acid, compared to the unmodified parental CasX 515 under comparable conditions. In some embodiments, the improved characteristic is decreased off-target editing (or increased editing specificity), e.g., as shown in Table 76. In some embodiments, the improved characteristic is increased on-target editing, e.g., as shown in Table 75. In some embodiments, the improved characteristic is increased specificity ratio, e.g., as shown in Table 77.
[0270] In some embodiments, the CasX variant for use in an rAAV comprises three mutations in the sequence of CasX 515 (SEQ ID NO: 9590), wherein the three mutations are selected from the group consisting of 27.-.R, 169.L.K, and 329.G.K; 27.-.R, 171.A.D, and 224.G.T; and 35.R.P, 171.A.Y, and 304.M.T, wherein the mutations result in an improved characteristic compared to unmodified CasX 515.
[0271] In some embodiments, a CasX variant for use in an rAAV is selected from the group consisting of SEQ ID NOS: 9385, 9391, 9393, 9401, 9409, 9417, 9419, 9423, 9429, 9443, 9444, 9447, 9449, 9450, 9452, 9453, 9455, 9456, 9458, 9462, 9466, 9469, 9470, 9472, 9478, 9483, 9485, 9491, 9495, 9499, 9501, 9512, 9513, 9517, 9519, 9521, 9536, 9542, 9607, and 9609, wherein the CasX variant exhibits improved editing activity of a target nucleic acid compared to the unmodified parental CasX 515. In some embodiments, the improved characteristics is determined in an in vitro assay, complexed with a gRNA having a targeting sequence complementary to the target nucleic acid, compared to the unmodified parental CasX 515 and assayed under comparable conditions.
[0272] In some embodiments, a CasX variant for use in an rAAV is selected from the group consisting of SEQ ID NOS: 9385, 9386, 9388, 9390, 9409, 9412, 9417, 9432, 9433, 9434, 9436, 9437, 9438, 9440, 9441, 9443, 9444, 9446, 9447, 9448, 9450, 9452, 9455, 9459, 9464, 9466, 9468, 9469, 9470, 9472, 9474, 9478, 9479, 9480, 9481, 9486, 9487, 9488, 9492, 9493, 9496, 9509, 9512, 9516, 9517, 9519, 9521, 9522, 9529, 9536, 9542, 9608, and 9609, wherein the CasX variant exhibits improved editing specificity of a target nucleic acid compared to the unmodified parental CasX 515, In some embodiments, the improved characteristics is determined in an in vitro assay, complexed with a gRNA having a targeting sequence complementary to the target nucleic acid, compared to the unmodified parental CasX 515 and assayed under comparable conditions.
[0273] In some embodiments, a CasX variant for use in an rAAV is selected from the group consisting of SEQ ID NOS: 9385, 9409, 9417, 9443, 9444, 9447, 9450, 9452, 9455, 9466, 9469, 9470, 9472, 9478, 9512, 9513, 9517, 9519, 9521, 9536, 9542, and 9609, wherein the CasX variant exhibits improved editing activity and specificity of a target nucleic acid compared to the unmodified parental CasX 515. In some embodiments, the improved characteristics is determined in an in vitro assay, complexed with a gRNA having a targeting sequence complementary to the target nucleic acid, compared to the unmodified parental CasX 515 and assayed under comparable conditions.
[0274] In some embodiments, a CasX variant for use in an rAAV is selected from the group consisting of SEQ ID NOS: 9385, 9386, 9388, 9390, 9393, 9409, 9412, 9417, 9432, 9433, 9434, 9436, 9437, 9438, 9440, 9441, 9443, 9444, 9446, 9447, 9448, 9450, 9452, 9455, 9459, 9464, 9466, 9468, 9469, 9470, 9472, 9474, 9478, 9479, 9480, 9481, 9483, 9486, 9488, 9491, 9492, 9493, 9495, 9496, 9509, 9512, 9513, 9516, 9517, 9519, 9521, 9522, 9529, 9536, 9542, 9608, and 9609, wherein the CasX variant exhibits improved specificity ratio compared to the unmodified parental CasX 515. In some embodiments, the improved characteristics is determined in an in vitro assay, complexed with a gRNA having a targeting sequence complementary to the target nucleic acid, compared to the unmodified parental CasX 515 and assayed under comparable conditions.
[0275] In some embodiments, a CasX variant for use in an rAAV is selected from the group consisting of SEQ ID NOS: 9385, 9393, 9409, 9417, 9443, 9444, 9447, 9450, 9452, 9455, 9466, 9469, 9470, 9472, 9478, 9483, 9491, 9495, 9512, 9513, 9517, 9519, 9521, 9536, 9542, and 9609, wherein the CasX variant exhibits improved editing activity and improved specificity ratio compared to the unmodified parental CasX 515. In some embodiments, the improved characteristics is determined in an in vitro assay, complexed with a gRNA having a targeting sequence complementary to the target nucleic acid, compared to the unmodified parental CasX 515 and assayed under comparable conditions.
[0276] In some embodiments, the foregoing characteristics of the CasX variants are improved be at least about 0.1-fold, at least about 0.5-fold, at least about 1-fold, at least about 2-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, or at least about 10-fold improved compared to the unmodified parental CasX 515.
l. CasX Fusion Proteins
[0277] Also contemplated within the scope of the disclosure are CasX variant proteins comprising a heterologous protein fused to the CasX. This includes CasX variants comprising N-terminal or C-terminal fusions of the CasX to a heterologous protein or domain thereof. In some embodiments, the CasX variant protein is fused to one or more proteins or domains thereof that has a different activity of interest, resulting in a fusion protein. For example, in some embodiments, the CasX variant protein is fused to a protein (or domain thereof) that inhibits transcription, modifies a target nucleic acid, or modifies a polypeptide associated with a nucleic acid (e.g., histone modification).
[0278] A variety of heterologous polypeptides are suitable for inclusion in a CasX variant fusion protein of the disclosure. In some cases, the fusion partner can modulate transcription (e.g., inhibit transcription, increase transcription) of a target DNA. For example, in some cases the fusion partner is a protein (or a domain from a protein) that inhibits transcription (e.g., a transcriptional repressor, a protein that functions via recruitment of transcription inhibitor proteins, modification of target DNA such as methylation, recruitment of a DNA modifier, modulation of histones associated with target DNA, recruitment of a histone modifier such as those that modify acetylation and/or methylation of histones, and the like). In some cases the fusion partner is a protein (or a domain from a protein) that increases transcription (e.g., a transcription activator, a protein that acts via recruitment of transcription activator proteins, modification of target DNA such as demethylation, recruitment of a DNA modifier, modulation of histones associated with target DNA, recruitment of a histone modifier such as those that modify acetylation and/or methylation of histones, and the like).
[0279] In some cases, a fusion partner has enzymatic activity that modifies a target nucleic acid sequence; e.g., nuclease activity, methyltransferase activity, demethylase activity, DNA repair activity, DNA damage activity, deamination activity, dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity, transposase activity, recombinase activity, polymerase activity, ligase activity, helicase activity, photolyase activity or glycosylase activity. In some cases, the fusion partner to a CasX variant has enzymatic activity that modifies the target nucleic acid (e.g., ssRNA, dsRNA, ssDNA, dsDNA). Examples of enzymatic activity that can be provided by the fusion partner include but are not limited to: nuclease activity such as that provided by a restriction enzyme (e.g., FokI nuclease), methyltransferase activity such as that provided by a methyltransferase (e.g., Hhal DNA m5c-methyltransferase (M.Hhal), DNA methyltransferase 1 (DNMT1), DNA methyltransferase 3 alpha (DNMT3A) and subdomains such as DNMT3A catalytic domain and ATRX-DNMT3-DNMT3L domain (ADD), DNMT3L interaction domain (DNMT3L), DNA methyltransferase 3 beta (DNMT3B), METI, ZMET2, CMT1, CMT2 (plants), and the like); demethylase activity such as that provided by a demethylase (e.g., Ten-Eleven Translocation (TET) dioxygenase 1 (TET 1 CD), TET1, DME, DML1, DML2, ROS1, and the like), DNA repair activity, DNA damage activity, deamination activity such as that provided by a deaminase (e.g., a cytosine deaminase enzyme, e.g., an APOBEC protein such as rat apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 {APOBEC1}), dismutase activity, alkylation activity, depurination activity, oxidation activity, pyrimidine dimer forming activity, integrase activity such as that provided by an integrase and/or resolvase (e.g., Gin invertase such as the hyperactive mutant of the Gin invertase, GinH106Y; human immunodeficiency virus type 1 integrase (IN); Tn3 resolvase; and the like), transposase activity, recombinase activity such as that provided by a recombinase (e.g., catalytic domain of Gin recombinase), polymerase activity, ligase activity, helicase activity, photolyase activity, and glycosylase activity).
[0280] In some cases, a heterologous polypeptide (a fusion partner) for use with a CasX variant provides for subcellular localization, i.e., the heterologous polypeptide contains a subcellular localization sequence (e.g., a nuclear localization signal (NLS) for targeting to the nucleus, a sequence to keep the fusion protein out of the nucleus, e.g., a nuclear export sequence (NES), a sequence to keep the fusion protein retained in the cytoplasm, a mitochondrial localization signal for targeting to the mitochondria, a chloroplast localization signal for targeting to a chloroplast, an ER retention signal, and the like). In some embodiments, a subject RNA-guided polypeptide or a conditionally active RNA-guided polypeptide and/or subject CasX fusion protein does not include a NLS so that the protein is not targeted to the nucleus (which can be advantageous, e.g., when the target nucleic acid sequence is an RNA that is present in the cytosol). In some embodiments, a fusion partner can provide a tag (i.e., the heterologous polypeptide is a detectable label) for ease of tracking and/or purification (e.g., a fluorescent protein, e.g., green fluorescent protein (GFP), yellow fluorescent protein (YFP), red fluorescent protein (RFP), cyan fluorescent protein (CFP), mCherry, tdTomato, and the like; a histidine tag, e.g., a 6His tag; a hemagglutinin (HA) tag; a FLAG tag; a Myc tag; and the like).
[0281] In some cases, a CasX variant protein for use in the rAAV includes (is fused to) a nuclear localization signal (NLS) for targeting the CasX/gRNA to the nucleus of the cell. In some cases, a CasX variant protein is fused to 2 or more, 3 or more, 4 or more, or 5 or more 6 or more, 7 or more, 8 or more NLSs. In some embodiments, an NLS for incorporation into an rAAV of the disclosure comprises a sequence selected from the group consisting of SEQ ID NOS: 3411-3486, 3939-3971, 4065-4111. Non-limiting examples of NLSs suitable for use with a CasX variant include sequences having at least about 80%, at least about 90%, or at least about 95% identity or are identical to sequences derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 3411); the NLS from nucleoplasmin (e.g., the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK (SEQ ID NO: 3418); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 3420) or RQRRNELKRSP (SEQ ID NO: 4065); the hRNPAI M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 4066); the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 4067) of the IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO: 4068) and PPKKARED (SEQ ID NO: 4069) of the myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 4070) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 4071) of mouse c-abl IV; the sequences DRLRR (SEQ ID NO: 4072) and PKQKKRK (SEQ ID NO: 4073) of the influenza virus NS1; the sequence RKLKKKIKKL (SEQ ID NO: 4074) of the Hepatitis virus delta antigen; the sequence REKKKFLKRR (SEQ ID NO: 4075) of the mouse Mxl protein; the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 4076) of the human poly(ADP-ribose) polymerase; the sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 4077) of the steroid hormone receptors (human) glucocorticoid; the sequence PRPRKIPR (SEQ ID NO: 4078) of Borna disease virus P protein (BDV-P1); the sequence PPRKKRTVV (SEQ ID NO: 4079) of hepatitis C virus nonstructural protein (HCV-NS5A); the sequence NLSKKKKRKREK (SEQ ID NO: 4080) of LEF1; the sequence RRPSRPFRKP (SEQ ID NO: 4081) of ORF57 simirae; the sequence KRPRSPSS (SEQ ID NO: 4082) of EBV LANA; the sequence KRGINDRNFWRGENERKTR (SEQ ID NO: 4083) of Influenza A protein; the sequence PRPPKMARYDN (SEQ ID NO: 4084) of human RNA helicase A (RHA); the sequence KRSFSKAF (SEQ ID NO: 4085) of nucleolar RNA helicase II; the sequence KLKIKRPVK (SEQ ID NO: 4086) of TUS-protein; the sequence PKKKRKVPPPPAAKRVKLD (SEQ ID NO: 4087) associated with importin-alpha; the sequence PKTRRRPRRSQRKRPPT (SEQ ID NO: 4088) from the Rex protein in HTLV-1; the sequence MSRRRKANPTKLSENAKKLAKEVEN (SEQ ID NO: 4089) from the EGL-13 protein of Caenorhabditis elegans; and the sequences KTRRRPRRSQRKRPPT (SEQ ID NO: 4090), RRKKRRPRRKKRR (SEQ ID NO: 4091), PKKKSRKPKKKSRK (SEQ ID NO: 4092), HKKKHPDASVNFSEFSK (SEQ ID NO: 4093), QRPGPYDRPQRPGPYDRP (SEQ ID NO: 4094), LSPSLSPLLSPSLSPL (SEQ ID NO: 4095), RGKGGKGLGKGGAKRHRK (SEQ ID NO: 14096), PKRGRGRPKRGRGR (SEQ ID NO: 4097), PKKKRKVPPPPAAKRVKLD (SEQ ID NO: 4098) and PKKKRKVPPPPKKKRKV (SEQ ID NO: 4099), PAKRARRGYKC (SEQ ID NO: 3425), KLGPRKATGRW (SEQ ID NO: 4100), PRRKREE (SEQ ID NO: 4101), PYRGRKE (SEQ ID NO: 4102), PLRKRPRR (SEQ ID NO: 4103), PLRKRPRRGSPLRKRPRR (SEQ ID NO: 4104), PAAKRVKLDGGKRTADGSEFESPKKKRKV (SEQ ID NO: 4105), PAAKRVKLDGGKRTADGSEFESPKKKRKVGIHGVPAA (SEQ ID NO: 4106), PAAKRVKLDGGKRTADGSEFESPKKKRKVAEAAAKEAAAKEAAAKA (SEQ ID NO: 4107), PAAKRVKLDGGKRTADGSEFESPKKKRKVPG (SEQ ID NO: 4108), KRKGSPERGERKRHW (SEQ ID NO: 4109), KRTADSQHSTPPKTKRKVEFEPKKKRKV (SEQ ID NO: 4110), and PKKKRKVGGSKRTADSQHSTPPKTKRKVEFEPKKKRKV (SEQ ID NO: 4111). Additional NLS for incorporation in the rAAV of the disclosure are provided in Tables 20 and 21, indicating NLS for linking to the N- or C-terminus of the CasX. In some embodiments, the one or more NLS are linked to the CasX or to an adjacent NLS by a linker peptide wherein the linker peptide is selected from the group consisting of RS, (G)n (SEQ ID NO: 26), (GS)n (SEQ ID NO: 27), (GSGGS)n (SEQ ID NO: 20), (GGSGGS)n (SEQ ID NO: 21), (GGGS)n (SEQ ID NO: 22), GGSG (SEQ ID NO: 23), GGSGG (SEQ ID NO: 24), GSGSG (SEQ ID NO: 25), GSGGG (SEQ ID NO: 28), GGGSG (SEQ ID NO: 45), GSSSG (SEQ ID NO: 46), GPGP (SEQ ID NO: 29), GGP, PPP, PPAPPA (SEQ ID NO: 30), PPPG (SEQ ID NO: 47), PPPGPPP (SEQ ID NO: 31), PPP(GGGS)n (SEQ ID NO: 44), (GGGS)nPPP (SEQ ID NO: 32), AEAAAKEAAAKEAAAKA (SEQ ID NO: 4112), and TPPKTKRKVEFE (SEQ ID NO: 4113), wherein n is 1 to 5. In some embodiments, the rAAV constructs of the disclosure comprise polynucleic acids encoding the NLS and linker peptides of any of the foregoing embodiments of the paragraph, as well as the NLS of Tables 20 and 21, and can be, in some cases, configured in relation to the other components of the transgene constructs as depicted in any one of
[0282] In general, NLS (or multiple NLSs) are of sufficient strength to drive accumulation of a CasX variant fusion protein in the nucleus of a eukaryotic cell. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to a CasX variant fusion protein such that location within a cell may be visualized. Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly.
[0283] In some embodiments, a CasX variant fusion protein can include a CasX protein that is linked to an internally inserted heterologous amino acid or heterologous polypeptide (a heterologous amino acid sequence) via a linker polypeptide (e.g., one or more linker polypeptides). In some embodiments, a CasX variant fusion protein can be linked at the C-terminal and/or N-terminal end to a heterologous polypeptide (fusion partner) via a linker polypeptide (e.g., one or more linker polypeptides). The linker polypeptide may have any of a variety of amino acid sequences. Proteins can be joined by a spacer peptide, generally of a flexible nature, although other chemical linkages are not excluded. Suitable linkers include polypeptides of between 4 amino acids and 40 amino acids in length, or between 4 amino acids and 25 amino acids in length. These linkers are generally produced by using synthetic, linker-encoding oligonucleotides to couple the proteins. Peptide linkers with a degree of flexibility can be used. The linking peptides may have virtually any amino acid sequence, bearing in mind that the preferred linkers will have a sequence that results in a generally flexible peptide. The use of small amino acids, such as glycine and alanine, are of use in creating a flexible peptide. The creation of such sequences is routine to those of skill in the art. A variety of different linkers are commercially available and are considered suitable for use. Example linker polypeptides include glycine polymers (G)n, glycine-serine polymers, glycine-alanine polymers, alanine-serine polymers, glycine-proline polymers, proline polymers and proline-alanine polymers. Example linkers can comprise amino acid sequences including, but not limited to (G)n (SEQ ID NO: 26), (GS)n (SEQ ID NO: 27), (GSGGS)n (SEQ ID NO: 20), (GGSGGS)n (SEQ ID NO: 21), (GGGS)n (SEQ ID NO: 22), GGSG (SEQ ID NO: 23), GGSGG (SEQ ID NO: 24), GSGSG (SEQ ID NO: 25), GSGGG (SEQ ID NO: 28), GGGSG (SEQ ID NO: 45), GSSSG (SEQ ID NO: 46), GPGP (SEQ ID NO: 29), GGP, PPP, PPAPPA (SEQ ID NO: 30), PPPG (SEQ ID NO: 47), PPPGPPP (SEQ ID NO: 31), PPP(GGGS)n (SEQ ID NO: 44), (GGGS)nPPP (SEQ ID NO: 32), AEAAAKEAAAKEAAAKA (SEQ ID NO:4112), and TPPKTKRKVEFE (SEQ ID NO: 4113), where n is 1 to 5, where n is 1 to 5. The ordinarily skilled artisan will recognize that design of a peptide conjugated to any elements described above can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure.
V. rAAV and Methods for Modification of Target Nucleic Acids
[0284] The rAAV provided herein are useful for various applications, including as therapeutics, diagnostics, and for research. To effect the methods of the disclosure for gene editing, provided herein are programmable rAAV to modify the target nucleic acid in eukaryotic cells; either in vitro, ex vivo, or in vivo in a subject. Generally, any portion of a gene can be targeted using the programmable systems and methods provided herein. In some embodiments of the rAAV vector, the CRISPR nuclease is a Class 2, Type V nuclease. In some embodiments, the disclosure provides a Class 2, Type V nuclease selected from the group consisting of Cas12a (Cpf1), Cas12b (C2c1), Cas12c (C2c3), Cas12d (CasY), Cas12e (CasX), Cas12f, Cas12g, Cas12h, Cas12i, Cas12j, Cas12k, Cas14, and Cas(D. In some embodiments, the disclosure provides vectors encoding a CasX variant protein and one or more guide nucleic acid (gRNA) variants as gene editing pairs. The programmable nature of the CasX and gRNA components of the rAAV provided herein allows for the precise targeting to achieve the desired effect (nicking, cleaving, etc.) at one or more regions of predetermined interest in the target nucleic acid sequence. In some embodiments, the rAAV provided herein comprise sequences encoding a CasX variant protein and a first, and optionally a second gRNA wherein the targeting sequence of the gRNA is complementary to, and therefore is capable of hybridizing with, a target nucleic acid sequence. In some cases, the rAAV further comprises a donor template nucleic acid.
[0285] In some embodiments of the disclosure, provided herein are methods of modifying a target nucleic acid sequence. In some embodiments, the methods comprise contacting a cell comprising the target nucleic acid sequence with an rAAV encoding a CasX protein of the disclosure and a gRNA of the disclosure comprising a targeting sequence, wherein the targeting sequence of the gRNA has a sequence complementary to and that can hybridize with the sequence of the target nucleic acid. Upon hybridization with the target nucleic acid by the CasX and the gRNA, the CasX introduces one or more single-strand breaks or double-strand breaks within or near the target nucleic acid, which may include sequences that contain regulatory elements or non-coding regions of the gene, that results in a permanent indel (deletion or insertion) or mutation in the target nucleic acid, as described herein, with a corresponding modulation of expression or alteration in the function of the gene product, thereby creating an edited cell. In some embodiments of the method, the modification comprises introducing an in-frame mutation in the target nucleic acid. In some embodiments of the method, the modification comprises introducing a frame-shifting mutation in the target nucleic acid. In some embodiments of the method, the modification comprises introducing a premature stop codon in the coding sequence in the target nucleic acid. In some embodiments of the method, the modification results in expression of a non-functional protein in the modified cells of the population. In some embodiments of the method, the modification results in the correction of a mutation to wild-type or results in the ability of the cell to express a functional gene product.
[0286] In some embodiments of the method of modifying a target nucleic acid sequence, the method comprises contacting a cell with an rAAV comprising an encoded CasX protein wherein the CasX is an encoded CasX variant having a sequence of any one of SEQ ID NOS: 137-512, 9382-9542, and 9607-9609, or a sequence having at least about 80%, at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity thereto, and comprises a gRNA scaffold having a sequence of SEQ ID NOS: 2238-2400, 9257-9289 and 9588, or a sequence having at least about 80%, at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity thereto, and comprises a targeting sequence complementary to the target nucleic acid to be modified, wherein the expressed CasX and gRNA retain the ability to form an RNP complex and to bind and cleave the target nucleic acid. In some embodiments of the method of modifying a target nucleic acid sequence, the method comprises contacting a cell with an rAAV comprising an encoded CasX variant having a sequence selected from the group consisting of SEQ ID NOS: 190, 197, 278, 352, 355, 359, and 484, or a sequence having at least about 80%, at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity thereto, and comprises a gRNA scaffold having a sequence of SEQ ID NOS: 2292, or a sequence having at least about 80%, at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity thereto, and comprises a targeting sequence complementary to the target nucleic acid to be modified, wherein the expressed CasX and gRNA retain the ability to form an RNP complex and to bind and cleave the target nucleic acid. In some embodiments of the method of modifying a target nucleic acid sequence, the method comprises contacting a cell with an rAAV comprising an encoded CasX variant having a sequence selected from the group consisting of SEQ ID NOS: 190, 197, 278, 352, 355, 359, and 484, or a sequence having at least about 80%, at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity thereto, and comprises a gRNA scaffold having a sequence of SEQ ID NOS: 9588, or a sequence having at least about 80%, at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity thereto, and comprises a targeting sequence complementary to the target nucleic acid to be modified, wherein the expressed CasX and gRNA retain the ability to form an RNP complex and to bind and cleave the target nucleic acid.
[0287] In other embodiments, the method comprises contacting a cell comprising the target nucleic acid sequence with an rAAV encoding a first and a second of gRNA targeted to different or overlapping portions of the target nucleic acid wherein the CasX protein introduces multiple breaks in the target nucleic acid that result in a permanent indel, mutation, or excision of the intervening sequence in the target nucleic acid, with a corresponding modulation of expression or alteration in the function of the gene product, thereby creating an edited cell. In some embodiments of the method, the gRNA scaffold of the first and the second comprises a sequence selected from the group consisting of SEQ ID NOS: 2238-2400, 9257-9289 and 9588. In some embodiments of the method, the gRNA scaffold of the first and the second comprises a sequence selected from the group consisting of SEQ ID NOS: 2238 and 2292.
[0288] In some embodiments of the method, the modification of the target nucleic acid results in reduced expression of a gene product of a gene comprising the target nucleic acid, wherein expression is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% in comparison to a cell that has not been modified. In some embodiments of the method, the modification of the target nucleic acid results in correction of a mutation in the target nucleic acid such that a wild-type or a functional gene product can be express.
[0289] In some embodiments, the modifying of the target nucleic acid sequence is carried out ex vivo. In some embodiments, the modifying of the target nucleic acid sequence is carried out in vitro inside a cell. In some embodiments of the modification of the target nucleic acid sequence in a cell, the cell is a eukaryotic cell selected from the group consisting of a rodent cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, and a human cell. In particular embodiments, the eukaryotic cell is a human cell. In some embodiments, the modifying of the target nucleic acid sequence is carried out in vivo in a subject. In some embodiments, the subject is selected from the group consisting of mouse, rat, pig, non-human primate. In some embodiments, the subject is a human.
[0290] In some embodiments, the method of modifying a target nucleic acid sequence comprises contacting a target nucleic acid with an rAAV encoding a CasX protein and gRNA pair and further comprising a donor template. The donor template may be inserted into the target nucleic acid such that all, some or none of the gene product is expressed. Depending on whether the vector is used to knock-down/knock-out or to knock-in a protein-coding sequence, the donor template can be a short single-stranded or double-stranded oligonucleotide, or can be a long single-stranded or double-stranded oligonucleotide. For knock-down/knock-outs, the donor template sequence need not be identical to the genomic sequence that it replaces and may contain one or more single base changes, insertions, deletions, inversions or rearrangements with respect to the genomic sequence. Provided that there are arms with sufficient numbers of nucleotides having sufficient homology flanking the cleavage site(s) of the target nucleic acid sequence targeted by the CasX:gRNA (i.e., 5 and 3 to the cleavage site) to support homology-directed repair (homologous arms), use of such donor templates can result in a frame-shift or other mutation such that the gene product is not expressed or is expressed at a lower level. In some embodiments, the homologous arms comprise between 10 and 100 nucleotides. The upstream and downstream homology arm sequences share at least about 80%, 85%, 90%, 95%, or 100% homology with the nucleotide sequences within 1-50 bases flanking either side of the cleavage site where the CasX cleaves the target nucleic acid sequence, facilitating insertion of the donor template sequence by HDR. In some embodiments, the donor template sequence comprises a non-homologous or a heterologous sequence flanked by two homologous arms, such that homology-directed repair between the target DNA region and the two flanking arm sequences results in insertion of the non-homologous or heterologous sequence at the target region, resulting in the knock-down or knock-out of the target gene, with a resulting reduction or elimination of expression of the gene product. In such knock-down cases, expression of the gene product is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% in comparison to target nucleic acid that has not been modified. In other cases, an exogenous donor template may comprise a corrective sequence to be integrated, and is flanked by an upstream homologous arm and a downstream homologous arm, each having homology to the target nucleic acid sequence that is introduced into a cell. Use of such donor templates can result in expression of functional protein or expression of physiologically normal levels of functional protein after gene editing. In other cases, an exogenous donor template, which may comprise a mutation, a heterologous sequence, or a corrective sequence, is inserted between the ends generated by CasX cleavage by homology-independent targeted integration (HITI) mechanisms. The exogenous sequence inserted by HITI can be any length, for example, a relatively short sequence of between 1 and 50 nucleotides in length, or a longer sequence of about 50-1000 nucleotides in length. The lack of homology can be, for example, having no more than 20-50% sequence identity and/or lacking in specific hybridization at low stringency. In other cases, the lack of homology can further include a criterion of having no more than 5, 6, 7, 8, or 9 bp identity.
[0291] Introducing recombinant rAAV into a target cell can be carried out in vivo, in vitro or ex vivo. Introducing recombinant rAAV comprising sequences encoding the transgene components (e.g., the CasX, gRNA, promoters and accessory components and, optionally, the donor template sequences) of the disclosure into cells under in vitro conditions can occur in any suitable culture media and under any suitable culture conditions that promote the survival of the cells and production of the CasX:gRNA. In some embodiments of the method, vectors may be provided directly to a target host cell. For example, cells may be contacted with vectors having nucleic acids encoding the CasX and gRNA of any of the embodiments described herein and, optionally, having a donor template sequence such that the vectors are taken up by the cells.
[0292] In some embodiments, the vector is administered in vivo to a subject at a therapeutically effective dose. In the foregoing, the subject is selected from the group consisting of mouse, rat, pig, non-human primate, and human. In particular embodiments, the subject is a human. In some embodiments of the methods, the vector is administered to a subject at a dose of at least about 110.sup.5 vector genomes/kg (vg/kg), at least about 110.sup.6 vg/kg, at least about 110.sup.7 vg/kg, at least about 110.sup.8 vg/kg, at least about 110.sup.9 vg/kg, at least about 110.sup.10 vg/kg, at least about 110.sup.11 vg/kg, at least about 110.sup.12 vg/kg, at least about 110.sup.13 vg/kg, at least about 110.sup.14 vg/kg, at least about 110.sup.15 vg/kg, at least about 110.sup.16 vg/kg. In other embodiments, the vector is administered to the subject at a dose of at least about 110.sup.5 vg/kg to at least about 110.sup.16 vg/kg, or at least about 110.sup.6 vg/kg to about 110.sup.15 vg/kg, or at least about 110.sup.7 vg/kg to about 110.sup.14 vg/kg, or at least about 110.sup.1 vg/kg to about 110.sup.14 vg/kg.
[0293] The vector can be administered by a route of administration selected from the group consisting of subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatical, or intraperitoneal routes, wherein the administering method is injection, transfusion, or implantation.
VI. rAAV
[0294] In other embodiments, the present disclosure provides recombinant rAAV comprising polynucleotides encoding the CasX proteins, the gRNAs, and the regulatory and accessory elements described herein that are integrated into the rAAV transgene.
[0295] In some embodiments, the disclosure provides a recombinant adeno-associated virus (rAAV) comprising: a) an AAV capsid protein, and b) the transgene polynucleotide of any one of the embodiments described herein. In the foregoing embodiment, the polynucleotide can comprise sequences of components selected from: a first adeno-associated virus (AAV) inverted terminal repeat (ITR) sequence; a second AAV ITR sequence; a first promoter sequence operably linked to the CRISPR protein; a second promoter sequence operably linked to the gRNA; a sequence encoding a CRISPR protein; a sequence encoding at least a first guide RNA (gRNA); and one or more accessory element sequences (e.g., a 3 UTR, a poly(A) signal sequence, an enhancer, an intron, a posttranscriptional regulatory element (PTREs), an NLS, a deaminases, a DNA glycosylase inhibitor, a factor that stimulates CRISPR-mediated homology-directed repair, an activator or repressor of transcription, a self-cleaving sequence, or a fusion domain. In some embodiments, the polynucleotide comprises one or more sequences selected from the group of sequences set forth in Tables 7-10, 12-17, 19, 23-43, 45-46, 50-55, 57-58, and 60-61, or a sequence having at least 85%, at least 90%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto. In another embodiment, the polynucleotide comprises a sequence selected from the group of sequences set forth in Tables 7-10, 12-17, 19, 23-43, 45-46, 50-55, 57-58, and 60-61. In some embodiments, the polynucleotide sequence differs from those set forth in Tables 7-10, 12-17, 19, 23-43, 45-46, 50-55, 57-58, and 60-61 only in the selection of the targeting sequences of the gRNA or gRNAs encoded by the polynucleotide, wherein the targeting sequence is a sequence having 15 to 20 nucleotides capable of hybridizing with the sequence of a target nucleic acid. In some embodiments, the present disclosure provides a transgene polynucleotide, wherein the polynucleotide has the configuration of a construct of any one of
[0296] In some embodiments, the AAV capsid protein is derived from serotype AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV 9.45, AAV 9.61, AAV 44.9, AAV-Rh74, AAVRh10, MyoAAV 1Al, MyoAAV 1A2, or MyoAAV 2A. In some embodiments, the AAV capsid protein and the 5 and 3 ITR are derived from the same serotype of AAV. In other embodiments, the AAV capsid protein and the 5 and 3 ITR are derived from different serotypes of AAV. In a particular embodiment, the 5 and 3 ITR are derived from AAV1. In a particular embodiment, the ITRs are derived from serotype AAV2, including the 5 ITR having sequence CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCGTCGGGCGAC CTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACT CCATCACTAGGGGTTCCT (SEQ ID NO: 3683) and the 3 ITR having sequence AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCGCTCACTG AGGCCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCGGGCGGCCTCAGTG AGCGAGCGAGCGCGCAGCTGCCTGCAGG (SEQ ID NO: 3701).
[0297] In some embodiments, the polynucleotides utilized in the rAAV comprise sequences encoding a CasX variant selected from the group consisting of SEQ ID NOS: 137-512, 9382-9542, and 9607-9609, or sequences having at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto. In some embodiments, the polynucleotides utilized in the rAAV comprise sequences encoding the CasX variants selected from the group consisting of SEQ ID NOS: 190, 197, 348, 351, 355, or 484, or sequences having at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto. In some embodiments, the polynucleotides utilized in the rAAV encode gRNA scaffold sequences selected from the group consisting of SEQ ID NOS: 2238-2400, 9257-9289 and 9588, or sequences having at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity thereto. In some embodiments, the polynucleotides utilized in the rAAV encode gRNA scaffold sequences selected from the group consisting of SEQ ID NOS: 2292 and 9588 as set forth in Table 2, or sequences having at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity thereto. In some embodiments, the gRNA comprises a targeting sequence having 15 to 20 nucleotides that is complementary to, and therefore hybridizes with, the target nucleic acid in a cell, and is linked to the 3 end of the gRNA scaffold sequence. In one embodiment, the polynucleotide utilized in the rAAV transgene encodes CasX 515 (SEQ ID NO: 197), gRNA scaffold 235 (SEQ ID NO: 2292), and the gRNA comprises a targeting sequence having 15 to 20 nucleotides that is complementary to, and therefore hybridizes with, the target nucleic acid in a cell, and is linked to the 3 end of the gRNA scaffold sequence. In another embodiment, the polynucleotide utilized in the rAAV transgene encodes CasX 515 (SEQ ID NO: 197), gRNA scaffold 316 (SEQ ID NO: 9588), and the gRNA comprises a targeting sequence having 15 to 20 nucleotides that is complementary to, and therefore hybridizes with, the target nucleic acid in a cell, and is linked to the 3 end of the gRNA scaffold sequence.
[0298] In other embodiments, the disclosure provides an rAAV comprising a donor template nucleic acid, wherein the donor template comprises a nucleotide sequence having homology to a target nucleic acid sequence. In some embodiments, the donor template is intended for gene editing and comprises all or at least a portion of a target gene wherein upon insertion of the donor template, the gene is either knocked down, knocked out, or the mutation is corrected. In some embodiments, the donor template comprises a sequence that encodes at least a portion of a target nucleic acid exon. In other embodiments, the donor template has a sequence that encodes at least a portion of a target nucleic acid intron. In other embodiments, the donor template has a sequence that encodes at least a portion of a target nucleic acid intron-exon junction. In still other cases, the donor template sequence of the rAAV comprises one or more mutations relative to a target nucleic acid. In the foregoing embodiments, the donor template can range in size from 10-700 nucleotides. In some embodiments, the donor template is a single-stranded DNA template.
[0299] In other aspects, the disclosure relates to methods to produce polynucleotide sequences encoding the rAAV, as well as methods to express and recover the rAAV. In general, the methods include producing a polynucleotide sequence coding for the components of the expression cassette plus the flanking ITRs and incorporating the encoding gene into an expression vector appropriate for a host cell. For production of the rAAV, the methods include transforming an appropriate host cell with an expression vector comprising the encoding polynucleotide, together with and the Rep and Cap sequences provided in trans, and culturing the host cell under conditions causing or permitting the resulting rAAV to be produced, which are recovered by methods described herein or by standard purification methods known in the art. Rep and Cap can be provided to the packaging host cell as plasmids. Alternatively, the host cell genome may comprise stably integrated Rep and Cap genes. Suitable packaging cell lines are known to one of ordinary skill in the art. See for example, www.cellbiolabs.com/aav-expression-and-packaging. Methods of purifying rAAV produced by host cell lines will be known to one of ordinary skill in the art, and include, without limitation, affinity chromatography, gradient centrifugation, and ion exchange chromatography. Standard recombinant techniques in molecular biology are used, along with the methods of the Examples, to make the polynucleotides and rAAV of the present disclosure.
[0300] In accordance with the disclosure, nucleic acid sequences that encode the CasX variants or the gRNA described herein (or their complement) are used to generate recombinant DNA molecules that direct the expression in appropriate host cells. Several cloning strategies are suitable for performing the present disclosure, many of which are used to generate a construct that comprises a gene coding for a composition of the present disclosure, or its complement. In some embodiments, the cloning strategy is used to create a gene that encodes a construct that comprises nucleotides encoding the CasX variants or the gRNA that is used to transform a host cell for expression of the composition.
[0301] In some approaches, a construct is first prepared containing the DNA sequences encoding the components of the rAAV and transgene. Exemplary methods for the preparation of such constructs are described in the Examples. The construct is then used to create an expression vector suitable for transforming a host packaging cell, such as a eukaryotic host cell for the expression and recovery of the rAAV comprising the transgene. The eukaryotic host packaging cell can be selected from Baby Hamster Kidney fibroblast (BHK) cells, human embryonic kidney 293 (HEK293), human embryonic kidney 293T (HEK293T), NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells, hybridoma cells, NIH3T3 cells, CV-1 (simian) in Origin with SV40 genetic material (COS), HeLa, Chinese hamster ovary (CHO) cells, or other eukaryotic cells known in the art suitable for the production of recombinant AAV. A number of transfection techniques are generally known in the art; see, e.g., Sambrook et al. (1989) Molecular Cloning, a laboratory manual, Cold Spring Harbor Laboratories, New York. Particularly suitable transfection methods include calcium phosphate co-precipitation, direct microinjection into cultured cells, electroporation, liposome mediated gene transfer, lipid-mediated transduction, and nucleic acid delivery using high-velocity microprojectiles. Exemplary methods for the creation of expression vectors, the transformation of host cells and the expression and recovery of the nucleic acids and the rAAV are described in the Examples.
[0302] The gene encoding the rAAV can be made in one or more steps, either fully synthetically or by synthesis combined with enzymatic processes, such as restriction enzyme-mediated cloning, PCR and overlap extension, including methods more fully described in the Examples. The methods disclosed herein can be used, for example, to ligate sequences of polynucleotides encoding the various components (e.g., ITRs, CasX and gRNA, promoters and accessory elements) of a desired sequence to create the expression vector.
[0303] In some embodiments, host cells transfected with the above-described rAAV expression vectors are rendered capable of providing AAV helper functions in order to replicate and encapsidate the nucleotide sequences flanked by the AAV ITRs to produce rAAV viral particles. AAV helper functions are generally AAV-derived coding sequences which can be expressed to provide AAV gene products that, in turn, function in trans for productive AAV replication. AAV helper functions are used herein to complement necessary AAV functions that are missing from the AAV expression vectors. Thus, AAV helper functions include one, or both of the major AAV ORFs (open reading frames), encoding the rep and cap coding regions, or functional homologues thereof. Accessory functions can be introduced into and then expressed in host cells using methods known to those of skill in the art. Commonly, accessory functions are provided by infection of the host cells with an unrelated helper virus. In some embodiments, accessory functions are provided using an accessory function vector. Depending on the host/vector system utilized, any of a number of suitable transcription and translation control elements, including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc., may be used in the expression vector.
[0304] In some embodiments, the nucleotide sequence encoding the CRISPR protein components of the rAAV is codon optimized. This type of optimization can entail a mutation of an encoding nucleotide sequence to mimic the codon preferences of the intended host organism or cell while encoding the same CasX protein or other protein component. Thus, the codons can be changed, but the encoded protein remains unchanged. For example, if the intended host cell was a human cell, a human codon-optimized CasX-encoding nucleotide sequence could be used. The gene design can be performed using algorithms that optimize codon usage and amino acid composition appropriate for the host cell utilized in the production of the rAAV vector. In one method of the disclosure, a library of polynucleotides encoding the components of the constructs is created and then assembled, as described above. The resulting genes are then assembled and the resulting genes used to transform a host cell and produce and recover the rAAV compositions for evaluation of its properties, as described herein. In some embodiments, as described more fully below, the nucleotide sequence encoding the components of the rAAV are engineered to remove CpG dinucleotides in order to reduce the immunogenicity of the components, while retaining their functional characteristics.
[0305] In some embodiments, a nucleotide sequence encoding a gRNA is operably linked to a regulatory element. In some embodiments, a nucleotide sequence encoding a CasX protein is operably linked to a regulatory element. In other cases, the nucleotide encoding the CasX and gRNA are linked and are operably linked to a single regulatory element. Exemplary accessory elements include a transcription promoter, a transcription enhancer element, a transcription termination signal, internal ribosome entry site (IRES) or P2A peptide to permit translation of multiple genes from a single transcript, polyadenylation sequences to promote downstream transcriptional termination, sequences for optimization of initiation of translation, and translation termination sequences. In some cases, the promoter is a constitutively active promoter. In some cases, the promoter is a regulatable promoter. In some cases, the promoter is an inducible promoter. In some cases, the promoter is a tissue-specific promoter. In some cases, the promoter is a cell type-specific promoter. In some cases, the transcriptional accessory element (e.g., the promoter) is functional in a targeted cell type or targeted cell population. For example, in some cases, the transcriptional accessory element can be functional in eukaryotic cells, e.g., packaging host cells for the production of the rAAV vector. In some cases, the accessory element is a transcription activator that works in concert with a promoter to initiate transcription. By transcriptional activation, it is intended that transcription will be increased above basal levels in the target cell by 10-fold, by 100-fold, more usually by 1000-fold.
[0306] Non-limiting examples of Pol II promoters suitable for use in the transgene of the rAAV of the disclosure include, but are not limited to polyubiquitin C (UBC), cytomegalovirus (CMV), simian virus 40 (SV40), chicken beta-Actin promoter and rabbit beta-Globin splice acceptor site fusion (CAG), chicken -actin promoter with cytomegalovirus enhancer (CB7), PGK, Jens Tornoe (JeT), GUSB, CBA hybrid (CBh), elongation factor-1 alpha (EF-1alpha), beta-actin, Rous sarcoma virus (RSV), silencing-prone spleen focus forming virus (SFFV), CMVd1 promoter, truncated human CMV (tCMVd2), minimal CMV promoter, chicken -actin promoter, chicken -actin promoter with cytomegalovirus enhancer (CB7), HSV TK promoter, Mini-TK promoter, minimal IL-2 promoter, GRP94 promoter, Super Core Promoter 1, Super Core Promoter 2, MLC, MCK, GRK1 protein promoter, Rho promoter, CAR protein promoter, hSyn Promoter, U1A promoter, Ribsomal Rpl and Rps promoters (e.g., hRpl30 and hRps18), CMV53 promoter, minimal SV40 promoter, CMV53 promoter, SFCp promoter, pJB42CAT5 promoter, MLP promoter, rhodopsin promoter, EFS promoter, MeP426 promoter, MecP2 promoter, MHCK7 promoter, beta-glucuronidase (GUSB), CK7 promoter, and CK8e promoter. In some embodiments, an rAAV construct of the disclosure comprises a Pol II promoter comprising a sequence of SEQ ID NOS: 3532-3562, 3714-3739, 3773-3778, and 9344-9350, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto. In one embodiment, the Pol II promoter is EF-1alpha, wherein the promoter enhances transfection efficiency, the transgene transcription or expression of the CRISPR nuclease, the proportion of expression-positive clones and the copy number of the episomal vector in long-term culture. In one embodiment, the Pol II promoter is JeT, wherein the promoter enhances transfection efficiency, the transgene transcription or expression of the CRISPR nuclease, the proportion of expression-positive clones and the copy number of the episomal vector in long-term culture. In one embodiment, the Pol II promoter is U1A, wherein the promoter enhances transfection efficiency, the transgene transcription or expression of the CRISPR nuclease, the proportion of expression-positive clones and the copy number of the episomal vector in long-term culture. In one embodiment, the Pol II promoter is UbC, wherein the promoter enhances transfection efficiency, the transgene transcription or expression of the CRISPR nuclease, the proportion of expression-positive clones and the copy number of the episomal vector in long-term culture. In some embodiments, the Pol II promoter is a truncated version of the foregoing promoters. In some embodiments the Pol II promoter in an rAAV construct has less than about 400 nucleotides, less than about 350 nucleotides, less than about 300 nucleotides, less than about 200 nucleotides, less than about 150 nucleotides, less than about 100 nucleotides, less than about 80 nucleotides, or less than about 40 nucleotides. In some embodiments, the Pol II promoter in an rAAV construct has between about 40 to about 585 nucleotides, between about 100 to about 400 nucleotides, or between about 150 to about 300 nucleotides. In some embodiments, the rAAV constructs comprise polynucleic acids comprising the Pol II promoters of any of the foregoing embodiments of the paragraph, as well as the promoters of Table 7, and can be, in some cases, configured in relation to the other components of the constructs as depicted in any one of
[0307] In some embodiments, an rAAV construct of the disclosure comprises a Pol II promoter with a linked intron, wherein the intron enhances the ability of the promoter to increase transfection efficiency, the transgene transcription or expression of the CRISPR nuclease, the proportion of expression-positive clones and the copy number of the episomal vector in long-term culture. Exemplary embodiments of such promoter-intron combinations are described in the Examples.
[0308] Non-limiting examples of Pol III promoters suitable for use in the transgene of the rAAV of the disclosure include, but are notlimited to human U6, human U6 variant, human U6 isoform variant, mini U61, mini U62, mini U63, BiH1 (Bidrectional H1 promoter), BiU6 (Bidirectional U6 promoter), gorilla U6, rhesus U6, human 7sk, and human H1 promoters. In some embodiments, the Pol III promoter comprises a sequence selected from the group consisting of SEQ ID NOS: 3563, 3566-3582, 3599-3602, 3740-3746, 4025, 4029, 4032, and 4743, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto. In the foregoing embodiments, the Pol III promoter enhances the transcription of the gRNA encoded by the rAAV. In some embodiments, an rAAV construct of the disclosure comprises a Pol III promoter comprising a sequence as set forth in Table 8, or a sequence having at least 85%, at least 90%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto. In some embodiments, the Pol III promoter is a truncated version of the foregoing promoters. In some embodiments the Pol III promoter in an rAAV construct of the disclosure has less than about 250 nucleotides, less than about 220 nucleotides, less than about 200 nucleotides, less than about 160 nucleotides, less than about 140 nucleotides, less than about 130 nucleotides, less than about 120 nucleotides, less than about 100 nucleotides, less than about 80 nucleotides, or less than about 70 nucleotides. In some embodiments the Pol III promoter in an rAAV construct of the disclosure has between about 70 to about 245 nucleotides, between about 100 to about 220 nucleotides, or between about 120 to about 160 nucleotides. In some embodiments, the rAAV constructs comprise polynucleic acids encoding the Pol III promoters of any of the foregoing embodiments of the paragraph, as well as the promoters of Table 8, and can be, in some cases, configured in relation to the other components of the constructs as depicted in any one of
[0309] Selection of the appropriate promoter is well within the level of ordinary skill in the art, as it relates to controlling expression, e.g., for modifying a gene or other target nucleic acid. The expression vector may also contain a ribosome binding site for translation initiation and a transcription terminator. The expression vector may also include appropriate sequences for amplifying expression. The expression vector may also include nucleotide sequences encoding protein tags (e.g., 6His tag, hemagglutinin tag, fluorescent protein, etc.) that can be fused to the CasX protein, thus resulting in a chimeric CasX protein that are used for purification or detection.
[0310] In some embodiments, the disclosure provides rAAV transgenes comprising promoters and gRNA oriented in the forward direction (i.e., 5 to 3) relative to the orientation of the sequence encoding the Class 2, Type V CRISPR protein. In such a case, the gRNA would be 3 of the promoter in the transgene. In some embodiments, the disclosure provides rAAV transgenes comprising promoters and gRNA oriented in the reverse direction (i.e., 3 to 5) relative to the orientation of the sequence encoding the Class 2, Type V CRISPR protein. In such a case, the gRNA would be 5 of the promoter in the transgene. Exemplary promoters in the reverse orientation are described in the Examples and Table 50 and transgene constructs incorporating promoters in various locations and orientations are portrayed schematically in
[0311] In some embodiments, the present disclosure provides a polynucleotide sequence wherein one or more components of the transgene are operably linked to (under the control of) an inducible promoter operable in a eukaryotic cell. Examples of inducible promoters may include, but are not limited to, T7 RNA polymerase promoter, T3 RNA polymerase promoter, isopropyl-beta-D-thiogalactopyranoside (IPTG)-regulated promoter, lactose induced promoter, heat shock promoter, tetracycline-regulated promoter, kanamycin-regulated promoter, steroid-regulated promoter, metal-regulated promoter, estrogen receptor-regulated promoter, etc. Inducible promoters can therefore, in some embodiments, be regulated by molecules including, but not limited to, doxycycline, estrogen and/or an estrogen analog, IPTG, etc. Additional examples of inducible promoters include, without limitation, chemically/biochemically-regulated and physically-regulated promoters such as alcohol-regulated promoters, kanamycin-regulated promoters, tetracycline-regulated promoters (e.g., anhydrotetracycline (aTc)-responsive promoters and other tetracycline-responsive promoter systems, which include a tetracycline repressor protein (tetR), a tetracycline operator sequence (tetO) and a tetracycline transactivator fusion protein (tTA), steroid-regulated promoters (e.g., promoters based on the rat glucocorticoid receptor, human estrogen receptor, moth ecdysone receptors, and promoters from the steroid/retinoid/thyroid receptor superfamily), metal-regulated promoters (e.g., promoters derived from metallothionein (proteins that bind and sequester metal ions) genes from yeast, mouse and human), pathogenesis-regulated promoters (e.g., induced by salicylic acid, ethylene or benzothiadiazole (BTH)), temperature/heat-inducible promoters (e.g., heat shock promoters), and light-regulated promoters (e.g., light responsive promoters from plant cells).
[0312] In some cases, the promoter is a reversible promoter. Suitable reversible promoters, including reversible inducible promoters are known in the art. Such reversible promoters may be isolated and derived from many organisms, e.g., eukaryotes and prokaryotes. Modification of reversible promoters derived from a first organism for use in a second organism, e.g., a first prokaryote and a second a eukaryote, a first eukaryote and a second a prokaryote, etc., is well known in the art. Such reversible promoters, and systems based on such reversible promoters but also comprising additional control proteins, include, but are not limited to, alcohol regulated promoters (e.g., alcohol dehydrogenase I (alcA) gene promoter, promoters responsive to alcohol transactivator proteins (AlcR, etc.), tetracycline regulated promoters, (e.g., promoter systems including Tet Activators, TetON, TetOFF, etc.), steroid regulated promoters (e.g., rat glucocorticoid receptor promoter systems, human estrogen receptor promoter systems, retinoid promoter systems, thyroid promoter systems, ecdysone promoter systems, mifepristone promoter systems, etc.), metal regulated promoters (e.g., metallothionein promoter systems, etc.), pathogenesis-related regulated promoters (e.g., salicylic acid regulated promoters, ethylene regulated promoters, benzothiadiazole regulated promoters, etc.), temperature regulated promoters (e.g., heat shock inducible promoters (e.g., HSP-70, HSP-90, soybean heat shock promoter, etc.), light regulated promoters, synthetic inducible promoters, and the like.
[0313] Recombinant expression vectors of the disclosure can also comprise elements that facilitate robust expression components of the disclosure (e.g., the CasX or the gRNA). For example, recombinant expression vectors utilized in the rAAV constructs of the disclosure can include one or more of a polyadenylation signal (poly(A) signal), an intronic sequence or a post-transcriptional accessory element (PTRE) such as a woodchuck hepatitis post-transcriptional accessory element (WPRE). Non-limiting examples of PTRE suitable for the rAAV constructs of the disclosure include the sequences of SEQ ID NOS: 3615-3617 of Table 16, or a sequence having at least 85%, at least 90%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto. Exemplary poly(A) signal sequences suitable for inclusion in the expression vectors of the disclosure include hGH poly(A) signal (short), HSV TK poly(A) signal, synthetic polyadenylation signals, SV40 poly(A) signal, SV40 Late PolyA signal, -globin poly(A) signal, -globin poly(A) short, and the like. Non-limiting examples of poly(A) signals suitable for the rAAV constructs of the disclosure include the sequences of SEQ ID NOS: 2401-3401 of Table 12, or a sequence having at least 85%, at least 90%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto. Non-limiting examples of introns suitable for the rAAV of the disclosure include the sequences of SEQ ID NOS: 3487-3531 of Table 22, or a sequence having at least 85%, at least 90%, at least 95%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity thereto. A person of ordinary skill in the art will be able to select suitable elements to include in the recombinant expression vectors described herein.
[0314] The polynucleotides encoding the transgene components can be individually cloned into the rAAV expression vector. In some embodiments, the polynucleotide is a recombinant expression vector that comprises a nucleotide sequence encoding a CasX protein. In other embodiments, the disclosure provides a recombinant expression vector comprising a polynucleotide sequence encoding a CasX protein and a nucleotide sequence encoding a first gRNA with a linked targeting sequence complementary to a target nucleic acid of a cell, and, optionally, a second gRNA with a linked targeting sequence complementary to different or overlapping regions of a target nucleic acid of a cell. In some cases, the nucleotide sequence encoding the CasX protein variant and/or the nucleotide sequence encoding the gRNA are each operably linked to a promoter that is operable in a cell type of choice. In other embodiments, the nucleotide sequence encoding the CasX protein variant and the nucleotide sequence encoding the gRNA are provided in separate vectors.
[0315] The nucleic acid sequences encoding the transgene components are inserted into the vector by a variety of procedures. In general, DNA is inserted into an appropriate restriction endonuclease site(s) using techniques known in the art. Vector components generally include, but are not limited to, one or more of a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence. Construction of suitable vectors containing one or more of these components employs standard ligation techniques which are known to the skilled artisan. Such techniques are well known in the art and well described in the scientific and patent literature. Various vectors are publicly available.
[0316] The recombinant expression vectors can be delivered to the target host cells by a variety of methods, as described more fully, below, and in the Examples. Such methods include, e.g., viral infection, transfection, lipofection, electroporation, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran mediated transfection, liposome-mediated transfection, particle gun technology, nucleofection, electroporation, cell squeezing, calcium phosphate precipitation, direct microinjection, nanoparticle-mediated nucleic acid delivery, and the like. A number of transfection techniques are generally known in the art; see, e.g., Sambrook et al. (1989) Molecular Cloning, a laboratory manual, Cold Spring Harbor Laboratories, New York. Packaging cells are typically used to form virus particles; such cells include BHK cells, HEK293 cells, HEK293T cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells, hybridoma cells, NIH3T3 cells, COS cells, HeLa cells, and CHO cells (and other cells known in the art), which package adenovirus, which are then recovered by conventional methods known in the art.
[0317] In some embodiments, host cells transfected with the above-described rAAV expression vectors are rendered capable of providing rAAV helper functions in order to replicate and encapsidate the nucleotide sequences flanked by the AAV ITRs to produce rAAV viral particles. AAV helper functions are generally AAV-derived coding sequences which can be expressed to provide AAV gene products that, in turn, function in trans for productive AAV replication. In some embodiments, packaging cells are transfected with plasmids comprising AAV helper functions to complement necessary AAV functions that are missing from the rAAV expression vectors. Thus, AAV helper function plasmids include one, or both of the major AAV ORFs (open reading frames), encoding the rep and cap coding regions, the aap (assembly) gene, or functional homologues thereof, and the adenoviral helper genes comprising E2A, E4, and VA genes, operably linked to a promoter. Accessory functions can be introduced into and then expressed in host cells using methods known to those of skill in the art. Commonly, accessory functions are provided by infection of the host cells with an unrelated helper virus. In some embodiments, accessory functions are provided using an accessory function vector. Depending on the host/vector system utilized, any of a number of suitable transcription and translation accessory elements, including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc., may be used in the expression vector.
VII. Therapeutic Methods
[0318] The present disclosure provides methods of treating a disease in a subject in need thereof. In some embodiments of the method, the subject has one or more mutations in a gene, wherein administration of the rAAV is administered to modify the gene, either to knock down or knock out expression of the gene product. In some embodiments of the method, the rAAV is administered to correct a mutation in a gene of the subject. In some embodiments, the methods of the disclosure can prevent, treat and/or ameliorate a disease of a subject by the administering to the subject of an rAAV composition of the disclosure. In some embodiments, the composition administered to the subject further comprises pharmaceutically acceptable carrier, diluent or excipient.
[0319] In some embodiments, the disclosure provides methods of treating a disease in a subject in need thereof comprising modifying a target nucleic acid in a cell of the subject, the modifying comprising administering to the subject a therapeutically effective dose of an rAAV of any of the embodiments described herein wherein the targeting sequence of the encoded gRNA has a sequence that hybridizes with the target nucleic acid, resulting in the modification of the target nucleic acid by the CasX protein.
[0320] In other embodiments, the methods of treating a disease in a subject in need thereof comprise administering to the subject a therapeutically effective dose of an rAAV of any of the embodiments described herein wherein the targeting sequence of the encoded gRNA has a sequence that hybridizes with the target nucleic acid and wherein the rAAV further comprises a donor template comprises one or more mutations or a heterologous sequence that is inserted into or replaces the target nucleic acid sequence to knock-down or knock-out the gene comprising the target nucleic acid. In the foregoing, the insertion of the donor template serves to disrupt expression of the gene and the resulting gene product. In some embodiments of the foregoing methods, the donor DNA template ranges in size from 10-5,000 nucleotides. In other embodiments of the foregoing methods, the donor template ranges in size from 100-1,000 nucleotides. In some cases, the donor template is a single-stranded RNA or DNA template.
[0321] The modified cell of the treated subject can be a eukaryotic cell selected from the group consisting of a rodent cell, a mouse cell, a rat cell, a primate cell, a non-human primate cell, and a human cell. In some embodiments, the eukaryotic cell of the treated subject is a human cell.
[0322] In some embodiments, the method comprises administering to the subject the rAAV of the embodiments described herein via an administration route selected from the group consisting of subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatical, intraocular or intraperitoneal routes, wherein the administering method is injection, transfusion, or implantation. In some embodiments of the methods of treating a disease in a subject, the subject is selected from the group consisting of mouse, rat, pig, non-human primate, and human. In a particular embodiment, the subject is a human.
[0323] In some embodiments of the method of treating a disease in a subject in need thereof, the rAAV is administered at a dose of at least about 110.sup.5 vector genomes/kg (vg), at least about 110.sup.6 vector genomes/kilogram (vg/kg), at least about 110.sup.7 vg/kg, at least about 110.sup.8 vg/kg, at least about 110.sup.9 vg/kg, at least about 110.sup.10 vg/kg, at least about 110.sup.11 vg/kg, at least about 110.sup.12 vg/kg, at least about 110.sup.13 vg/kg, at least about 110.sup.14 vg/kg, at least about 110.sup.15 vg/kg, at least about 1101.sup.6 vg/kg. In other embodiments of the method of treatment, the rAAV is administered to a subject at a dose of at least about 110.sup.5 vg/kg to about 110.sup.16 vg/kg, at least about 110.sup.6 vg/kg to about 110.sup.15 vg/kg, or at least about 110.sup.7 vg/kg to about 110.sup.14 vg/kg.
[0324] In organ systems like the eye, the rAAV is administered at a dose of at least about 110.sup.5 vector genomes (vg), at least about 110.sup.6 vg, at least about 110.sup.7 vg, at least about 110.sup.8 vg, at least about 110.sup.9 vg, at least about 110.sup.10 vg, at least about 110.sup.11 vg, at least about 110.sup.12 vg, at least about 110.sup.13 vg, at least about 110.sup.14 vg, at least about 110.sup.15 vg, at least about 110.sup.16 vg.
[0325] A number of therapeutic strategies have been used to design the compositions for use in the methods of treatment of a subject with a disease. In some embodiments, the invention provides a method of treatment of a subject having a disease, the method comprising administering to the subject an rAAV of any of the embodiments disclosed herein according to a treatment regimen comprising one or more consecutive doses using a therapeutically effective dose. In some embodiments of the treatment regimen, the therapeutically effective dose of the rAAV is administered as a single dose. In other embodiments of the treatment regimen, the therapeutically effective dose is administered to the subject as two or more doses over a period of at least two weeks, or at least one month, or at least two months, or at least three months, or at least four months, or at least five months, or at least six months. In some embodiments of the treatment regiment, the effective doses are administered by a route selected from the group consisting of subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatical, intraocular, subretinal, intravitreal, or intraperitoneal routes, wherein the administering method is injection, transfusion, or implantation.
[0326] In some embodiments, the administering of the therapeutically effective amount of an rAAV to knock down or knock out expression of a gene having one or more mutations leads to the prevention or amelioration of the underlying disease such that an improvement is observed in the subject, notwithstanding that the subject may still be afflicted with the underlying disease. In some embodiments, the administration of the therapeutically effective amount of the rAAV leads to an improvement in at least one clinically-relevant parameter for the disease. In some embodiments of the method of treatment, the subject is selected from mouse, rat, pig, dog, non-human primate, and human.
[0327] In some embodiments, the disclosure provides compositions of any of the rAAV embodiments described herein for the manufacture of a medicament for the treatment of a human in need thereof. In some embodiments, the medicament is administered to the subject according to a treatment regimen comprising one or more consecutive doses using a therapeutically effective dose.
VIII. rAAV Engineered to Reduce Immunogenicity Retain Editing Properties
[0328] rAAV-associated pathogen associated molecular patterns (PAMPs) that contribute to immune responses in mammalians hosts include: i) ligands present on rAAV viral capsids that bind toll-like receptor 2 (TLR2), a cell-surface PRR on non-parenchymal cells in the liver; and ii) unmethylated CpG dinucleotides in viral DNA that bind TLR9, an endosomal PRR in plasmacytoid dendritic cells (pDCs) and B cells (Faust, S M, et al. CpG-depleted adeno-associated virus vectors evade immune detection. J. Clinical Invest. 123:2294 (2013)). In particular, CpG dinucleotide motifs (CpG PAMPs) in AAV vectors are immunostimulatory because of their high degree of hypomethylation, relative to mammalian CpG motifs, which have a high degree of methylation. Accordingly, reducing the frequency of unmethylated CpGs in rAAV genomes to a level below the threshold that activates human TLR9 is expected to reduce the immune response to exogenously administered rAAV-based biologics. Similarly, methylation of CpG PAMPs in rAAV constructs is similarly expected to reduce the immune response to rAAV-based biologics.
[0329] In some embodiments, the present disclosure provides rAAV wherein one or more components of the transgene are optimized for depletion of CpG dinucleotides by the substitution of homologous nucleotide sequences from mammalian species, wherein the one or more components substantially retain their functional properties upon expression in a transduced cell; e.g., ability to drive expression of the CRISPR nuclease, ability to drive expression of the gRNA, enhance the expression of the CRISPR nuclease and/or the gRNA, and enhanced ability to edit a target nucleic acid sequence. In some embodiments, the present disclosure provides rAAV wherein one or more rAAV transgene component sequences selected from the group consisting of 5 ITR, 3 ITR, Pol III promoter, Pol II promoter, encoding sequence for CRISPR nuclease, encoding sequence for gRNA, 3 UTR, poly(A) signal sequence, and accessory element are optimized for depletion of all or a portion of the CpG dinucleotides, wherein the resulting rAAV transgene is substantially devoid of CpG dinucleotides. In some embodiments, the present disclosure provides rAAV wherein one or more rAAV transgene component sequences selected from the group consisting of 5 ITR, 3 ITR, Pol III promoter, Pol II promoter, encoding sequence for a CRISPR nuclease, encoding sequence for gRNA, poly(A) signal, and accessory element comprise less than about 10%, less than about 5%, or less than about 1% CpG dinucleotides. In some embodiments, the present disclosure provides rAAV wherein one or more rAAV transgene component sequences selected from the group consisting of 5 ITR, 3 ITR, Pol III promoter, Pol II promoter, encoding sequence for the CRISPR nuclease, encoding sequence for the gRNA, and poly(A) signal are devoid of CpG dinucleotides. In some embodiments, the present disclosure provides rAAV wherein the transgene comprises less than about 10%, less than about 5%, or less than about 1% CpG dinucleotides. In some embodiments, the present disclosure provides rAAV wherein the one or more rAAV component sequences optimized for depletion of CpG dinucleotides are selected from the group of sequences consisting of SEQ ID NOS: 9327-9333, 9369-9380, and 3735-3772 or a sequence having at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto. In some embodiments, the present disclosure provides rAAV wherein the sequence encoding the CasX nuclease protein component sequences are optimized for depletion of CpG dinucleotides, selected from the group consisting of SEQ ID NOS: 9327-9333 and 9369-9380, or a sequence having at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto. In some embodiments, the disclosure provides a CpG-depleted polynucleotide sequence encoding a gRNA scaffold, wherein the sequence is selected from the group consisting of SEQ ID NOS: 3751-3772, or a sequence having at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto. In some embodiments, the disclosure provides a CpG-depleted polynucleotide sequence encoding an ITR, wherein the sequence is selected from the group consisting of SEQ ID NOS: 3749 and 3750. In some embodiments, the disclosure provides a CpG-depleted polynucleotide sequence encoding a promoter, wherein the sequence is selected from the group consisting of SEQ ID NOS: 3735-3746. In some embodiments, the disclosure provides a CpG-depleted polynucleotide sequence encoding a poly(A) signal sequence, wherein the sequence is SEQ ID NO: 3748. In some embodiments, the disclosure provides rAAV having one or more components of the transgene optimized for depletion of CpG dinucleotides, wherein the expressed CRISPR nuclease and gRNA retain at least about 60%, at least about 70%, at least about 80%, or at least about 90% of the editing potential for a target nucleic acid compared to an rAAV wherein the transgene has not been optimized for depletion of CpG dinucleotides, when assayed in an in vitro assay under comparable conditions. In a particular embodiment, the present disclosure provides rAAV wherein the one or more rAAV component sequences optimized for depletion of CpG dinucleotides that retain editing potential are selected from the group of sequences consisting of SEQ ID NOS: 9327-9333, 9369-9380, and 3735-3772, or a sequence having at least about 80%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto.
[0330] The embodiments of the rAAV comprising the one or more components of the transgene optimized for depletion of CpG dinucleotides have, as an improved characteristic, a lower potential for inducing an immune response, either in vivo (when administered to a subject) or in in vitro mammalian cell assays designed to detect markers of an inflammatory response. In some embodiments, the administration of a therapeutically effective dose of the rAAV comprising the one or more components of the transgene optimized for depletion of CpG dinucleotides to a subject results in a reduced immune response compared to the immune response of a comparable rAAV wherein the transgene has not been optimized for depletion of CpG dinucleotides, wherein the reduced response is determined by the measurement of one or more parameters such as production of antibodies or a delayed-type hypersensitivity to an rAAV component, or the production of inflammatory cytokines and markers, such as, but not limited to TLR9, interleukin-1 (IL-1), IL-6, IL-12, IL-18, tumor necrosis factor alpha (TNF-), interferon gamma (IFN), and granulocyte-macrophage colony stimulating factor (GM-CSF). In some embodiments, the rAAV comprising the one or more components of the transgene that are substantially devoid of CpG dinucleotides elicits reduced production of one or more inflammatory markers selected from the group consisting of TLR9, interleukin-1 (IL-1), IL-6, IL-12, IL-18, tumor necrosis factor alpha (TNF-), interferon gamma (IFN), and granulocyte-macrophage colony stimulating factor (GM-CSF) of at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 80%, or at least about 90% compared to the comparable rAAV that is not CpG depleted, when assayed in a cell-based vitro assay using cells known in the art appropriate for such assays; e.g., monocytes, macrophages, T-cells, B-cells, etc. In a particular embodiment, the rAAV comprising the one or more components of the transgene optimized for depletion of CpG dinucleotides exhibits a reduced activation of TLR9 in hNPCs in an in vitro assay of at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 80%, or at least about 90% compared to the comparable rAAV that is not CpG depleted.
IX. Kits and Articles of Manufacture
[0331] In other embodiments, provided herein are kits comprising an rAAV of any of the embodiments of the disclosure, and a suitable container (for example a tube, vial or plate).
[0332] In some embodiments, the kit further comprises a buffer, a nuclease inhibitor, a protease inhibitor, a liposome, a therapeutic agent, a label, a label visualization reagent, or any combination of the foregoing. In some embodiments, the kit further comprises a pharmaceutically acceptable carrier, diluent or excipient.
[0333] In some embodiments, the kit comprises appropriate control compositions for gene modifying applications, and instructions for use.
ENUMERATED EMBODIMENTS
[0334] The following sets of enumerated embodiments are included for illustrative purposes and are not intend to limit the scope of the invention.
Set I
[0335] Embodiment I-1. A polynucleotide comprising the following component sequences: [0336] a. a first AAV inverted terminal repeat (ITR) sequence as disclosed in the present disclosure; [0337] b. a second AAV ITR sequence as disclosed in the present disclosure; [0338] c. a first promoter sequence as disclosed in the present disclosure; [0339] d. a sequence encoding a CRISPR protein as disclosed in the present disclosure; [0340] e. a sequence encoding a first guide RNA (gRNA) as disclosed in the present disclosure; and, [0341] f. optionally, at least one accessory element sequence as disclosed in the present disclosure, wherein the polynucleotide is configured for incorporation into a recombinant adeno-associated virus (AAV).
[0342] Embodiment I-2. The polynucleotide of embodiment I-1, wherein the first AAV ITR, the second AAV ITR, the first promoter sequence, the sequence encoding the CRISPR protein, the sequence encoding the first gRNA, the at least one accessory element sequence, or a combination thereof, is modified to reduce or deplete at least one CpG dinucleotide.
[0343] Embodiment I-3. The polynucleotide of embodiment I-1 or embodiment I-2, wherein the first promoter sequence is a muscle-specific promoter.
[0344] Embodiment I-4. The polynucleotide of any one of embodiments 1-3, wherein the accessory element sequence encodes a muscle-specific accessory element.
[0345] Embodiment I-5. The polynucleotide of any one of embodiments 1-4, wherein the gRNA is modified to exhibit improved activity for double strand DNA cleavage.
[0346] Embodiment I-6. The polynucleotide of any one of embodiments 1-5 wherein the CRISPR protein is modified to exhibit improved activity for double strand DNA cleavage or spacer specificity at TTC, ATC, or CTC PAM sequences.
Set II
[0347] Embodiment II-1. A recombinant adeno-associated virus (rAAV) transgene wherein [0348] a. the transgene comprises: [0349] i) a polynucleotide sequence encoding a CasX protein comprising a sequence selected from the group consisting of SEQ ID NOS: 137-512, 9382-9542, and 9607-9609, or a sequence having at least about 70% sequence identity thereto; and [0350] ii) a polynucleotide sequence encoding a first guide RNA (gRNA) comprising a targeting sequence of 15 to 20 nucleotides complementary to a target nucleic acid of a cell; [0351] b. the transgene has less than about 4700 nucleotides; and [0352] c. the rAAV transgene is configured for incorporation into a rAAV capsid.
[0353] Embodiment II-2. The rAAV transgene of embodiment II-1, wherein the CasX protein comprises a sequence selected from the group consisting of SEQ ID NOS: 137-512, 9382-9542 and 9607-9609.
[0354] Embodiment II-3. The rAAV of embodiment II-1 or II-2, wherein the wherein the CasX protein is a CasX variant selected from the group consisting of SEQ ID NOS: 9385, 9391, 9393, 9401, 9409, 9417, 9419, 9423, 9429, 9443, 9444, 9447, 9449, 9450, 9452, 9453, 9455, 9456, 9458, 9462, 9466, 9469, 9470, 9472, 9478, 9483, 9485, 9491, 9495, 9499, 9501, 9512, 9513, 9517, 9519, 9521, 9536, 9542, 9607, and 9609, wherein the encoded CasX variant exhibits improved editing of a target nucleic acid in an in vitro assay, compared to a CasX variant of SEQ ID NO: 197 and assayed under comparable conditions.
[0355] Embodiment II-4. The rAAV of embodiment II-1 or II-2, wherein the wherein the CasX protein is a CasX variant selected from the group consisting of SEQ ID NOS: 9385, 9386, 9388, 9390, 9409, 9412, 9417, 9432, 9433, 9434, 9436, 9437, 9438, 9440, 9441, 9443, 9444, 9446, 9447, 9448, 9450, 9452, 9455, 9459, 9464, 9466, 9468, 9469, 9470, 9472, 9474, 9478, 9479, 9480, 9481, 9486, 9487, 9488, 9492, 9493, 9496, 9509, 9512, 9516, 9517, 9519, 9521, 9522, 9529, 9536, 9542, 9608, and 9609, wherein the encoded CasX variant exhibits improved editing specificity of a target nucleic acid in an in vitro assay, compared to a CasX variant of SEQ ID NO: 197 and assayed under comparable conditions.
[0356] Embodiment II-5. The rAAV of embodiment II-1 or II-2, wherein the wherein the CasX protein is a CasX variant selected from the group consisting of SEQ ID NOS: 9385, 9386, 9388, 9390, 9393, 9409, 9412, 9417, 9432, 9433, 9434, 9436, 9437, 9438, 9440, 9441, 9443, 9444, 9446, 9447, 9448, 9450, 9452, 9455, 9459, 9464, 9466, 9468, 9469, 9470, 9472, 9474, 9478, 9479, 9480, 9481, 9483, 9486, 9488, 9491, 9492, 9493, 9495, 9496, 9509, 9512, 9513, 9516, 9517, 9519, 9521, 9522, 9529, 9536, 9542, 9608, and 9609, wherein the encoded CasX variant exhibits improved editing specificity ratio of a target nucleic acid in an in vitro assay, compared to a CasX variant of SEQ ID NO: 197 and assayed under comparable conditions.
[0357] Embodiment II-6. The rAAV of embodiment II-1 or II-2, wherein the wherein the CasX protein is a CasX variant selected from the group consisting of SEQ ID NOS: 9385, 9409, 9417, 9443, 9444, 9447, 9450, 9452, 9455, 9466, 9469, 9470, 9472, 9478, 9512, 9513, 9517, 9519, 9521, 9536, 9542, and 9609, wherein the encoded CasX variant exhibits improved editing and improved specificity of a target nucleic acid in an in vitro assay, compared to a CasX variant of SEQ ID NO: 197 and assayed under comparable conditions.
[0358] Embodiment II-7. The rAAV of embodiment II-1 or II-2, wherein the wherein the CasX protein is a CasX variant selected from the group consisting of SEQ ID NOS: 9385, 9393, 9409, 9417, 9443, 9444, 9447, 9450, 9452, 9455, 9466, 9469, 9470, 9472, 9478, 9483, 9491, 9495, 9512, 9513, 9517, 9519, 9521, 9536, 9542, and 9609, wherein the encoded CasX variant exhibits improved editing and improved specificity ratio of a target nucleic acid in an in vitro assay, compared to a CasX variant of SEQ ID NO: 197 and assayed under comparable conditions.
[0359] Embodiment II-8. The rAAV transgene of embodiment II-2, wherein the CasX protein comprises a sequence selected from the group consisting of SEQ ID NOS: 190 and 197.
[0360] Embodiment II-9. The rAAV transgene of any one of embodiments II-1 to II-7, wherein the transgene further comprises one or more components selected from the group consisting of: [0361] a. a first and a second rAAV inverted terminal repeat (ITR) sequence; [0362] b. a first promoter sequence operably linked to the Type V CRISPR protein; [0363] c. a sequence encoding a nuclear localization signal (NLS); [0364] d. a 3 UTR; [0365] e. a poly(A) signal sequence; [0366] f. a second promoter operably linked to the first gRNA; and [0367] g. an accessory element.
[0368] Embodiment II-10. The rAAV transgene of embodiment II-9, wherein the first promoter is a pol II promoter selected from the group consisting of polyubiquitin C (UBC) promoter, cytomegalovirus (CMV) promoter, simian virus 40 (SV40) promoter, chicken beta-Actin promoter and rabbit beta-Globin splice acceptor site fusion (CAG), chicken -actin promoter with cytomegalovirus enhancer (CB7), PGK promoter, Jens Tornoe (JeT) promoter, GUSB promoter, CBA hybrid (CBh) promoter, elongation factor-1 alpha (EF-1alpha) promoter, beta-actin promoter, Rous sarcoma virus (RSV) promoter, silencing-prone spleen focus forming virus (SFFV) promoter, CMVd1 promoter, truncated human CMV (tCMVd2) promoter, minimal CMV promoter, hepB promoter, chicken -actin promoter, HSV TK promoter, Mini-TK promoter, minimal IL-2 promoter, GRP94 promoter, Super Core Promoter 1, Super Core Promoter 2, Super Core Promoter 3, adenovirus major late (AdML) promoter, MLC promoter, MCK promoter, GRK1 protein promoter, Rho promoter, CAR protein promoter, hSyn Promoter, U1a promoter, Ribosomal Protein Large subunit 30 (Rp130) promoter, Ribosomal Protein Small subunit 18 (Rps18) promoter, CMV53 promoter, minimal SV40 promoter, CMV53 promoter, SFCp promoter, Mecp2 promoter, pJB42CAT5 promoter, MLP promoter, EFS promoter, rhodopsin promoter, MeP426 promoter, MecP2 promoter, Desmin promoter, MHCK promoter, MHCK7 promoter, beta-glucuronidase (GUSB) promoter, CK7 promoter, and CK8e promoter.
[0369] Embodiment II-11. The rAAV transgene of embodiment II-9 or II-10, wherein the first promoter is a pol II promoter selected from the group consisting of U1A, UbC, and JeT.
[0370] Embodiment II-12. The rAAV transgene of any one of embodiments II-9 to II-13, wherein the first promoter comprises a sequence selected from the group consisting of SEQ ID NOS: 3532-3562, 3714-3739, 3773-3778, and 9344-9350, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
[0371] Embodiment II-13. The polynucleotide of any one of embodiments II-9 to II-12, wherein the first promoter sequence has less than about 400 nucleotides, less than about 350 nucleotides, less than about 300 nucleotides, less than about 200 nucleotides, less than about 150 nucleotides, less than about 100 nucleotides, less than about 80 nucleotides, or less than about 40 nucleotides.
[0372] Embodiment II-14. The rAAV transgene of any one of embodiments II-9, wherein the second promoter is a pol III promoter selected from the group consisting of human U6 promoter, human U6 variant promoter, human U6 isoform variant promoter, mini U61 promoter, mini U62 promoter, mini U63 promoter, BiH1 (Bidrectional H1 promoter), BiU6 (Bidirectional U6 promoter), gorilla U6 promoter, rhesus U6 promoter, human 7sk promoter, and human H1 promoter.
[0373] Embodiment II-15. The rAAV transgene of embodiment II-14, wherein the second promoter is a pol III promoter selected from the group consisting of human U6, human U6 variant, or human U6 isoform variant.
[0374] Embodiment II-16. The rAAV transgene of embodiment II-15, wherein the second promoter comprises a sequence selected from the group consisting of SEQ ID NOS: 3563, 3566-3582, 3599-3602, 3740-3746, 4025, 4029, 4032, and 4743 or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
[0375] Embodiment II-17. The rAAV transgene of any one of embodiments II-14 to II-16, wherein the second promoter sequence has less than about 250 nucleotides, less than about 220 nucleotides, less than about 200 nucleotides, less than about 160 nucleotides, less than about 140 nucleotides, less than about 130 nucleotides, less than about 120 nucleotides, less than about 100 nucleotides, less than about 80 nucleotides, or less than about 70 nucleotides.
[0376] Embodiment II-18. The rAAV transgene of any one of embodiments II-9, wherein the poly(A) signal sequence is selected from the group consisting of SEQ ID NOS: 2401-3401, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
[0377] Embodiment II-19. The rAAV transgene of any one of embodiments II-9, wherein the encoded NLS comprises a sequence selected from the group consisting of SEQ ID NOS: 3411-3486, 3939-3971, and 4065-4111.
[0378] Embodiment II-20. The rAAV transgene of any one of embodiments II-1 to II-19, wherein the transgene comprises a polynucleotide sequence encoding a second gRNA with a linked targeting sequence of 15 to 20 nucleotides complementary to a different or overlapping region of a target nucleic acid of a cell, as compared to the targeting sequence of the first gRNA.
[0379] Embodiment II-21. The rAAV transgene of any one of embodiments II-1 to II-20, wherein the first and/or the second gRNA each comprise: [0380] a. a scaffold sequence selected from the group consisting of SEQ ID NOS: 2238-2400, 9257-9289 and 9588, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto; or [0381] b. a scaffold sequence selected from the group consisting of SEQ ID NOS: 2238-2400, 9257-9289 and 9588, further comprising at least 1, 2, 3, 4, or 5 mismatches thereto.
[0382] Embodiment II-22. The rAAV transgene of embodiment II-20 or II-21, wherein the first and the second gRNA each comprise a scaffold sequence of SEQ ID NO: 2293 or SEQ ID NO: 9588.
[0383] Embodiment II-23. The rAAV transgene of any one of embodiments II-20 to II-22, comprising a third promoter operably linked to the second gRNA.
[0384] Embodiment II-24. The rAAV transgene of embodiment II-23, wherein the third promoter is a pol III promoter selected from the group consisting of human U6, human U6 variant, human U6 isoform variant, mini U61, mini U62, mini U63, BiH1 (Bidirectional H1 promoter), BiU6 (Bidirectional U6 promoter), gorilla U6, rhesus U6, human 7sk, and human H1 promoters.
[0385] Embodiment II-25. The rAAV transgene of embodiment II-23, wherein the third promoter is a pol III promoter selected from the group consisting of human U6, human U6 variant, and human U6 isoform variant.
[0386] Embodiment II-26. The rAAV transgene of any one of embodiments II-23 to II-25, wherein the third promoter comprises a sequence selected from the group consisting of SEQ ID NOS: 3563, 3566-3582, 3599-3602, 3740-3746, 4025, 4029, 4032, and 4743, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
[0387] Embodiment II-27. The rAAV transgene of any one of embodiments II-23 to II-26, wherein the third promoter sequence has less than about 250 nucleotides, less than about 220 nucleotides, less than about 200 nucleotides, less than about 160 nucleotides, less than about 140 nucleotides, less than about 130 nucleotides, less than about 120 nucleotides, less than about 100 nucleotides, less than about 80 nucleotides, or less than about 70 nucleotides.
[0388] Embodiment II-28. The rAAV transgene of any one of embodiments II-20 to II-27, wherein: [0389] a. the polynucleotide sequence encoding the first gRNA and the polynucleotide sequence encoding the second gRNA are 5 of the polynucleotide sequence encoding the CasX protein; [0390] b. the polynucleotide sequence encoding the first gRNA is 5 of the polynucleotide sequence encoding the CasX protein and the polynucleotide sequence encoding the second gRNA is 3 of the polynucleotide sequence encoding the CasX protein; [0391] c. the polynucleotide sequence encoding the first gRNA is 3 of the polynucleotide sequence encoding the CasX protein and the polynucleotide sequence encoding the second gRNA is 5 of the polynucleotide sequence encoding the CasX protein; or [0392] d. the polynucleotide sequence encoding the first gRNA and the polynucleotide sequence encoding the second gRNA are 3 of the polynucleotide sequence encoding the CasX protein.
[0393] Embodiment II-29. The rAAV transgene of any one of embodiments II-20 to II-28, wherein: [0394] a. the polynucleotide sequence encoding the first gRNA and the polynucleotide sequence encoding the second gRNA are encoded in a forward orientation relative to the polynucleotide sequence encoding the CasX protein; [0395] b. the polynucleotide sequence encoding the first gRNA is encoded in a forward orientation relative to the polynucleotide sequence encoding the CasX protein and the polynucleotide sequence encoding the second gRNA is encoded in a reverse orientation relative to the polynucleotide sequence encoding the CasX protein; [0396] c. the polynucleotide sequence encoding the first gRNA is encoded in a reverse orientation relative to the polynucleotide sequence encoding the CasX protein and the polynucleotide sequence encoding the second gRNA is encoded in a forward orientation relative to the polynucleotide sequence encoding the CasX protein; or [0397] d. the polynucleotide sequence encoding the first gRNA and the polynucleotide sequence encoding the second gRNA are encoded in a reverse orientation relative to the polynucleotide sequence encoding the CasX protein.
[0398] Embodiment II-30. The rAAV transgene of any one of embodiments II-20 to II-29, wherein the transgene has less than about 4800, less than about 4750, less than about 4700, less than about 4650 nucleotides, or less than about 4600 nucleotides.
[0399] Embodiment II-31. The rAAV transgene of any one of embodiments II-20 to II-30, wherein the rAAV transgene is configured for incorporation into an rAAV capsid.
[0400] Embodiment II-32. The rAAV transgene of any one of embodiments II-1 to II-31, wherein one or more components of the transgene are optimized to reduce or deplete CpG motifs.
[0401] Embodiment II-33. The rAAV transgene of embodiment II-32, wherein the one or more components comprise less than about 10%, less than about 5%, or less than about 1% CpG dinucleotides.
[0402] Embodiment II-34. The rAAV transgene of embodiment II-32 or II-33, wherein the CpG-depleted polynucleotide sequence encoding the CasX protein is selected from the group consisting of SEQ ID NOS: 9327-9333 and 9369-9380.
[0403] Embodiment II-35. The rAAV transgene of embodiment II-32 or II-33, wherein the CpG-depleted polynucleotide sequence encodes a gRNA scaffold, and is selected from the group consisting of SEQ ID NOS: 3751-3772.
[0404] Embodiment II-36. The rAAV transgene of embodiment II-32 or II-33, wherein the CpG-depleted polynucleotide sequence of the ITR is selected from the group consisting of SEQ ID NOS: 3749 and 3750.
[0405] Embodiment II-37. The rAAV transgene of embodiment II-32 or II-33, wherein the CpG-depleted polynucleotide sequence of the promoter is selected from the group consisting of SEQ ID NOS: 3735-3746.
[0406] Embodiment II-38. The rAAV transgene of embodiment II-32 or II-33, wherein the CpG-depleted polynucleotide sequence of the poly(A) signal is SEQ ID NO: 3748.
[0407] Embodiment II-39. The rAAV transgene of any one of embodiments II-1 to II-38, wherein the transgene has the configuration of a construct depicted in any one of
[0408] Embodiment II-40. A recombinant adeno-associated virus (rAAV) comprising: [0409] a. an AAV capsid protein, and [0410] b. the transgene of any one of embodiments II-1 to II-39.
[0411] Embodiment II-41. The rAAV of embodiment II-40, wherein the AAV capsid protein is derived from serotype AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV 11, AAV12, AAV 9.45, AAV 9.61, AAV 44.9, AAV-Rh74, AAVRh10, MyoAAV 1A1, MyoAAV 1A2, or MyoAAV 2A.
[0412] Embodiment II-42. The rAAV of embodiment II-41, wherein the AAV capsid protein and the 5 and 3 ITR are derived from the same serotype of AAV.
[0413] Embodiment II-43. The rAAV of embodiment II-41, wherein the AAV capsid protein and the 5 and 3 ITR are derived from different serotypes of AAV.
[0414] Embodiment II-44. The rAAV of embodiment II-43, wherein the 5 and 3 ITR are derived from AAV serotype 2.
[0415] Embodiment II-45. The rAAV of any one of embodiments II-40 to II-44, wherein upon transduction of a cell with the rAAV, the CasX protein and the first and/or the second gRNA encoded in the rAAV transgene are expressed.
[0416] Embodiment II-46. The rAAV of embodiment II-45, wherein upon expression, the first and/or the second gRNA is capable of forming a ribonucleoprotein (RNP) complex with the CasX protein.
[0417] Embodiment II-47. The rAAV of embodiment II-46, wherein the RNP is capable of binding and modifying a target nucleic acid of the cell.
[0418] Embodiment II-48. The rAAV of any one of embodiments II-40 to II-47, wherein inclusion of a poly(A) signal in the transgene enhances expression of the CasX protein and editing efficiency of a target nucleic acid in a cell transduced by the rAAV.
[0419] Embodiment II-49. The rAAV of any one of embodiments II-40 to II-47, wherein inclusion of a posttranscriptional regulatory element (PTRE) accessory element in the transgene enhances editing efficiency of a target nucleic acid in a cell transduced by the rAAV.
[0420] Embodiment II-50. The rAAV of embodiment II-49, wherein the PTRE comprises a sequence selected from the group consisting of SEQ ID NOS: 3615-3617, or a sequence having at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity thereto.
[0421] Embodiment II-51. The rAAV of any one of embodiments II-40 to II-50, wherein components of the transgene modified for depletion of all or a portion of the CpG dinucleotides exhibit a lower potential for inducing an immune response in a cell transduced with the rAAV, compared to a rAAV wherein the components are not modified for depletion of the CpG dinucleotides.
[0422] Embodiment II-52. The rAAV of embodiment II-51, wherein the lower potential for inducing an immune response is exhibited in an in vitro mammalian cell assay designed to detect production of one or more markers of an inflammatory response selected from the group consisting of TLR9, interleukin-1 (IL-1), IL-6, IL-12, IL-18, tumor necrosis factor alpha (TNF-a), interferon gamma (IFN), and granulocyte-macrophage colony stimulating factor (GM-CSF).
[0423] Embodiment II-53. The rAAV of embodiment II-51 or II-52, wherein the rAAV comprising the component sequences modified for depletion of all or a portion of the CpG dinucleotides elicits reduced production of the one or more inflammatory markers of at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 80%, or at least about 90% less compared to the comparable rAAV that is not CpG depleted.
[0424] Embodiment II-54. The rAAV of any one of embodiments II-51 to II-53, wherein the expressed CasX and the first and/or the second gRNA retain at least about 60%, at least about 70%, at least about 80%, or at least about 90% of the editing potential for a target nucleic acid compared to an rAAV wherein the transgene has not been optimized for depletion of CpG dinucleotides, when assayed in an in vitro assay under comparable conditions.
[0425] Embodiment II-55. The rAAV of embodiment II-40, wherein incorporation of a Pol II promoter selected from the group consisting of CK8e, MHCK7, and MHCK in the transgene of a rAAV used to transduce a muscle cell results in higher expression of the CasX protein in the muscle cell compared to incorporation of a UbC promoter.
[0426] Embodiment II-56. The rAAV of embodiment II-40, wherein incorporation of a muscle enhancer sequence selected from the group consisting of SEQ ID NOS: 3779-3809 in the transgene of a rAAV used to transduce a muscle cell results in higher expression of the CasX protein in the muscle cell compared to a rAAV not incorporating the muscle enhancer.
[0427] Embodiment II-57. A method for modifying a target nucleic acid of a gene in a population of mammalian cells, comprising contacting a plurality of the cells with an effective amount of the rAAV of any one of embodiments II-40 to II-56, wherein the target nucleic acid of the gene targeted by the first and/or the second gRNA is modified by the expressed CasX protein.
[0428] Embodiment II-58. The method of embodiment II-57, wherein the gene comprises one or more mutations.
[0429] Embodiment II-59. The method of embodiment II-57 or II-58, wherein the modifying comprises introducing an insertion, deletion, substitution, duplication, or inversion of one or more nucleotides in the target nucleic acid of the cells of the population.
[0430] Embodiment II-60. The method of any one of embodiments II-57 to II-59, wherein the gene is knocked down or knocked out.
[0431] Embodiment II-61. The method of any one of embodiments II-57 to II-59, wherein the gene is modified such that a functional gene product can be expressed.
[0432] Embodiment II-62. The method of any one of embodiments II-57 to II-61, wherein the rAAV comprises the first and the second gRNA, wherein the second gRNA comprises a targeting sequence complementary to a different target site in a gene targeted by the targeting sequence of the first gRNA, wherein the nucleotides between the target sites are excised by cleavage of the target sites by the CasX protein.
[0433] Embodiment II-63. The method of any one of embodiments II-57 to II-61, wherein the rAAV comprises the first and the second gRNA, wherein the second gRNA comprises a targeting sequence complementary to a target site in a different gene targeted by the targeting sequence of the first gRNA, wherein the target nucleic acid at each target site is modified by the CasX protein.
[0434] Embodiment II-64. A method of treating a disease in a subject caused by one or more mutations in a gene of the subject, comprising administering a therapeutically effective dose of the rAAV of any one of embodiments II-40 to II-56 to the subject.
[0435] Embodiment II-65. The method of embodiment II-62, wherein the rAAV is administered to the subject by a route of administration selected from subcutaneous, intradermal, intraneural, intranodal, intramedullary, intramuscular, intralumbar, intrathecal, subarachnoid, intraventricular, intracapsular, intravenous, intralymphatical, intraocular and intraperitoneal routes, and wherein the administration method is injection, transfusion, or implantation.
[0436] Embodiment II-66. The method of embodiment II-64 or II-65, wherein the subject is selected from the group consisting of mouse, rat, pig, and non-human primate.
[0437] Embodiment II-67. The method of embodiment II-64 or II-65, wherein the subject is a human.
[0438] Embodiment II-68. A method of making a rAAV, comprising: [0439] a. providing a population of packaging cells; and [0440] b. transfecting the population of cells with: [0441] i) a vector comprising the transgene of any one of embodiments II-1 to II-39; [0442] ii) a vector comprising an Assembly-Activating Protein (AAP) gene; and [0443] iii) a vector comprising rep and cap genomes.
[0444] Embodiment II-69. The method of embodiment II-68, wherein the packaging cell is selected from the group consisting of BHK cells, HEK293 cells, HEK293T cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells, hybridoma cells, NIH3T3 cells, COS cells, HeLa cells, and CHO cells.
[0445] Embodiment II-70. The method of embodiment II-68 or II-69, the method further comprising recovering the rAAV.
[0446] Embodiment II-71. The method of any one of embodiments II-68 to II-70, wherein the component sequences of the transgene are encompassed in a single recombinant adeno-associated virus particle.
[0447] Embodiment II-72. A composition of a recombinant adeno-associated virus of any one of embodiments II-35 to II-56, for use in the manufacture of a medicament for the treatment of a disease in a human in need thereof.
[0448] Embodiment II-73. A kit comprising the rAAV of any one of embodiment II-35 to II-56 and a suitable container.
[0449] Embodiment II-74. The kit of embodiment II-73, comprising a pharmaceutically acceptable carrier, diluent, buffer, or excipient.
EXAMPLES
Example 1: Small Class 2, Type V CRISPR Proteins can Edit the Genome when Expressed from an AAV Episome In Vitro
[0450] Experiments were conducted to demonstrate that small Class 2, Type V CRISPR proteins can edit a genome when expressed from an AAV plasmid or an AAV vector in vitro.
Materials and Methods
[0451] The AAV transgene between the ITRs was broken into different parts, which consisted of the therapeutic cargo and accessory elements relevant to expression of the therapeutic cargo in mammalian cells. AAV vectorology consisted of identifying a parts list and subsequently designing, building, and testing vectors in both plasmid and AAV form in mammalian cells. A schematic of a representative AAV transgene and one configuration of its components is shown in
[0452] In this first example, three plasmids were constructed (construct 1, construct 2, and construct 3; see Table 45 for component sequences), where the only difference in the plasmid sequence between the ITRs was in the affinity tag region.
Cloning and QC:
[0453] AAV vectors were cloned using a 4-part Golden Gate Assembly consisting of a pre-digested AAV backbone, small CRISPR protein-encoding DNA, and flanking 5 and 3 DNA sequences. 5 sequences contained enhancer, protein promoter and N-terminal NLS, while 3 sequences contained C-terminal NLS, Woodchuck Hepatitis Virus (WHV) Posttranscriptional Regulatory Element (WPRE), poly(A) signal, RNA promoter and guide RNA containing spacer 12.7, targeting tdTomato (DNA sequence: CTGCATTCTAGTTGTGGTTT (SEQ ID NO: 4049)). 5 and 3 parts were ordered as gene fragments, PCR-amplified, and assembled into AAV vectors through cyclical Golden Gate reactions using T4 Ligase and BbsI.
[0454] Assembled AAV vectors were then transformed into chemically-competent E. coli (Stbl3s). Transformed cells were recovered for 1 hour in a 37 C. shaking incubator, plated on Kanamycin LB-Agar plates and allowed to grow at 37 C. for 12-16 hours. Colony PCR was performed to determine clones that contained full transgenes. Correct clones were inoculated in 50 mL of LB media with kanamycin and grown overnight. Plasmids were then midiprepped the following day and sequence-verified. To assess the quality of plasmid preparations, constructs were processed in restriction digests with XmaI (which cuts in each of the ITRs) and XhoI (which cuts once in the AAV genome). Digests and uncut constructs were then run on a 1% agarose gel and imaged on a ChemiDoc. If the plasmid was >90% supercoiled, the correct size, and the ITRs were intact, the construct was tested via nucleofection and/or transduction.
Method for Plasmid Nucleofection:
[0455] Plasmids containing the AAV genome were transfected in a mouse immortalized neural progenitor cell line isolated from the Ai9-tdTomato mouse neuroprogenitor cells (tdTomato mNPCs) using the Lonza P3 Primary Cell 96-well Nucleofector Kit. Briefly, Ai9 is a Cre reporter tool strain designed to have a loxP flanked STOP cassette preventing the transcription of a CAG promoter-driven tdTomato marker. Ai9 mice, or Ai9 mNPCs, express tdTomato following Cre-mediated recombination to remove the STOP cassette. Sequence-validated plasmids were diluted to concentrations of 200 ng/l, 100 ng/l, 50 ng/L and 25 ng/L, and 5 L of each (1000 ng, 500 ng, 250 ng and 125 ng) were added to P3 solution containing 200,000 tdTomato mNPCs. The combined solution was nucleofected using a Lonza 4D Nucleofector System following program EH-100. Following nucleofection, the solution was quenched with pre-equilibrated mNPC medium (DMEM/F12 with GlutaMax, 10 mM HEPES, 1MEM Non-Essential Amino Acids, 1 penicillin/streptomycin, 1:1000 2-mercaptoethanol, 1B-27 supplement, minus vitamin A, 1N2 with supplemented growth factors bFGF and EGF (20 ng/mL final concentration). The solution was then aliquoted in triplicate (approx. 67,000 cells per well) in a 96-well plate coated with PLF (1 Poly-DL-ornithine hydrobromide, 10 mg/mL in sterile diH20, 1 laminin, and 1 fibronectin). 48 hours after transfection, treated cells were replenished with fresh mNPC media containing growth factors. 5 days after transfection, tdTomato mNPCs were lifted and activity was assessed by fluorescence activated cell sorting (FACS).
AAV production:
[0456] Suspension HEK293T cells were adapted from parental HEK293T and grown in FreeStyle 293 media. For screening purposes, small scale cultures (20-30 mL cultured in 125 mL Erlenmeyer flasks and agitated at 110 rpm) were diluted to a density of 1.5e+6 cells/mL on the day of transfection. Endotoxin-free pAAV plasmids with the transgene flanked by ITR repeats were co-transfected with plasmids supplying the adenoviral helper genes for replication and encoding AAV rep/cap proteins using PEI MAX (Polysciences) in serum-free OPTI-MEM media. Cultures were supplemented with 10% CDM4HEK293 (HyClone) 3 hours post-transfection. Three days later, cultures were centrifuged at 1000 rpm for 10 minutes to separate the supernatant from the cell pellet. The supernatant was mixed with 40% PEG 2.5M NaCl (8% final concentration) and incubated on ice for at least 2 hours to precipitate AAV viral particles. The cell pellet, containing the majority of the AAV vectors, was resuspended in lysis media (0.15 M NaCl, 50 mM Tris HCl, 0.05% Tween, pH 8.5), sonicated on ice (15 seconds, 30% amplitude) and treated with Benzonase (250 U/L, Novagen) for 30 minutes at 37 C. Crude lysate and PEG-treated supernatant were then centrifuged at 4000 rpm for 20 minutes at 4 C. to resuspend the PEG precipitated AAV (pellet) with cell debris-free crude lysate (supernatant), and then clarified further using a 0.45 M filter.
[0457] To determine the viral genome titer, 1 L from crude lysate containing viruses was digested with DNase and proteinase K, followed by quantitative PCR. 5 L of digested virus was used in a 25 L qPCR reaction composed of IDT primetime master mix and a set of primer and 6FAM/Zen/IBFQ probe (IDT) designed to amplify the CMV promoter region or a 62 nucleotide-fragment located in the AAV2-ITR. Ten-fold serial dilutions of an AAV ITR plasmid was used as reference standards to calculate the titer (viral genome (vg)/mL) of viral samples.
AAV Transduction:
[0458] 10,000 cells/well of mNPCs were seeded on PLF-coated wells in 96-well plates 48-hours before AAV transduction. All viral infection conditions were performed in triplicate, with normalized number of vg among experimental vectors, in a series of 3-fold dilution of multiplicity of infection (MOI) ranging from 1.0e+6 to 1.0e+4 vg/cell. Final volumes of 50 L of AAV vectors diluted in pre-equilibrated mNPC medium supplemented with bFGF/EGF growth factors (20 ng/ml final concentration) were applied to each well. 48 hours post-transfection, a complete media change was performed with fresh media supplemented with growth factors. Editing activity (tdT+ cell quantification) was assessed by FACS 5 days post-transfection.
Method for Assessing Activity by FACS:
[0459] Five days after transfection, treated tdTomato mNPCs in 96-well plates were washed with dPBS and treated with 50 L TrypLE for 15 minutes. Following cell dissociation, treated wells were quenched with media containing DMEM, 10% FBS and 1 penicillin/streptomycin. Resuspended cells were transferred to round-bottom 96-well plates and centrifuged for 5 min at 1000g. Cell pellets were then resuspended with dPBS containing 1DAPI, and plates were loaded into an Attune NxT Flow Cytometer Autosampler. The Attune NxT flow cytometer was run using the following gating parameters: FSC-ASSC-A to select cells, FSC-HFSC-A to select single cells, FSC-AVL1-A to select DAPI-negative alive cells, and FSC-AYL1-A to select tdTomato positive cells.
Results
[0460] The results in the graph in
[0461] The experiments demonstrate that small Class 2, Type V CRISPR proteins (such as CasX) and targeted guides can edit the genome when expressed from an AAV transgene plasmid or episome in vitro.
Example 2: Packaging of Small Class 2, Type V CRISPR Systems within an AAV Vector
[0462] Experiments were conducted to demonstrate that systems of small Class 2, Type V CRISPR proteins such as CasX and gRNA can be encoded and efficiently packaged within a single AAV vector.
Materials and Methods
[0463] For this experiment, AAV vectors were generated with transgenes packaging CasX variant 438, gRNA scaffold 174 and spacer 12.7 using the methods for AAV production, purification and characterization, as described in Example 1. For characterization, AAV viral genomes were titered by qPCR, and the empty-full ratio was quantified using scanning transmission electron microscopy (STEM). The AAV were negatively stained with 1% uranyl acetate and visualized. Empty particles were identified by presence of a dark electron dense circle at the center of the capsid.
Results
[0464] The genomic DNA titers (by qPCR) for the AAV preparation was measured to be 6e12 vg/mL, generated from 1 L of HEK293T cell culture.
Example 3: In Vivo Editing of a Genome with Small Class 2, Type V CRISPR Proteins Expressed from an AAV Episome
[0465] Experiments were conducted to demonstrate that small Class 2, Type V CRISPR proteins, such as CasX, are capable of being delivered by AAV and can edit the genome when expressed from an AAV episome in vivo.
Materials and Methods
[0466] For this experiment, AAV vectors were generated using the methods for AAV production, purification and characterization, as described in Example 1.
In Vivo AAV Administration and Tissue Processing
[0467] P0-P1 pups from Ai9 mice were injected with AAV with a transgene encoding CasX variant 491 and guide variant 174 with spacer 12.7. Briefly, mice were cryo-anesthetized and 1-2 L of AAV vector (1e11 viral genomes (vg)) was unilaterally injected into the intracerebroventricular (ICV) space using a Hamilton syringe (10 L, Model 1701 RN SYR Cat No: 7653-01) fitted with a 33-gauge needle (small hub RN NDLcustom length 0.5 inches, point 4 (45 degrees)). Post-injection, pups were recovered on a warm heating pad before being returned to their cages. 1 month after ICV injections, animals were terminally anesthetized with an intraperitoneal injection of ketamine/xylazine, and perfused transcardially with saline and fixative (4% paraformaldehyde). Brains were dissected and further post-fixed in 4% PFA, followed by infiltration with 30% sucrose solution, and embedding in OCT compound. OCT-embedded brains were coronally sectioned using a cryostat. Sections were then mounted on slides, counter-stained with DAPI to label cell nuclei, cover slipped and imaged on a fluorescence microscope. Images were processed using ImageJ software and editing levels were quantified by counting the number of tdTom+ cells as a percentage of DAPI-labeled nuclei.
[0468] In a subsequent experiment to assess editing in peripheral tissues, particularly in the liver and in the heart, P0-P1 pups from Ai9 mice were cryo-anesthetized and were intravenously injected with 1e12 viral genomes (vg) of the same AAV construct in a 40 L volume. Post-injection, pups were recovered on a warm heating pad before being returned to their cages. 1-month post-administration, animals were terminally anesthetized and heart and liver tissues were necropsied and processed as described above.
Results
[0469]
[0470] The results demonstrate that that AAV encoding small CRISPR proteins (such as CasX) and a targeting guide can distribute within the tissues, when delivered either locally (brain) or systemically, and edit the target genome when expressed from single AAV episomes in vivo.
Example 4: Small CRISPR Protein Potency is Enhanced by AAV Vector Protein Promoter Choice
[0471] Experiments were conducted to demonstrate that small CRISPR protein expression and editing can be enhanced by utilizing different promoters in an AAV construct for the encoded protein. Cargo space in the AAV transgene can be maximized with the use of short promoters in combination with small CRISPR proteins such as CasX. Additionally, experiments were conducted to demonstrate that expression can be enhanced with the use of promoters that would otherwise be too long to be efficiently packaged in AAV vector, if they were combined with larger CRISPR proteins, such as Cas9. The use of long, cell-type-specific promoters to enhance small CRISPR proteins is an advantage to the AAV system described herein, and not possible in traditional CRISPR systems due to the size of traditional CRISPR proteins.
Materials and Methods
[0472] Cloning and QC were conducted as described in Example 1. Promoter variants (Table 7) were cloned upstream of CasX protein in an AAV-cis plasmid. The sequences of the additional components of the AAV constructs, with the exception of sequences encoding the CasX (Table 26) and the one or more gRNA (Tables 23 and 24), are listed in Table 45.
TABLE-US-00011 TABLE 7 Promoter variant sequences Promoter SEQ Construct Promoter length ID NO: ID based on (bp) 3532 1, 2, 3, 7, 44 CMV 584 3533 4 UbC 400 3534 5 EFS 234 3535 6 CMV-s 335 3536 8 CMVd1 100 3537 9 CMVd2 52 3538 10 miniCMV 39 3539 11, 26 HSVTK 146 3540 12 miniTK 63 3541 13 miniIL2 114 3542 14 GRP94 710 3543 15 Supercore 1 81 3544 16 Supercore 2 81 3545 17 Supercore 3 81 3546 18 Mecp2 229 3547 19 CMVmini 68 3548 20 CMVmini2 65 3549 21 miniCMVIE 39 3550 22 adML 81 3551 23 hepB 107 3552 54 RSV 227 3553 55 hSyn 448 3554 56 SV40 330 3555 57 hPGK 551 3556 58 Jet 164 3557 59 Jet + UsP intron 326 3558 60 hRLP30 325 3559 61 hRPS18 243 3560 62 CBA 493 3561 63 CBH 565 3562 64 CMV core 204
Method for Plasmid Nucleofection:
[0473] Immortalized neural progenitor cells were nucleofected as described in Example 1. Sequence-validated plasmids were diluted to concentrations of 200 ng/ul, 100 ng/ul, 50 ng/L and 25 ng/L, and 5 L of each (1000 ng, 500 ng, 250 ng and 125 ng) were added to P3 solution containing 200,000 tdTomato mNPCs.
[0474] AAV viral production and QC, and AAV transduction and editing level assessment in mNPTC-tdT cells by FACS were conducted as described in Example 1.
Results
[0475] The results of
[0476] The results of
[0477] The results of
[0478] The results shown in
[0479] In the experiments performed for the results portrayed in
[0480] The results demonstrate that expression of small CRISPR proteins (such as CasX) can be enhanced by utilizing long promoters that would otherwise be unusable in AAV constructs with traditional CRISPR proteins due to the size constraints of the AAV genome. Furthermore, combining short promoters with small CRISPR proteins (such as CasX) allows for significant reductions in AAV transgene cargo capacity without compromising expression efficiency. This conservation of space allows for the inclusion of additional accessory elements, such as enhancers and regulatory elements in the transgene, which would enable increased editing potential. Example 35 further demonstrates and evaluates various protein promoters on CasX protein editing activity in a cell-based assay.
Example 5: Potency of Small CRISPR Systems is Enhanced by AAV RNA Promoter Choice
[0481] Experiments were conducted to demonstrate that the editing potency of small CRISPR systems, such as CasX, can be enhanced if certain promoters are chosen for expression of the guide RNA, which recognizes target DNA for editing, in an AAV vector. By using RNA promoters with different strengths, guide RNA expression can be modulated, which affects editing potency. The AAV platform based on the CasX system provides enough cargo space in the AAV to include at least 2 independent promoters for the expression of two incorporated guide RNAs. By combining different promoters, expression of multiple guide RNAs can be tuned within a single AAV transgene. Engineering shorter versions of RNA promoters that still retain editing potency also results in increased space in the vector for the inclusion of other accessory elements in the AAV transgene.
Materials and Methods
[0482] The methods of Example 1 were used for cloning and quality control of the constructs, as well as for plasmid nucleofection and AAV production, transduction, and FACS analyses. The sequences of the Pol III promoters are presented in Table 8. The sequences of the additional components of the AAV constructs, with the exception of sequences encoding the CasX (Table 26) and the one or more gRNA (Tables 23 and 24), are listed in Table 45.
TABLE-US-00012 TABLE 8 Sequences of Pol III promoters. Promoter SEQ AAV Pol III length ID NO: construct ID promoter (bp) 3563 3, 53, 157 hU6 isoform 1 241 3564 32, 158 H1 215 3565 33 7SK 267 3566 85/89 hU6 variant 1 103 3567 86 hU6 variant 2 38 3568 87 hU6 variant 3 67 3569 88 hU6 variant 4 79 3570 90 hU6 variant 5 111 3571 91 hU6 variant 6 127 3572 92 hU6 variant 7 123 3573 93 hU6 variant 8 143 3574 94 hU6 variant 9 131 3575 95 hU6 variant 10 159 3576 96 hU6 variant 11 103 3577 97 hU6 variant 12 111 3578 98 hU6 variant 13 127 3579 99 hU6 variant 14 103 3580 100 hU6 variant 15 131 3581 101 hU6 variant 16 159 3582 102 hU6 variant 17 128 3583 159 H1 core 91 3584 160 H1 core + 7SK hybrid 1 92 3585 161 H1 core + 7SK hybrid 2 92 3586 162 H1 core + 7SK hybrid 3 91 3587 163 H1 core + 7SK hybrid 4 91 3588 164 H1 core + 7SK hybrid 5 92 3589 165 H1 core + 7SK hybrid 6 91 3590 166 H1 core + 7SK hybrid 7 91 3591 167 H1 core + 7SK hybrid 8 91 3592 168 H1 core + 7SK hybrid 9 92 3593 169 H1 core + U6 hybrid 1 91 3594 170 H1 core + U6 hybrid 2 94 3595 171 H1 core + 7SK + 92 U6 hybrid 1 3596 172 H1 core + U6 hybrid 3 90 3597 173 H1 core + 7SK + 94 U6 hybrid 2 3598 174 H1 core + 7SK + 94 U6 hybrid 3 3599 hU6 isoform 2 249 3600 hU6 isoform 3 249 3601 hU6 isoform 4 249 3602 hU6 isoform 5 249 3603 mU6 304 3604 mU6 isoform 314 3605 gorilla U6 241 3606 Saimiri U6 229 3607 Macaca U6 240 3608 Papio U6 240 3609 Rhinopithecus U6 240 3610 Mini Gorilla U6 103 3611 Mini Saimiri U6 102 3612 Mini Macaca U6 102 3613 Mini Papio U6 102 3614 Mini Rhinopithecus U6 102
Results
[0483] The results portrayed in
[0484] The results portrayed in
[0485] The results shown in
[0486]
[0487] The results of
[0488] The results depicted in
[0489] The results in
[0490] The results depicted in
[0491] Additional RNA promoters can be identified via substitutions and deletions of the U6 promoter and mining for alternative guide RNA promoters from non-human species. To test these RNA promoters in a high-throughput manner, a screening assay is developed to test a library of U6 promotor sequences (SEQ ID NOS: 48-100, 513-566, 594-2100, and 4133-9256) containing all single bp substitutions and single-, double-, 5-, and 10-bp deletions of the human U6 promoter and alternative non-human primate RNA promoters. This library of sequences is synthesized as DNA oligos, amplified and cloned into a lentiviral construct containing different CasX variants, including CasX variants 491, 515, 593, 668, 672, 676, and 812, gRNA scaffold 235 with spacer 34.19, which edits the HBEGF locus and confers cell survival. Briefly, HBEGF is a receptor that mediates entry of diphtheria toxin, which, when added to the cells, inhibits translation and results in cell death. Targeting the HBEGF locus with CasX and HBEGF-targeting spacer should prevent toxin entry and allow cell survival. The resulting lentiviral library is used to transduce HEK293T cells, followed by selection at 2 ng/mL of toxin for 48 hours. After selection, genomic DNA (gDNA) is isolated and used to PCR an amplicon containing the U6 promoter in the surviving cells. These amplicons are sequenced, and frequencies are compared to the pre-selection library to identify U6 promoters that increase in frequency by resulting in more potent CasX:gRNA-mediated editing of the HBEGF locus. This screening assay may be repeated at higher doses, various timepoints, and different cell types to identify more active U6 promoters that induce greater CasX:gRNA-mediated editing. The results of these screens are expected to allow for a ranking of U6 promoters by fitness scores, many of which are anticipated to be better than the current set of lead molecules described in the preceding Examples. The U6 promoters that result in strong survival in all cell types across the doses utilized are prioritized for further characterization as elements in AAV vectors.
[0492] The results of these experiments demonstrate that expression of small CRISPR systems, such as CasX and gRNAs, can be modulated in various ways by utilizing alternative RNA promoters to express the gRNA. While most other CRISPR systems utilized in AAV do not have sufficient space in the transgene to include a separate promoter to express the gRNA, the CasX CRISPR system, and other systems with similarly small size, enable the use of multiple gRNA promoters of varying lengths within a single AAV transgene. These promoters can be used to differentially control expression and editing by the AAV transgene. The data also show that shorter versions of Pol III promoters can be engineered to retain their ability to facilitate transcription of functional guides. This increases the capacity of the AAV transgene to include additional promoters and/or accessory elements. Furthermore, adjusting other elements in the AAV transgene allows for the combination of multiple gRNA transcriptional units that could result in the following: 1) increased gRNA expression and thus CasX-mediated editing; or 2) driving the expression of more than one gRNA from a single AAV system, which would enable the ability to deliver CasX with a dual-gRNA system from a single AAV vector for targeted editing at different locations in the genome (further discussed in Example 9).
Example 6: Choice of Poly(A) Signal Sequence Enhances Potency of AAV Vectors
[0493] Experiments were conducted to demonstrate that small CRISPR proteins, such as CasX, can be expressed from an AAV genome utilizing a variety of polyadenylation (poly(A)) signal sequences. Specifically, use of sequences encoding smaller CRISPR systems enable the inclusion of larger poly(A) signal sequences in the transgene of AAV vectors. In addition, experiments were conducted to demonstrate that the inclusion of shorter synthetic poly(A) signal sequences in the AAV constructs allows for further reductions in the AAV transgene cargo capacity.
Materials and Methods
AAV Plasmid Cloning:
[0494] Poly(A) signal sequences within the AAV genome were separated by restriction enzyme sites to allow for modular cloning. Polyadenylation sequences were ordered as gene fragments and cloned into vector restriction sites according to standard techniques.
[0495] To generate the AAV plasmids assessed in the experiments resulting in the data presented in
TABLE-US-00013 TABLE 9 Poly(A) signal sequences AAV Poly(A) signal SEQ Construct ID Poly(A) signal sequence length (bp) ID NO 1, 3, 37, 232 bGH 208 3401 24, 227 hGH 623 3402 25, 228 hGHshort 477 3403 26, 231 HSVTK 49 3404 27, 221 SynPolyA 49 3405 28, 226 SV40 122 3406 29 SV40short 82 3407 30, 229 bglob 395 3408 31, 230 bglobshort 56 3409 34 SV40polyA late (SL) 181 3410 222 T7 Tphi 119 9336 223 CaMV 175 9337 224 RDH1 171 9338 225 Sv40 polyA late 241 9339
[0496] Methods for plasmid nucleofection and assessing activity by FACS were conducted as described in Example 1.
Neuronal Cell Culture:
[0497] All neuronal cell culture was performed using N2B327-based media. To induce neuronal differentiation, iPSCs were plated in neuronal plating media (N2B327 base media with 1 g/mL doxycycline, 200 M L-ascorbic acid, 1 M dibutyryl cAMP sodium salt, 10 M CultureOne, 100 ng/ml of BDNF, 100 ng/ml of GDNF). iNs (induced neurons) were dissociated, aliquoted, and frozen for long term storage after three days of differentiation (DIV3). DIV3 iNs were thawed and seeded on a 96-well plate at 30,000-50,000 cells per well. iNs were cultured for one week in plating media and thereafter, half-media changes were performed once every week using feeding media (N2B327 base media with 200 M L-ascorbic acid, 1 M dibutyryl cAMP sodium salt, 200 ng/ml of BDNF, 200 ng/ml of GDNF).
AAV Transduction of iNs In Vitro:
[0498] 24 hours prior to transduction, -30,000-50,000 iNs per well were seeded on Matrigel-coated 96-well plates. AAVs expressing the CasX:gRNA system, which included constructs encoding for poly(A) signal sequences listed in Table 12, were then diluted in neuronal plating media and added to cells. Cells were transduced at two MOIs (1E2 or 1E3 vg/cell). Seven days post-transduction, iNs were replenished using feeding media. Seven days post-transduction, cells were lifted using lysis buffer, 4-well replicates were pooled per experimental condition, and genomic DNA (gDNA) was harvested and prepared for editing analysis at the B2M locus using next generation sequencing (NGS).
NGS Processing and Analysis:
[0499] Genomic DNA (gDNA) from harvested cells was extracted using the Zymo Quick-DNA Miniprep Plus kit following the manufacturer's instructions. Target amplicons were formed by amplifying regions of interest from 200 ng of extracted gDNA with a set of primers specific to the target locus, such as the human B2M gene. These gene-specific primers contained an additional sequence at the 5 end to introduce an Illumina adapter and a 16-nucleotide unique molecule identifier. Amplified DNA products were purified with the Ampure XP DNA cleanup kit. Quality and quantification of the amplicon were assessed using a Fragment Analyzer DNA Analysis kit (Agilent, dsDNA 35-1500 bp). Amplicons were sequenced on the Illumina Miseq according to the manufacturer's instructions. Raw fastq files from sequencing were quality-controlled and processed using cutadapt v2.1, flash2 v2.2.00, and CRISPResso2 v2.0.29. Each sequence was quantified for containing an insertion or deletion (indel) relative to the reference sequence, in a window around the 3 end of the spacer (30 bp window centered at 3 bp from 3 end of spacer). CasX activity was quantified as the total percent of reads that contain insertions, substitutions, and/or deletions anywhere within this window for each sample.
Cloning Poly(A) Signal Sequence Library for High-Throughput Screen:
[0500] To identify poly(A) signals that enable CasX to be expressed in an AAV genome in a high-throughput manner, a massively parallel reporter assay was conducted. Briefly, 10,000 poly(A) constructs (1,000 unique poly(A) signal sequences10 barcodes per poly(A) signal sequence) were amplified, digested, and ligated into a restriction enzyme-digested AAV plasmid backbone harboring sequences coding for CasX protein 491 and gRNA scaffold variant 235 with spacer 7.37 (GGCCGAGAUGUCUCGCUCCG; SEQ ID NO: 4059) targeting the endogenous B2M (beta-2-microglobulin) locus. The 1000 unique poly(A) signal sequences, designated as Poly(A)_1 through Poly(A)_1001 (SEQ ID NOS: 2401-3401) are provided in Table 10. Cloned AAV plasmids were then transformed into electrocompetent bacterial cells (MegaX DH1B T1 Electrocomp). Titer of poly(A) signal sequence library transformation was determined by counting E. coli colony-forming units (CFUs) from electroporated library yEGA-X Competent cells. After transformation and overnight growth in liquid cultures, the library was purified using the ZymoPURE Midiprep Kit. To determine adequate library coverage, barcoded amplicons were detected via PCR amplification followed by NGS on the Illumina MiSeq. Raw fastq files were processed using cutadapt v3.5, mapped using bowtie2 v9.3.0, and barcodes were extracted using custom software. Barcoded counts were normalized by total read counts to calculate the representation of each library member.
TABLE-US-00014 TABLE 10 Poly(A) Signal Sequence Library Poly(A) signal Poly(A) sequence signal ID (SEQ ID NO) Poly(A)_1 2401 Poly(A)_2 2402 Poly(A)_3 2403 Poly(A)_4 2404 Poly(A)_5 2405 Poly(A)_6 2406 Poly(A)_7 2407 Poly(A)_8 2408 Poly(A)_9 2409 Poly(A)_10 2410 Poly(A)_11 2411 Poly(A)_12 2412 Poly(A)_13 2413 Poly(A)_14 2414 Poly(A)_15 2415 Poly(A)_16 2416 Poly(A)_17 2417 Poly(A)_18 2418 Poly(A)_19 2419 Poly(A)_20 2420 Poly(A)_21 2421 Poly(A)_22 2422 Poly(A)_23 2423 Poly(A)_24 2424 Poly(A)_25 2425 Poly(A)_26 2426 Poly(A)_27 2427 Poly(A)_28 2428 Poly(A)_29 2429 Poly(A)_30 2430 Poly(A)_31 2431 Poly(A)_32 2432 Poly(A)_33 2433 Poly(A)_34 2434 Poly(A)_35 2435 Poly(A)_36 2436 Poly(A)_37 2437 Poly(A)_38 2438 Poly(A)_39 2439 Poly(A)_40 2440 Poly(A)_41 2441 Poly(A)_42 2442 Poly(A)_43 2443 Poly(A)_44 2444 Poly(A)_45 2445 Poly(A)_46 2446 Poly(A)_47 2447 Poly(A)_48 2448 Poly(A)_49 2449 Poly(A)_50 2450 Poly(A)_51 2451 Poly(A)_52 2452 Poly(A)_53 2453 Poly(A)_54 2454 Poly(A)_55 2455 Poly(A)_56 2456 Poly(A)_57 2457 Poly(A)_58 2458 Poly(A)_59 2459 Poly(A)_60 2460 Poly(A)_61 2461 Poly(A)_62 2462 Poly(A)_63 2463 Poly(A)_64 2464 Poly(A)_65 2465 Poly(A)_66 2466 Poly(A)_67 2467 Poly(A)_68 2468 Poly(A)_69 2469 Poly(A)_70 2470 Poly(A)_71 2471 Poly(A)_72 2472 Poly(A)_73 2473 Poly(A)_74 2474 Poly(A)_75 2475 Poly(A)_76 2476 Poly(A)_77 2477 Poly(A)_78 2478 Poly(A)_79 2479 Poly(A)_80 2480 Poly(A)_81 2481 Poly(A)_82 2482 Poly(A)_83 2483 Poly(A)_84 2484 Poly(A)_85 2485 Poly(A)_86 2486 Poly(A)_87 2487 Poly(A)_88 2488 Poly(A)_89 2489 Poly(A)_90 2490 Poly(A)_91 2491 Poly(A)_92 2492 Poly(A)_93 2493 Poly(A)_94 2494 Poly(A)_95 2495 Poly(A)_96 2496 Poly(A)_97 2497 Poly(A)_98 2498 Poly(A)_99 2499 Poly(A)_100 2500 Poly(A)_101 2501 Poly(A)_102 2502 Poly(A)_103 2503 Poly(A)_104 2504 Poly(A)_105 2505 Poly(A)_106 2506 Poly(A)_107 2507 Poly(A)_108 2508 Poly(A)_109 2509 Poly(A)_110 2510 Poly(A)_111 2511 Poly(A)_112 2512 Poly(A)_113 2513 Poly(A)_114 2514 Poly(A)_115 2515 Poly(A)_116 2516 Poly(A)_117 2517 Poly(A)_118 2518 Poly(A)_119 2519 Poly(A)_120 2520 Poly(A)_121 2521 Poly(A)_122 2522 Poly(A)_123 2523 Poly(A)_124 2524 Poly(A)_125 2525 Poly(A)_126 2526 Poly(A)_127 2527 Poly(A)_128 2528 Poly(A)_129 2529 Poly(A)_130 2530 Poly(A)_131 2531 Poly(A)_132 2532 Poly(A)_133 2533 Poly(A)_134 2534 Poly(A)_135 2535 Poly(A)_136 2536 Poly(A)_137 2537 Poly(A)_138 2538 Poly(A)_139 2539 Poly(A)_140 2540 Poly(A)_141 2541 Poly(A)_142 2542 Poly(A)_143 2543 Poly(A)_144 2544 Poly(A)_145 2545 Poly(A)_146 2546 Poly(A)_147 2547 Poly(A)_148 2548 Poly(A)_149 2549 Poly(A)_150 2550 Poly(A)_151 2551 Poly(A)_152 2552 Poly(A)_153 2553 Poly(A)_154 2554 Poly(A)_155 2555 Poly(A)_156 2556 Poly(A)_157 2557 Poly(A)_158 2558 Poly(A)_159 2559 Poly(A)_160 2560 Poly(A)_161 2561 Poly(A)_162 2562 Poly(A)_163 2563 Poly(A)_164 2564 Poly(A)_165 2565 Poly(A)_166 2566 Poly(A)_167 2567 Poly(A)_168 2568 Poly(A)_169 2569 Poly(A)_170 2570 Poly(A)_171 2571 Poly(A)_172 2572 Poly(A)_173 2573 Poly(A)_174 2574 Poly(A)_175 2575 Poly(A)_176 2576 Poly(A)_177 2577 Poly(A)_178 2578 Poly(A)_179 2579 Poly(A)_180 2580 Poly(A)_181 2581 Poly(A)_182 2582 Poly(A)_183 2583 Poly(A)_184 2584 Poly(A)_185 2585 Poly(A)_186 2586 Poly(A)_187 2587 Poly(A)_188 2588 Poly(A)_189 2589 Poly(A)_190 2590 Poly(A)_191 2591 Poly(A)_192 2592 Poly(A)_193 2593 Poly(A)_194 2594 Poly(A)_195 2595 Poly(A)_196 2596 Poly(A)_197 2597 Poly(A)_198 2598 Poly(A)_199 2599 Poly(A)_200 2600 Poly(A)_201 2601 Poly(A)_202 2602 Poly(A)_203 2603 Poly(A)_204 2604 Poly(A)_205 2605 Poly(A)_206 2606 Poly(A)_207 2607 Poly(A)_208 2608 Poly(A)_209 2609 Poly(A)_210 2610 Poly(A)_211 2611 Poly(A)_212 2612 Poly(A)_213 2613 Poly(A)_214 2614 Poly(A)_215 2615 Poly(A)_216 2616 Poly(A)_217 2617 Poly(A)_218 2618 Poly(A)_219 2619 Poly(A)_220 2620 Poly(A)_221 2621 Poly(A)_222 2622 Poly(A)_223 2623 Poly(A)_224 2624 Poly(A)_225 2625 Poly(A)_226 2626 Poly(A)_227 2627 Poly(A)_228 2628 Poly(A)_229 2629 Poly(A)_230 2630 Poly(A)_231 2631 Poly(A)_232 2632 Poly(A)_233 2633 Poly(A)_234 2634 Poly(A)_235 2635 Poly(A)_236 2636 Poly(A)_237 2637 Poly(A)_238 2638 Poly(A)_239 2639 Poly(A)_240 2640 Poly(A)_241 2641 Poly(A)_242 2642 Poly(A)_243 2643 Poly(A)_244 2644 Poly(A)_245 2645 Poly(A)_246 2646 Poly(A)_247 2647 Poly(A)_248 2648 Poly(A)_249 2649 Poly(A)_250 2650 Poly(A)_251 2651 Poly(A)_252 2652 Poly(A)_253 2653 Poly(A)_254 2654 Poly(A)_255 2655 Poly(A)_256 2656 Poly(A)_257 2657 Poly(A)_258 2658 Poly(A)_259 2659 Poly(A)_260 2660 Poly(A)_261 2661 Poly(A)_262 2662 Poly(A)_263 2663 Poly(A)_264 2664 Poly(A)_265 2665 Poly(A)_266 2666 Poly(A)_267 2667 Poly(A)_268 2668 Poly(A)_269 2669 Poly(A)_270 2670 Poly(A)_271 2671 Poly(A)_272 2672 Poly(A)_273 2673 Poly(A)_274 2674 Poly(A)_275 2675 Poly(A)_276 2676 Poly(A)_277 2677 Poly(A)_278 2678 Poly(A)_279 2679 Poly(A)_280 2680 Poly(A)_281 2681 Poly(A)_282 2682 Poly(A)_283 2683 Poly(A)_284 2684 Poly(A)_285 2685 Poly(A)_286 2686 Poly(A)_287 2687 Poly(A)_288 2688 Poly(A)_289 2689 Poly(A)_290 2690 Poly(A)_291 2691 Poly(A)_292 2692 Poly(A)_293 2693 Poly(A)_294 2694 Poly(A)_295 2695 Poly(A)_296 2696 Poly(A)_297 2697 Poly(A)_298 2698 Poly(A)_299 2699 Poly(A)_300 2700 Poly(A)_301 2701 Poly(A)_302 2702 Poly(A)_303 2703 Poly(A)_304 2704 Poly(A)_305 2705 Poly(A)_306 2706 Poly(A)_307 2707 Poly(A)_308 2708 Poly(A)_309 2709 Poly(A)_310 2710 Poly(A)_311 2711 Poly(A)_312 2712 Poly(A)_313 2713 Poly(A)_314 2714 Poly(A)_315 2715 Poly(A)_316 2716 Poly(A)_317 2717 Poly(A)_318 2718 Poly(A)_319 2719 Poly(A)_320 2720 Poly(A)_321 2721 Poly(A)_322 2722 Poly(A)_323 2723 Poly(A)_324 2724 Poly(A)_325 2725 Poly(A)_326 2726 Poly(A)_327 2727 Poly(A)_328 2728 Poly(A)_329 2729 Poly(A)_330 2730 Poly(A)_331 2731 Poly(A)_332 2732 Poly(A)_333 2733 Poly(A)_334 2734 Poly(A)_335 2735 Poly(A)_336 2736 Poly(A)_337 2737 Poly(A)_338 2738 Poly(A)_339 2739 Poly(A)_340 2740 Poly(A)_341 2741 Poly(A)_342 2742 Poly(A)_343 2743 Poly(A)_344 2744 Poly(A)_345 2745 Poly(A)_346 2746 Poly(A)_347 2747 Poly(A)_348 2748 Poly(A)_349 2749 Poly(A)_350 2750 Poly(A)_351 2751 Poly(A)_352 2752 Poly(A)_353 2753 Poly(A)_354 2754 Poly(A)_355 2755 Poly(A)_356 2756 Poly(A)_357 2757 Poly(A)_358 2758 Poly(A)_359 2759 Poly(A)_360 2760 Poly(A)_361 2761 Poly(A)_362 2762 Poly(A)_363 2763 Poly(A)_364 2764 Poly(A)_365 2765 Poly(A)_366 2766 Poly(A)_367 2767 Poly(A)_368 2768 Poly(A)_369 2769 Poly(A)_370 2770 Poly(A)_371 2771 Poly(A)_372 2772 Poly(A)_373 2773 Poly(A)_374 2774 Poly(A)_375 2775 Poly(A)_376 2776 Poly(A)_377 2777 Poly(A)_378 2778 Poly(A)_379 2779 Poly(A)_380 2780 Poly(A)_381 2781 Poly(A)_382 2782 Poly(A)_383 2783 Poly(A)_384 2784 Poly(A)_385 2785 Poly(A)_386 2786 Poly(A)_387 2787 Poly(A)_388 2788 Poly(A)_389 2789 Poly(A)_390 2790 Poly(A)_391 2791 Poly(A)_392 2792 Poly(A)_393 2793 Poly(A)_394 2794 Poly(A)_395 2795 Poly(A)_396 2796 Poly(A)_397 2797 Poly(A)_398 2798 Poly(A)_399 2799 Poly(A)_400 2800 Poly(A)_401 2801 Poly(A)_402 2802 Poly(A)_403 2803 Poly(A)_404 2804 Poly(A)_405 2805 Poly(A)_406 2806 Poly(A)_407 2807 Poly(A)_408 2808 Poly(A)_409 2809 Poly(A)_410 2810 Poly(A)_411 2811 Poly(A)_412 2812 Poly(A)_413 2813 Poly(A)_414 2814 Poly(A)_415 2815 Poly(A)_416 2816 Poly(A)_417 2817 Poly(A)_418 2818 Poly(A)_419 2819 Poly(A)_420 2820 Poly(A)_421 2821 Poly(A)_422 2822 Poly(A)_423 2823 Poly(A)_424 2824 Poly(A)_425 2825 Poly(A)_426 2826 Poly(A)_427 2827 Poly(A)_428 2828 Poly(A)_429 2829 Poly(A)_430 2830 Poly(A)_431 2831 Poly(A)_432 2832 Poly(A)_433 2833 Poly(A)_434 2834 Poly(A)_435 2835 Poly(A)_436 2836 Poly(A)_437 2837 Poly(A)_438 2838 Poly(A)_439 2839 Poly(A)_440 2840 Poly(A)_441 2841 Poly(A)_442 2842 Poly(A)_443 2843 Poly(A)_444 2844 Poly(A)_445 2845 Poly(A)_446 2846 Poly(A)_447 2847 Poly(A)_448 2848 Poly(A)_449 2849 Poly(A)_450 2850 Poly(A)_451 2851 Poly(A)_452 2852 Poly(A)_453 2853 Poly(A)_454 2854 Poly(A)_455 2855 Poly(A)_456 2856 Poly(A)_457 2857 Poly(A)_458 2858 Poly(A)_459 2859 Poly(A)_460 2860 Poly(A)_461 2861 Poly(A)_462 2862 Poly(A)_463 2863 Poly(A)_464 2864 Poly(A)_465 2865 Poly(A)_466 2866 Poly(A)_467 2867 Poly(A)_468 2868 Poly(A)_469 2869 Poly(A)_470 2870 Poly(A)_471 2871 Poly(A)_472 2872 Poly(A)_473 2873 Poly(A)_474 2874 Poly(A)_475 2875 Poly(A)_476 2876 Poly(A)_477 2877 Poly(A)_478 2878 Poly(A)_479 2879 Poly(A)_480 2880 Poly(A)_481 2881 Poly(A)_482 2882 Poly(A)_483 2883 Poly(A)_484 2884 Poly(A)_485 2885 Poly(A)_486 2886 Poly(A)_487 2887 Poly(A)_488 2888 Poly(A)_489 2889 Poly(A)_490 2890 Poly(A)_491 2891 Poly(A)_492 2892 Poly(A)_493 2893 Poly(A)_494 2894 Poly(A)_495 2895 Poly(A)_496 2896 Poly(A)_497 2897 Poly(A)_498 2898 Poly(A)_499 2899 Poly(A)_500 2900 Poly(A)_501 2901 Poly(A)_502 2902 Poly(A)_503 2903 Poly(A)_504 2904 Poly(A)_505 2905 Poly(A)_506 2906 Poly(A)_507 2907 Poly(A)_508 2908 Poly(A)_509 2909 Poly(A)_510 2910 Poly(A)_511 2911 Poly(A)_512 2912 Poly(A)_513 2913 Poly(A)_514 2914 Poly(A)_515 2915 Poly(A)_516 2916 Poly(A)_517 2917 Poly(A)_518 2918 Poly(A)_519 2919 Poly(A)_520 2920 Poly(A)_521 2921 Poly(A)_522 2922 Poly(A)_523 2923 Poly(A)_524 2924 Poly(A)_525 2925 Poly(A)_526 2926 Poly(A)_527 2927 Poly(A)_528 2928 Poly(A)_529 2929 Poly(A)_530 2930 Poly(A)_531 2931 Poly(A)_532 2932 Poly(A)_533 2933 Poly(A)_534 2934 Poly(A)_535 2935 Poly(A)_536 2936 Poly(A)_537 2937 Poly(A)_538 2938 Poly(A)_539 2939 Poly(A)_540 2940 Poly(A)_541 2941 Poly(A)_542 2942 Poly(A)_543 2943 Poly(A)_544 2944 Poly(A)_545 2945 Poly(A)_546 2946 Poly(A)_547 2947 Poly(A)_548 2948 Poly(A)_549 2949 Poly(A)_550 2950 Poly(A)_551 2951 Poly(A)_552 2952 Poly(A)_553 2953 Poly(A)_554 2954 Poly(A)_555 2955 Poly(A)_556 2956 Poly(A)_557 2957 Poly(A)_558 2958 Poly(A)_559 2959 Poly(A)_560 2960 Poly(A)_561 2961 Poly(A)_562 2962 Poly(A)_563 2963 Poly(A)_564 2964 Poly(A)_565 2965 Poly(A)_566 2966 Poly(A)_567 2967 Poly(A)_568 2968 Poly(A)_569 2969 Poly(A)_570 2970 Poly(A)_571 2971 Poly(A)_572 2972 Poly(A)_573 2973 Poly(A)_574 2974 Poly(A)_575 2975 Poly(A)_576 2976 Poly(A)_577 2977 Poly(A)_578 2978 Poly(A)_579 2979 Poly(A)_580 2980 Poly(A)_581 2981 Poly(A)_582 2982 Poly(A)_583 2983 Poly(A)_584 2984 Poly(A)_585 2985 Poly(A)_586 2986 Poly(A)_587 2987 Poly(A)_588 2988 Poly(A)_589 2989 Poly(A)_590 2990 Poly(A)_591 2991 Poly(A)_592 2992 Poly(A)_593 2993 Poly(A)_594 2994 Poly(A)_595 2995 Poly(A)_596 2996 Poly(A)_597 2997 Poly(A)_598 2998 Poly(A)_599 2999 Poly(A)_600 3000 Poly(A)_601 3001 Poly(A)_602 3002 Poly(A)_603 3003 Poly(A)_604 3004 Poly(A)_605 3005 Poly(A)_606 3006 Poly(A)_607 3007 Poly(A)_608 3008 Poly(A)_609 3009 Poly(A)_610 3010 Poly(A)_611 3011 Poly(A)_612 3012 Poly(A)_613 3013 Poly(A)_614 3014 Poly(A)_615 3015 Poly(A)_616 3016 Poly(A)_617 3017 Poly(A)_618 3018 Poly(A)_619 3019 Poly(A)_620 3020 Poly(A)_621 3021 Poly(A)_622 3022 Poly(A)_623 3023 Poly(A)_624 3024 Poly(A)_625 3025 Poly(A)_626 3026 Poly(A)_627 3027 Poly(A)_628 3028 Poly(A)_629 3029 Poly(A)_630 3030 Poly(A)_631 3031 Poly(A)_632 3032 Poly(A)_633 3033 Poly(A)_634 3034 Poly(A)_635 3035 Poly(A)_636 3036 Poly(A)_637 3037 Poly(A)_638 3038 Poly(A)_639 3039 Poly(A)_640 3040 Poly(A)_641 3041 Poly(A)_642 3042 Poly(A)_643 3043 Poly(A)_644 3044 Poly(A)_645 3045 Poly(A)_646 3046 Poly(A)_647 3047 Poly(A)_648 3048 Poly(A)_649 3049 Poly(A)_650 3050 Poly(A)_651 3051 Poly(A)_652 3052 Poly(A)_653 3053 Poly(A)_654 3054 Poly(A)_655 3055 Poly(A)_656 3056 Poly(A)_657 3057 Poly(A)_658 3058 Poly(A)_659 3059 Poly(A)_660 3060 Poly(A)_661 3061 Poly(A)_662 3062 Poly(A)_663 3063 Poly(A)_664 3064 Poly(A)_665 3065 Poly(A)_666 3066 Poly(A)_667 3067 Poly(A)_668 3068 Poly(A)_669 3069 Poly(A)_670 3070 Poly(A)_671 3071 Poly(A)_672 3072 Poly(A)_673 3073 Poly(A)_674 3074 Poly(A)_675 3075 Poly(A)_676 3076 Poly(A)_677 3077 Poly(A)_678 3078 Poly(A)_679 3079 Poly(A)_680 3080 Poly(A)_681 3081 Poly(A)_682 3082 Poly(A)_683 3083 Poly(A)_684 3084 Poly(A)_685 3085 Poly(A)_686 3086 Poly(A)_687 3087 Poly(A)_688 3088 Poly(A)_689 3089 Poly(A)_690 3090 Poly(A)_691 3091 Poly(A)_692 3092 Poly(A)_693 3093 Poly(A)_694 3094 Poly(A)_695 3095 Poly(A)_696 3096 Poly(A)_697 3097 Poly(A)_698 3098 Poly(A)_699 3099 Poly(A)_700 3100 Poly(A)_701 3101 Poly(A)_702 3102 Poly(A)_703 3103 Poly(A)_704 3104 Poly(A)_705 3105 Poly(A)_706 3106 Poly(A)_707 3107 Poly(A)_708 3108 Poly(A)_709 3109 Poly(A)_710 3110 Poly(A)_711 3111 Poly(A)_712 3112 Poly(A)_713 3113 Poly(A)_714 3114 Poly(A)_715 3115 Poly(A)_716 3116 Poly(A)_717 3117 Poly(A)_718 3118 Poly(A)_719 3119 Poly(A)_720 3120 Poly(A)_721 3121 Poly(A)_722 3122 Poly(A)_723 3123 Poly(A)_724 3124 Poly(A)_725 3125 Poly(A)_726 3126 Poly(A)_727 3127 Poly(A)_728 3128 Poly(A)_729 3129 Poly(A)_730 3130 Poly(A)_731 3131 Poly(A)_732 3132 Poly(A)_733 3133 Poly(A)_734 3134 Poly(A)_735 3135 Poly(A)_736 3136 Poly(A)_737 3137 Poly(A)_738 3138 Poly(A)_739 3139 Poly(A)_740 3140 Poly(A)_741 3141 Poly(A)_742 3142 Poly(A)_743 3143 Poly(A)_744 3144 Poly(A)_745 3145 Poly(A)_746 3146 Poly(A)_747 3147 Poly(A)_748 3148 Poly(A)_749 3149 Poly(A)_750 3150 Poly(A)_751 3151 Poly(A)_752 3152 Poly(A)_753 3153 Poly(A)_754 3154 Poly(A)_755 3155 Poly(A)_756 3156 Poly(A)_757 3157 Poly(A)_758 3158 Poly(A)_759 3159 Poly(A)_760 3160 Poly(A)_761 3161 Poly(A)_762 3162 Poly(A)_763 3163 Poly(A)_764 3164 Poly(A)_765 3165 Poly(A)_766 3166 Poly(A)_767 3167 Poly(A)_768 3168 Poly(A)_769 3169 Poly(A)_770 3170 Poly(A)_771 3171 Poly(A)_772 3172 Poly(A)_773 3173 Poly(A)_774 3174 Poly(A)_775 3175 Poly(A)_776 3176 Poly(A)_777 3177 Poly(A)_778 3178 Poly(A)_779 3179 Poly(A)_780 3180 Poly(A)_781 3181 Poly(A)_782 3182 Poly(A)_783 3183 Poly(A)_784 3184 Poly(A)_785 3185 Poly(A)_786 3186 Poly(A)_787 3187 Poly(A)_788 3188 Poly(A)_789 3189 Poly(A)_790 3190 Poly(A)_791 3191 Poly(A)_792 3192 Poly(A)_793 3193 Poly(A)_794 3194 Poly(A)_795 3195 Poly(A)_796 3196 Poly(A)_797 3197 Poly(A)_798 3198 Poly(A)_799 3199 Poly(A)_800 3200 Poly(A)_801 3201 Poly(A)_802 3202 Poly(A)_803 3203 Poly(A)_804 3204 Poly(A)_805 3205 Poly(A)_806 3206 Poly(A)_807 3207 Poly(A)_808 3208 Poly(A)_809 3209 Poly(A)_810 3210 Poly(A)_811 3211 Poly(A)_812 3212 Poly(A)_813 3213 Poly(A)_814 3214 Poly(A)_815 3215 Poly(A)_816 3216 Poly(A)_817 3217 Poly(A)_818 3218 Poly(A)_819 3219 Poly(A)_820 3220 Poly(A)_821 3221 Poly(A)_822 3222 Poly(A)_823 3223 Poly(A)_824 3224 Poly(A)_825 3225 Poly(A)_826 3226 Poly(A)_827 3227 Poly(A)_828 3228 Poly(A)_829 3229 Poly(A)_830 3230 Poly(A)_831 3231 Poly(A)_832 3232 Poly(A)_833 3233 Poly(A)_834 3234 Poly(A)_835 3235 Poly(A)_836 3236 Poly(A)_837 3237 Poly(A)_838 3238 Poly(A)_839 3239 Poly(A)_840 3240 Poly(A)_841 3241 Poly(A)_842 3242 Poly(A)_843 3243 Poly(A)_844 3244 Poly(A)_845 3245 Poly(A)_846 3246 Poly(A)_847 3247 Poly(A)_848 3248 Poly(A)_849 3249 Poly(A)_850 3250 Poly(A)_851 3251 Poly(A)_852 3252 Poly(A)_853 3253 Poly(A)_854 3254 Poly(A)_855 3255 Poly(A)_856 3256 Poly(A)_857 3257 Poly(A)_858 3258 Poly(A)_859 3259 Poly(A)_860 3260 Poly(A)_861 3261 Poly(A)_862 3262 Poly(A)_863 3263 Poly(A)_864 3264 Poly(A)_865 3265 Poly(A)_866 3266 Poly(A)_867 3267 Poly(A)_868 3268 Poly(A)_869 3269 Poly(A)_870 3270 Poly(A)_871 3271 Poly(A)_872 3272 Poly(A)_873 3273 Poly(A)_874 3274 Poly(A)_875 3275 Poly(A)_876 3276 Poly(A)_877 3277 Poly(A)_878 3278 Poly(A)_879 3279 Poly(A)_880 3280 Poly(A)_881 3281 Poly(A)_882 3282 Poly(A)_883 3283 Poly(A)_884 3284 Poly(A)_885 3285 Poly(A)_886 3286 Poly(A)_887 3287 Poly(A)_888 3288 Poly(A)_889 3289 Poly(A)_890 3290 Poly(A)_891 3291 Poly(A)_892 3292 Poly(A)_893 3293 Poly(A)_894 3294 Poly(A)_895 3295 Poly(A)_896 3296 Poly(A)_897 3297 Poly(A)_898 3298 Poly(A)_899 3299 Poly(A)_900 3300 Poly(A)_901 3301 Poly(A)_902 3302 Poly(A)_903 3303 Poly(A)_904 3304 Poly(A)_905 3305 Poly(A)_906 3306 Poly(A)_907 3307 Poly(A)_908 3308 Poly(A)_909 3309 Poly(A)_910 3310 Poly(A)_911 3311 Poly(A)_912 3312 Poly(A)_913 3313 Poly(A)_914 3314 Poly(A)_915 3315 Poly(A)_916 3316 Poly(A)_917 3317 Poly(A)_918 3318 Poly(A)_919 3319 Poly(A)_920 3320 Poly(A)_921 3321 Poly(A)_922 3322 Poly(A)_923 3323 Poly(A)_924 3324 Poly(A)_925 3325 Poly(A)_926 3326 Poly(A)_927 3327 Poly(A)_928 3328 Poly(A)_929 3329 Poly(A)_930 3330 Poly(A)_931 3331 Poly(A)_932 3332 Poly(A)_933 3333 Poly(A)_934 3334 Poly(A)_935 3335 Poly(A)_936 3336 Poly(A)_937 3337 Poly(A)_938 3338 Poly(A)_939 3339 Poly(A)_940 3340 Poly(A)_941 3341 Poly(A)_942 3342 Poly(A)_943 3343 Poly(A)_944 3344 Poly(A)_945 3345 Poly(A)_946 3346 Poly(A)_947 3347 Poly(A)_948 3348 Poly(A)_949 3349 Poly(A)_950 3350 Poly(A)_951 3351 Poly(A)_952 3352 Poly(A)_953 3353 Poly(A)_954 3354 Poly(A)_955 3355 Poly(A)_956 3356 Poly(A)_957 3357 Poly(A)_958 3358 Poly(A)_959 3359 Poly(A)_960 3360 Poly(A)_961 3361 Poly(A)_962 3362 Poly(A)_963 3363 Poly(A)_964 3364 Poly(A)_965 3365 Poly(A)_966 3366 Poly(A)_967 3367 Poly(A)_968 3368 Poly(A)_969 3369 Poly(A)_970 3370 Poly(A)_971 3371 Poly(A)_972 3372 Poly(A)_973 3373 Poly(A)_974 3374 Poly(A)_975 3375 Poly(A)_976 3376 Poly(A)_977 3377 Poly(A)_978 3378 Poly(A)_979 3379 Poly(A)_980 3380 Poly(A)_981 3381 Poly(A)_982 3382 Poly(A)_983 3383 Poly(A)_984 3384 Poly(A)_985 3385 Poly(A)_986 3386 Poly(A)_987 3387 Poly(A)_988 3388 Poly(A)_989 3389 Poly(A)_990 3390 Poly(A)_991 3391 Poly(A)_992 3392 Poly(A)_993 3393 Poly(A)_994 3394 Poly(A)_995 3395 Poly(A)_996 3396 Poly(A)_997 3397 Poly(A)_998 3398 Poly(A)_999 3399 Poly(A)_1000 3400 Poly(A)_1001 3401
AAV Vector Production:
[0501] AAV vectors were produced according to standard methods, which are described in Example 1.
[0502] To determine the viral genome (vg) titer, 1 L from crude lysate viruses was digested with DNase and Proteinase K, followed by quantitative PCR. 5 L of digested virus was used in a 25 L qPCR reaction composed of IDT primetime master mix and a set of primer and 6FAM/Zen/IBFQ probe (IDT) designed to amplify a 62 bp-fragment located in the AAV2-ITR. Ten-fold serial dilutions of an AAV ITR plasmid was used as reference standards to calculate the titer (vg/mL) of viral samples.
[0503] After production, AAVs from the pooled library were lysed to release AAV virion DNA, which was then purified according to standard methods. Barcoded amplicons were PCR-amplified from the viral DNA input, sequenced, and processed as described earlier to determine the coverage of the AAV pool. Barcode counts were normalized by total read counts to calculate an RPM value.
AAV Transduction and Method for RNA Transcript Analysis:
[0504] 10,000 HEK293T cells were seeded per well in PLF-coated 24-well plates 48 hours before AAV transduction. At the time of transduction, HEK293 Ts were transduced with the pooled library of AAVs containing the library of poly(A) signal sequences. All viral infection conditions were performed in triplicate, with normalized number of vg among experimental vectors, at an MOI of 1E5 and 1E4 vg/cell. Two days post-transduction, total RNA was isolated and converted into cDNA by reverse transcription. Barcoded amplicons were PCR-amplified from the resulting cDNA, sequenced, and processed as described earlier. Barcode counts were normalized by total read counts to calculate an RPM value. To calculate the RNA abundance ratio for each poly(A) signal sequence from the library, normalized barcode counts from cDNA amplicons were divided by normalized barcode counts from viral DNA input. Poly(A) signal sequences with a high RNA abundance ratio, i.e., with the highest accumulation in HEK293 Ts, were identified as the poly(A) signal sequences of interest for further CasX editing assessments in vitro or in vivo.
Results
[0505] The results portrayed in
TABLE-US-00015 TABLE 11 AAV constructs with poly(A) signal sequence variants. Poly(A) Signal Construct Sequence AAV Transgene ID Length (bp) Length (bp) 3 208 4550 25 477 4795 26 49 4367 27 49 4367 28 122 4440 29 82 4400 30 395 4713 31 56 4374 34 181 4565 37 208 4619
[0506] The results portrayed in
[0507] The results portrayed in
[0508] Experiments were performed in HEK293T cells to screen for poly(A) signal sequences for incorporation into future AAV construct designs that would improve CasX expression. As described above, poly(A) signal sequences with a high RNA abundance ratio would be identified as the poly(A) signal sequences of interest for further testing. The RNA abundance ratio was calculated across ten technical replicates by summing the counts across technical replicates and plotted for each unique poly(A) signal sequence from the library for each biological replicate (
[0509] Overall, the results demonstrate that the expression of small CRISPR proteins, such as CasX, can be modulated by poly(A) signals of varying lengths. Longer poly(A) signal sequences can be utilized in the AAV constructs for enhanced CasX activity, while shorter poly(A) signal sequences can be utilized in the AAV constructs to make more sequence space available for the inclusion of additional accessory elements within the AAV transgene.
TABLE-US-00016 TABLE12 Listofpoly(A)signalsidentifiedfromahigh-throughputscreenthat demonstratedapositivemeanRNAabundanceratioobservedinthreebiological replicatesandharborasequencelengthshorterthanthebGHcontrol(109bp). Poly(A) Poly(A) Name signalID SEQIDNO Name signalID SEQIDNO SPATA24 Poly(A)_812 3212 CCDC180 Poly(A)_946 3346 C14orf28 Poly(A)_269 2668 KCNJ13 Poly(A)_645 3045 TSKS Poly(A)_554 2954 SCO2 Poly(A)_707 3107 NUP153 Poly(A)_833 3233 TUT1 Poly(A)_145 2545 RPS12 Poly(A)_862 3262 PTH2 Poly(A)_543 2943 IL17RC Poly(A)_709 3109 THOCI Poly(A)_442 2842 CALM2 Poly(A)_594 2994 ACKR1 Poly(A)_76 2476 KLK13 Poly(A)_562 2962 RPL38 Poly(A)_429 2829 STPG4 Poly(A)_593 2993 SAMD8 Poly(A)_102 2502 RNF181 Poly(A)_612 3012 RPS8 Poly(A)_33 2433 SPAG4 Poly(A)_663 3063 SCNM1 Poly(A)_55 2455 RHOT2 Poly(A)_306 2706 HEXDC Poly(A)_441 2841 GLG1 Poly(A)_359 2759 EXOSC4 Poly(A)_931 3331 ACTA2 Poly(A)_105 2505 IDH3B Poly(A)_652 3052 SMPD2 Poly(A)_859 3259 UBE2D2 Poly(A)_813 3213 MRPL52 Poly(A)_254 2654 CBR3 Poly(A)_678 3078 ETV2 Poly(A)_499 2899 GPR19 Poly(A)_195 2595 TMEM102 Poly(A)_383 2783 ALKBH7 Poly(A)_462 2862 CLCNKB Poly(A)_13 2413 UBE2D3 Poly(A)_782 3182 AAAS Poly(A)_203 2603 SUPV3L1 Poly(A)_99 2499 SPATA7 Poly(A)_273 2673 SENP3 Poly(A)_384 2784 FKBP11 Poly(A)_200 2600 RNF166 Poly(A)_366 2766 NOP16 Poly(A)_821 3221 EEF1D Poly(A)_927 3327 CDC34 Poly(A)_450 2850 TEKT1 Poly(A)_380 2780 NLRX1 Poly(A)_188 2588 PSTK Poly(A)_115 2515 PRPF8 Poly(A)_370 2770 RETREG1 Poly(A)_792 3192 EIF3K Poly(A)_508 2908 RPL7 Poly(A)_910 3310 KRTCAP2 Poly(A)_71 2471 SLIT2 Poly(A)_775 3175 RPS15 Poly(A)_455 2855 CALHM6 Poly(A)_861 3261 ELOC Poly(A)_911 3311 Clorf53 Poly(A)_87 2487 TFPT Poly(A)_568 2968 AURKAIP1 Poly(A)_3 2403 CEP350 Poly(A)_86 2486 EEF1D Poly(A)_928 3328 RAB33A Poly(A)_993 3393 CRYGD Poly(A)_636 3036 WDR36 Poly(A)_808 3208 MSRB3 Poly(A)_215 2615 ARMC12 Poly(A)_846 3246 ABHD1 Poly(A)_584 2984 NNMT Poly(A)_184 2584 HCCS Poly(A)_972 3372 NAA50 Poly(A)_744 3144 POLD1 Poly(A)_558 2958 RPL14 Poly(A)_716 3116 ZBTB48 Poly(A)_7 2407 RPL18 Poly(A)_537 2937 C17orf98 Poly(A)_405 2805 TMEM205 Poly(A)_474 2874 ATRIP Poly(A)_721 3121 MRPL52 Poly(A)_253 2721 TRO Poly(A)_983 3383 CORO7- Poly(A)_321 2470 U2AF1L4 Poly(A)_502 2902 PAM16 DPM3 Poly(A)_70 2970 PRIM1 Poly(A)_211 2611 RPS9 Poly(A)_570 S100A2 Poly(A)_65 2464 SYCEIL Poly(A)_362 2762 PRKAA1 Poly(A)_794 3194 AKAP8L Poly(A)_479 2879 CPVL Poly(A)_870 3270 DHX30 Poly(A)_719 3119 PIP Poly(A)_896 3296 RABGGTA Poly(A)_265 2665 MAPKAPK5 Poly(A)_227 2627 RNF181 Poly(A)_611 3011 IL13RA2 Poly(A)_988 3388 PPP1R35 Poly(A)_881 3281 C2orf70 Poly(A)_582 2982 RRP9 Poly(A)_735 3135 TMEM219 Poly(A)_331 2731 VPS29 Poly(A)_225 2625 EXOSC8 Poly(A)_238 2638 NUP85 Poly(A)_431 2831 CUTA Poly(A)_843 3243 EXOC3L1 Poly(A)_347 2747 PLCB2 Poly(A)_282 2682 TAF10 Poly(A)_126 2526 PCGF1 Poly(A)_608 3008 PPP1R13L Poly(A)_531 2931 PFDN5 Poly(A)_201 2601 POLB Poly(A)_907 3307 IFT27 Poly(A)_697 3097 INTS8 Poly(A)_916 3316 VMA21 Poly(A)_994 3394 PLA2G1B Poly(A)_229 2629 PSMB1 Poly(A)_864 3264 ZFAND5 Poly(A)_945 3345 EEF1D Poly(A)_929 3329 RPL30 Poly(A)_918 3318 ARMC3 Poly(A)_98 2498 SGF29 Poly(A)_329 2729 AP1M1 Poly(A)_480 2880 NUDT14 Poly(A)_279 2679 BOLA3 Poly(A)_604 3004 IFT122 Poly(A)_751 3151 TMEM258 Poly(A)_143 2543 CUTA Poly(A)_842 3242 TCTEX1D2 Poly(A)_764 3164 FBL Poly(A)_516 2916 ALAS1 Poly(A)_737 3137 ZCRB1 Poly(A)_197 2597 AKAP14 Poly(A)_991 3391 C2orf70 Poly(A)_583 2983 TEX10 Poly(A)_947 3347 CCDC33 Poly(A)_291 2691 CTNNBL1 Poly(A)_665 3065 MPHOSPH10 Poly(A)_603 3003 UBL5 Poly(A)_472 2872 BAG6 Poly(A)_836 3236 FGF21 Poly(A)_540 2940 C11orf80 Poly(A)_167 2567 PPP2R3C Poly(A)_268 2668 PPIL6 Poly(A)_858 3258 SEPT11 Poly(A)_778 3178 SNRNP27 Poly(A)_600 3000 NUP93 Poly(A)_339 2739
TABLE-US-00017 TABLE 13 List of additional poly(A) signal sequences for incorporation into future AAV construct designs and further testing. Poly(A) SEQ Name signal ID ID NO RPL10 Poly(A)_1000 3400 RPL11 Poly(A)_16 2416 RPL12 Poly(A)_952 3352 RPL13A Poly(A)_546 2946 RPL22 Poly(A)_6 2406 RPL22L1 Poly(A)_757 3157 RPL26 Poly(A)_390 2790 RPL26 Poly(A)_391 2791 RPL26 Poly(A)_392 2792 RPL27A Poly(A)_127 2527 RPL3 Poly(A)_700 3100 RPL30 Poly(A)_919 3319 RPL32 Poly(A)_713 3113 RPL35A Poly(A)_765 3165 RPL35A Poly(A)_766 3166 RPL5 Poly(A)_43 2442 RPL8 Poly(A)_935 3335 RPS11 Poly(A)_547 2947 RPS15A Poly(A)_326 2726 RPS16 Poly(A)_513 2913 RPS16 Poly(A)_514 2914 RPS19 Poly(A)_521 2921 RPS3A Poly(A)_786 3186 RPS5 Poly(A)_574 2974 RPS7 Poly(A)_578 2978
Example 7: Small CRISPR Protein Potency is Modulated by the Position of Regulatory Elements in the AAV Vector
[0510] Orientation (forward or reverse) and position (upstream or downstream of CRISPR gene) of regulatory elements such as the gRNA promoter and guide scaffold complex can modulate the underlying expression of the small CRISPR protein and the overall editing efficiency of CRISPR systems in AAV vectors. Experiments were performed to assess the best orientation and position of regulatory elements within the AAV genome to enhance the potency of small CRISPR proteins and guide RNAs.
Materials and Methods
[0511] AAV vector production and QC, nucleofection, AAV viral production and editing level assessment in mNPTC-tdT cells by FACS were conducted as described in Example 1.
Results
[0512] Construct 44 (configuration shown in
[0513]
[0514] Additional configurations were explored, such that the gRNA transcriptional unit (Pol III U6 promoter driving the expression of the gRNA scaffold and indicated spacer) was placed either upstream or downstream of the CasX gene and was either in the forward or reverse orientation (
TABLE-US-00018 TABLE 14 Sequences of key AAV elements with varying positions and orientations of the gRNA transcriptional unit. Rev comp denotes the reverse complementary sequence. Component SEQ Length of Construct ID Name ID NO: Component (bp) 207A/B, 208, 5 ITR 3683 130 209A/B, 210 UbC promoter 3720 400 5 c-MYC NLS 9290 27 CasX 491 9291 2931 3 c-MYC NLS 9292 27 bGH poly(A) signal 3696 209 207A/B, 209A/B U6 promoter (Fwd) 3698 242 Scaffold 235 (Fwd) 3631 89 207B, 209B Spacer 12.7 (Fwd) 4049 21 207A, 209A Spacer NT (Fwd) 4057 18 208, 210 U6 promoter 3987 241 (Rev Comp) Scaffold 235 9293 99 (Rev Comp) Spacer 12.7 9294 20 (Rev Comp) 207A/B, 208, 3 ITR 3701 141 209A/B, 210
TABLE-US-00019 TABLE 15 Sequences of AAV constructs within AAV ITRs. Sequence Construct (within AAV ITR) Length of ID SEQ ID NO: Construct (bp) 207A 9295 4352 207B 9296 4352 208 9297 4344 209A 9298 4354 209B 9299 4354 210 9300 4364
[0515] The results of these experiments demonstrate that the orientation of parts within the AAV genome can be varied, yet result in sufficient expression of the CRISPR proteins and the guide RNA. This shows that specific orientations or positions of the regulatory elements relative to the encoded protein or RNA components may allow controlled modulation of expression in CasX-packaging AAV constructs that contain one or multiple guides.
Example 8: Small CRISPR Protein Potency is Enhanced by Inclusion of Additional Regulatory Elements in the AAV Vector that are not Possible with a Larger Protein
[0516] Experiments were performed to demonstrate that transcriptional levels mediated by AAV vectors delivering small CRISPR proteins (such as CasX) can be enhanced by inclusion of different regulatory elements (intronic sequences, enhancers, etc.) that conventionally do not fit in AAV vectors expressing large transgene (e.g., spCas9) plasmids.
Materials and Methods
[0517] Cloning and QC: A 4-part Golden Gate Assembly consisting of a pre-digested AAV backbone, small CRISPR protein-encoding DNA, and flanking 5 and 3 DNA sequences were used to generate AAV-cis plasmid as described in Example 1. 5 sequences contained enhancer, protein promoter and N-terminal NLS, while 3 sequences contained C-terminal NLS, WPRE, poly(A) signal, RNA promoter and guide RNA containing spacer 12.7. 5 and 3 parts were ordered as gene fragments, PCR-amplified, and assembled and assembled into AAV vectors. Cloning and plasmid QC, nucleofection, and FACS methods were conducted as described in Example 1.
[0518] Enhancement of editing by the inclusion of post-translation regulatory element (PTRE) 1, 2, or 3 in the AAV cis plasmid 3 was tested in combination with different promoters driving expression of CasX. A first set of promoters were tested; transgene plasmids 4, 35, 36 37, transgene plasmid 5, 38, 39, 40 and transgene plasmids 6, 42, 43 have the CasX protein expression driven by the CMV, UbC, EFS, CMV-s promoters, respectively. A second set of constructs tested included PTREs between the protein and poly(A) signal sequences and were generated with the Jet and JetUsp promoters compared to the UbC promoter (transgenes 58, 72, 73, 74; transgenes 59, 75, 76, 77 and transgenes 53, 80 and 81 respectively) driving expression of CasX. The PTRE sequences are listed in Table 16, and enhancer plus promoter sequences are listed in Table 17. The sequences of the additional components of the AAV constructs, with the exception of sequences encoding the CasX (Table 26) and the one or more gRNA (Tables 23 and 24), are listed in Table 45.
TABLE-US-00020 TABLE 16 Constructs and sequences of post-transcription elements (PTRE) tested on base construct ID 4, 5, 6, 53, 58, and 59 SEQ Length of ID NO: Construct ID PTRE PTRE (bp) 3615 35, 38, 72, 75 1 598 3616 36, 39, 42, 73, 76, 80 2 593 3617 37, 40, 43, 74, 77, 81 3 247
TABLE-US-00021 TABLE 17 Enhancer elements and sequences tested in combination with the CMV core promoter SEQ Core Length of ID NO: ID Enhancer promoter Promoter (bp) 3618 3 CMV CMV 584 3619 64 N/A CMV 204 3620 65 Syn 1 CMV 414 3621 66 NPC5 CMV 314 3622 67 NPC7 CMV 324 3623 68 NPC127 CMV 304 3624 69 NPC190 CMV 364 3625 70 NPC249 CMV 274 3626 71 NPC286 CMV 354
Results
[0519] The effects of PTREs on transgene expression were assessed by cloning 3 enhancer sequences (PTRE1, PTRE2, and PTR3, Table 16) into an AAV-cis plasmid (construct 3) and construct plasmids containing shorter protein promoters (constructs 4, 5, 6, 53, 57 and 58 contain 400, 234, 335, 400, 164 and 326 bp promoter sequences, respectively).
[0520] AAV-cis plasmid activity was first confirmed by nucleofection in mNPC-tdT cells. For each vector, addition of PTRE enhanced editing activity at various levels (
[0521] Improvements in editing levels were also observed when constructs were packaged into AAV. Inclusion of PTRE2 in transgene increased editing across the AAV vectors in a similar manner. Trends in on-target editing observed in mNPCs with the AAV infection generally correlated with the AAV plasmid nucleofection data set (
[0522] The trend was confirmed by testing another set of promoters with inclusion of these enhancer sequences. Across all AAV vectors tested, constructs including PTRE1 or PTRE2 in genomes yielded an average 1.5-fold increase compared to base vectors (
[0523] The results also demonstrate that inclusion of PTRE1 in the transgene plasmid improved editing levels across all promoters evaluated (
[0524] Several constructs with tissue-specific neuronal enhancers upstream of a single constitutive promoter were also tested. In this assay, 7 neuronal enhancer sequences (constructs 65-72) were cloned into a single AAV-cis plasmid (construct 64) harboring a core CMV promoter and all demonstrated improved editing via nucleofection over base construct 64 (
TABLE-US-00022 TABLE 18 Constructs with or without PTREs and indicated sequence lengths AAV construct (Sequence length indicated below) 3 4 35 36 37 5 38 39 40 6 42 43 Promoter 584 400 234 335 Length PTRE 1 592 592 PTRE 2 593 593 593 PTRE 3 247 247 247 AAV.transgene 4550 4349 4964 4965 4619 4183 4798 4799 4453 4284 4900 4554
[0525] The results demonstrate that use of small promoters in the AAV transgene constructs permits the inclusion of additional accessory elements. These additional accessory elements, such as post-transcriptional regulatory elements to AAV-transgenes expressing CasX under the control of short but strong promoter sequences enable increased CasX expression and on-target editing while reducing cargo size such that all components can be incorporated into a single AAV vector.
Example 9: Demonstration that a CasX:Dual-gRNA System Expressed from a Single AAV Vector can Edit the Target Locus In Vitro
[0526] Experiments were performed to demonstrate the following: 1) CasX and dual gRNAs expressed from an all-in-one AAV vector can edit the target locus; 2) the ability to package and deliver CasX with a dual-guide system within a single AAV vector for targeted editing; and 3) editing of a therapeutically-relevant locus by CasX and dual gRNAs delivered via a single AAV vector can excise the targeted genomic region. For the editing at a therapeutically-relevant locus by the CasX-dual-gRNA system, experiments were conducted to demonstrate the ability of CasX and the dual-guide system to mediate excision of a CTG repeat in the 3UTR region of the human DMPK gene when delivered via AAVs in vitro into HEK293T cells. The ability to demonstrate editing mediated by the CasX:dual-gRNA system delivered and expressed from a single all-in-one AAV vector is significant because this is not achievable with traditionally used Cas9-based systems.
Materials and Methods
[0527] AAV plasmid cloning and nucleofection were conducted as described in Example 1.
[0528] Various configurations of two gRNA transcriptional unit blocks, also referred as guide RNA stacks, of the AAV transgene are illustrated in
[0529]
[0530] AAV vector production and titering were conducted as described in Example 1. AAV transduction and editing assessment via FACs sorting were conducted as described in Example 1.
[0531] AAV constructs (Construct ID 211-214) assessed in
TABLE-US-00023 TABLE19 SequencesofAAVconstructswithdual-guidestargetingeithersideoftheCTG repeatinDMPK3'UTR.NT=non-targetingguide* DNAsequence Lengthof ConstructID ComponentName orSEQIDNO: Component(bp) 211through 5ITR 3683 130 214 buffersequence 3684 23 CMVenhancer+promoter 9301 584 buffersequence 9302 18 Kozak GCCACC 6 startcodon ATGGCC 6 SV40NLS 9305 21 linker TCTAGA 6 CasX491 9291 2931 linker GGATCC 6 SV40NLS 9308 21 HAtag 9309 27 linker+stopcodon GGATCCTAA 9 buffersequence 3695 30 bGHpoly(A)signal 3696 209 buffersequence GGTACCGT 8 U6promoter 3698 242 buffersequence GAAACACC 8 Scaffold174 9311 89 Spacer1 Seespecificdualguidecombosbelow (5CTG) buffersequence 9312 20 U6promoter 3698 242 buffersequence GAAACACC 8 Scaffold174 9311 89 Spacer2 Seespecificdualguidecombosbelow (3CTG) buffersequence 3700 17 3'ITR 3701 141 211 Spacer1(20.7) 9312 20 Spacer2(20.11) 9313 20 212 Spacer1(20.7) 9312 20 Spacer2(NT) 9314 18 213 Spacer1(NT) 9314 18 Spacer2(20.11) 9313 20 214 Spacer1(NT) 9314 18 Spacer2(NT) 9314 18 *Components are listed in a 5'to 3'order within the constructs
[0532] Production of AAV vectors from AAV constructs 211-214 and subsequent titering were performed as described in Example 1.
AAV Transduction of HEK293T Cells:
[0533] 10,000 ITEK293T cells per well were seeded in 96-well plates. 24 hours later, seeded cells were treated with AAVs encoding CasX variant 491 with the dual-guide system (i.e., scaffold 174 with spacers 20.7-20.11, 20.7-NT, NT-20.11, or NT-NT; refer to Table 19 for sequences). Viral infection conditions were performed in triplicate, with normalized number of viral genomes (vg) among experimental vectors, in a series of three-fold dilution of multiplicity of infection (MOI) ranging from 1E6 to 1E4 vg/cell. Five days post-transduction, AAV-treated ITEK293T cells were harvested for gDNA extraction for editing analysis at the DMPK locus by next generation sequencing (NGS). Briefly, amplicons were amplified from 200 ng of extracted gDNA with a set of primers targeting the CTG repeat region in the DMPK 3 UTR and processed as described in Example 18.
Results
[0534]
[0535] The bar plot in
[0536] The bar plot in
[0537] Experiments were also performed to demonstrate the use of CasX and a dual-guide system in targeting and excising the CTG repeat in the 3UTR region of the human DMPK gene. The significance of evaluating the ability to target this repeat is that the neuromuscular disease myotonic dystrophy type 1 (DM1) is caused by the abnormal CTG repeat expansion in the 3 noncoding region of the human DMPK gene. Here, HEK293T cells were transduced with dual-guide AAVs harboring either two DMPK-targeting spacers (20.7 and 20.11), the combination of one DMPK-targeting spacer and one non-targeting (NT) spacer (20.7 and NT or NT and 20.11), or two non-targeting spacers (NT-NT) at various MOIs. The results shown in
[0538] Altogether, these experiments demonstrate the feasibility of using dual gRNAs in combination with the full CasX protein sequence in a single AAV, which would not be achievable with the use of larger CRISPR proteins, such as Cas9, due to the transgene packaging constraints of the AAV capsid. The experiments also show that dual guide RNAs in an all-in-one vector construct were able to retain the ability to edit the target nucleic acid. Furthermore, the results demonstrate the ability to package and deliver CasX with the dual-guide system from an all-in-one single AAV vector in vitro, which resulted in efficient editing and excision of the target genomic region. In addition to using a dual-guide system to excise a target genomic region, combining two gRNA transcriptional units could also provide the ability to 1) increase gRNA expression and thus CasX-mediated editing or 2) target two distinct genes that might have cooperative therapeutic effects. The effects of varying the orientation and position of gRNA promoters are further investigated in Examples 31 and 32.
Example 10: Nuclear Localization Sequence (NLS) Selection Enhances Small CRISPR Protein Potency
[0539] Experiments were conducted to determine whether alteration of the nuclear localization sequence (NLS) utilized in constructs can modulate editing.
Materials and Methods
[0540] AAV vectors were cloned and produced according to standard methods, which are described in Example 1. The amino acid sequences of the encoded NLS are presented in Tables 20 and 21.
[0541] Methods for production of AAV vectors and nucleofection were conducted as described in Example 1. The sequences of the additional components of AAV constructs, with the exception of sequences encoding the CasX (Table 26) and the one or more gRNA (Tables 23 and 24), are listed in Table 45.
TABLE-US-00024 TABLE20 N-terminalNLSsequences SEQID NO: NLSAminoAcidSequence* NLSID 3411 PKKKRKVSR 1 3412 PKKKRKVGGSPKKKRKVGGSPKKKRKVGGSPKKKRKVSR 2 3413 PKKKRKVGGSPKKKRKVGGSPKKKRKVGGSPKKKRKVGGSPKKKRKVGGSPKKKRKVSR 3 3414 PAAKRVKLDSR 4 3415 PAAKRVKLDGGSPAAKRVKLDSR 5 3416 PAAKRVKLDGGSPAAKRVKLDGGSPAAKRVKLDGGSPAAKRVKLDSR 6 3417 PAAKRVKLDGGSPAAKRVKLDGGSPAAKRVKLDGGSPAAKRVKLDGGSPAAKRVKLDGGSPA 7 AKRVKLDSR 3418 KRPAATKKAGQAKKKKSR 8 3419 KRPAATKKAGQAKKKKGGSKRPAATKKAGQAKKKKSR 9 3420 PAAKRVKLDGGSPKKKRKVSR 10 3421 PAAKKKKLDGGSPKKKRKVSR 11 3422 PAAKKKKLDSR 12 3423 PAAKKKKLDGGSPAAKKKKLDGGSPAAKKKKLDSR 13 3424 PAAKKKKLDGGSPAAKKKKLDGGSPAAKKKKLDGGSPAAKKKKLDSR 14 3425 PAKRARRGYKCSR 15 3426 PAKRARRGYKCGSPAKRARRGYKCSR 16 3427 PRRKREESR 17 3428 PYRGRKESR 18 3429 PLRKRPRRSR 19 3430 PLRKRPRRGSPLRKRPRRSR 20 3431 PAAKRVKLDGGKRTADGSEFESPKKKRKVGGS 21 3432 PAAKRVKLDGGKRTADGSEFESPKKKRKVPPPPG 22 3433 PAAKRVKLDGGKRTADGSEFESPKKKRKVGIHGVPAAPG 23 3434 PAAKRVKLDGGKRTADGSEFESPKKKRKVGGGSGGGSPG 24 3435 PAAKRVKLDGGKRTADGSEFESPKKKRKVPGGGSGGGSPG 25 3436 PAAKRVKLDGGKRTADGSEFESPKKKRKVAEAAAKEAAAKEAAAKAPG 26 3437 PAAKRVKLDGGKRTADGSEFESPKKKRKVPG 27 3438 PAAKRVKLDGGSPKKKRKVGGS 28 3439 PAAKRVKLDPPPPKKKRKVPG 29 3440 PAAKRVKLDPG 30 3441 PAAKRVKLDGGGSGGGSGGGS 31 3442 PAAKRVKLDPPP 32 3443 PAAKRVKLDGGGSGGGSGGGSPPP 33 3444 PKKKRKVPPP 34 3445 PKKKRKVGGS 35 *Sequences in bold are NLS, while unbolded sequences are linkers.
TABLE-US-00025 TABLE21 C-terminalNLSsequences SEQID NO: NLSAminoAcidSequence* NLSID 3446 GSPKKKRKV 1 3447 GSPKKKRKVGGSPKKKRKVGGSPKKKRKVGGSPKKKRKV 2 3448 GSPKKKRKVGGSPKKKRKVGGSPKKKRKVGGSPKKKRKVGGSPKKKRKVGGSPKKKRKV 3 3449 GSPAAKRVKLD 4 3450 GSPAAKRVKLDGGSPAAKRVKLD 5 3451 GSPAAKRVKLDGGSPAAKRVKLDGGSPAAKRVKLDGGSPAAKRVKLD 6 3452 GSPAAKRVKLDGGSPAAKRVKLDGGSPAAKRVKLDGGSPAAKRVKLDGGSPAAKRVKLDGG 7 SPAAKRVKLD 3453 GSKRPAATKKAGQAKKKK 8 3454 KRPAATKKAGQAKKKKGGSKRPAATKKAGQAKKKK 9 3455 GSPAAKRVKLGGSPAAKRVKLGGSPKKKRKVGGSPKKKRKV 10 3456 GSKLGPRKATGRWGS 11 3457 GSKRKGSPERGERKRHWGS 12 3458 GSPKKKRKVGSGSKRPAATKKAGQAKKKKLE 13 3459 GPKRTADSQHSTPPKTKRKVEFEPKKKRKV 14 3460 GGGSGGGSKRTADSQHSTPPKTKRKVEFEPKKKRKV 15 3461 AEAAAKEAAAKEAAAKAKRTADSQHSTPPKTKRKVEFEPKKKRKV 16 3462 GPPKKKRKVGGSKRTADSQHSTPPKTKRKVEFEPKKKRKV 17 3463 GPAEAAAKEAAAKEAAAKAPAAKRVKLD 18 3464 GPGGGSGGGSGGGSPAAKRVKLD 19 3465 GPPKKKRKVPPPPAAKRVKLD 20 3466 GPPAAKRVKLD 21 3467 GSPKKKRKV 22 3468 GSPAAKRVKLD 23 3469 VGSKRPAATKKAGQAKKKK 24 3470 TGGGPGGGAAAGSGSPKKKRKVGSGSKRPAATKKAGQAKKKKLE 25 3471 TGGGPGGGAAAGSGSPKKKRKVGSGSKRPAATKKAGQAKKKKLE 26 3472 TGGGPGGGAAAGSGSPKKKRKVGSGS 27 3473 PPPPKKKRKVPPP 28 3474 GGSPKKKRKVPPP 29 3475 PPPPKKKRKV 30 3476 GGSPKKKRKV 31 3477 GGSPKKKRKVGGSGGSGGS 32 3478 GGSPKKKRKVGGSPKKKRKV 33 3479 GGSGGSGGSPKKKRKVGGSPKKKRKV 34 3480 VGGGSGGGSGGGSPAAKRVKLD 35 3481 VPPPPAAKRVKLD 36 3482 VPPPGGGSGGGSGGGSPAAKRVKLD 37 3483 VGGGSGGGSGGGSPAAKRVKLD 38 3484 VPPPPAAKRVKLD 39 3485 VPPPGGGSGGGSGGGSPAAKRVKLD 40 3486 VGSPAAKRVKLD 41 *Sequences in bold are NLS, while unbolded sequences are linkers.
[0542] AAV transduction and editing level assessment in mNPTC-tdT cells by FACS were conducted as described in Example 1.
Results
[0543] Initial plasmid nucleofection revealed that a number of NLS permutations displayed improved editing when compared to control (1SV40 NLS on both the N- and C-termini). In particular, N-terminal variants containing c-MYC or Nucleoplasmin NLSs significantly outperformed SV40 NLS combinations (
[0544] The data show that selecting the amino acid sequence of the NLS can enhance editing outcomes in the AAV setting. Specifically, N-terminal Cmyc-containing NLS variants showed a clear improvement compared to N-terminal SV40 NLS variants. In addition, C-terminal c-MYC and Nucleoplasmin variants improve editing over SV40 NLS variants. Repetitions of the SV40 NLS seem to be deleterious for editing efficiency on both the N- and C-terminals.
Example 11: Introns in the 5 UTR can Enhance Small CRISPR Protein Expression
[0545] An experiment is performed to test whether transcriptional levels mediated by AAV vectors delivering small CRISPR proteins (such as CasX) can be enhanced by inclusion of different regulatory elements such as intronic sequences taken from viral, mouse, or human genomes that conventionally do not fit in AAV vectors expressing large transgene (e.g., spCas9) plasmids.
Methods
[0546] AAV cloning and production are as described in Example 1. 5 sequences used to generate the AAV cis plasmid contain protein promoters including UbC, JeT, CMV, CAG, CBH, hSyn, or other Pol2 promoter, intronic region, and N-terminal NLS, while 3 sequences contain C-terminal NLS, poly A signal, RNA promoter and guide RNA containing spacer 12.7. Non-limiting examples of intron sequences to be incorporated into the constructs are listed in Table 22.
[0547] Enhancement in editing by the inclusion of intron 36 (transgene plasmid 59) is tested against transgene plasmid 58, which was the baseline construct not containing the intron. The rest of the introns in Table 22 have been derived from viral, mouse, and human origin.
TABLE-US-00026 TABLE 22 Intron sequences for incorporation into base construct 58 SEQ Length of Intron ID NO intron (bp) 1 3487 54 2 3488 67 3 3489 62 4 3490 49 5 3491 59 6 3492 67 7 3493 66 8 3494 86 9 3495 67 10 3496 70 11 3497 476 12 3498 69 13 3499 69 14 3500 70 15 3501 70 16 3502 108 17 3503 69 18 3504 206 19 3505 70 20 3506 68 21 3507 299 22 3508 226 23 3509 71 24 3510 69 25 3511 87 26 3512 84 27 3513 82 28 3514 66 29 3515 65 30 3516 66 31 3517 106 32 3518 69 33 3519 68 34 3520 68 35 3521 97 36 3522 140 37 3523 133 38 3524 190 39 3525 271 40 3526 96 41 3527 110 42 2528 270 43 3529 116 44 3530 67 45 3531 66#
Results
[0548] The effects of introns on transgene expression are assessed by cloning 50 different introns into AAV-cis plasmid and then assaying for editing in the tdTomato assay used in the Examples supra.
[0549] When compared to the base construct without an intron, the addition of an intronic sequence generally increases the overall editing efficiency of AAV transgenes.
[0550] The results are expected to support that the addition of introns to AAV-transgenes expressing CasX under the control of short but strong promoter sequences enables increased CasX expression and on-target editing while reducing cargo size, further optimizing the AAV system.
Example 12: Improved Guide Variants Demonstrate Enhanced On-Target Activity In Vitro
[0551] Experiments were conducted to identify engineered guide RNA variants with increased activity at different genomic targets, including the therapeutically-relevant mouse and human RHO exon 1. Previous assays identified many different hotspot regions (e.g., stem loop) within the scaffold sequences holding the potential to significantly increase editing efficiency as well as specificity. Additionally, screens were conducted to identify scaffold variants that would increase the overall activity of the tested CRISPR system in an AAV vector across multiple different PAM-spacer combinations, without triggering off-target or non-specific editing. Achieving increased editing efficiency compared to current benchmark vectors would allow reduced viral vector doses to be used in in vivo studies, improving the safety of AAV-mediated CasX-guide systems.
Methods
[0552] New gRNA scaffold and spacer variants were inserted into an AAV transgene construct for plasmid and viral vector validation (encoding sequences in Tables 23 and 24). CasX 491 variant protein was used for all constructs evaluated in this experiment, however the disclosure contemplates utilizing any of the CasX variants, including those of Table 5 and the encoding sequences of Table 26. The AAV transgene was conceptually broken up between ITRs into different parts, which consisted of the therapeutic cargo and accessory elements relevant to expression in mammalian cells and the nuclease-guide RNA complex (protein nuclease, scaffold, spacer). A schematic with its conceptual parts is shown in
Cloning:
[0553] Each part in the AAV genome was separated by restriction enzyme sites to allow for modular cloning. Parts were ordered as gene fragments from Twist, PCR amplified, and digested with corresponding restriction enzymes, cleaned, then ligated into a vector also digested with the same enzymes. New AAV constructs were then transformed into chemically competent E. coli (Turbos or Stbl3s). Transformed cells were recovered for 1 hour in a 37 C. shaking incubator then plated on Kanamycin LB-Agar plates and allowed to grow at 37 C. for 12-16 hours. Colonies were picked into 6 mL of 2yt treated with Kanamycin and allowed to grow for 7-14 hours, then mini-prepped and Sanger sequenced. The transformation and miniprep protocol were then repeated and spacer-cloned vectors were sequence verified again. Validated constructs were maxi-prepped. To assess the quality of maxi-preps, constructs were processed in two separate digests with XmaI (which cuts at several sites in each of the ITRs) and XhoI which cuts once in the AAV genome. These digests and the uncut construct were then run on a 1% Agarose gel and imaged on a ChemiDoc. If the plasmid was >90% supercoiled, the correct size, and the ITRs were intact, the construct moved on to be tested via nucleofection and subsequently used for AAV vector production.
TABLE-US-00027 TABLE 23 Guide sequences cloned into p59.491.U6.X.Y. plasmids (X = guide; Y = spacer) gRNA Guide gRNA Guide + Guide.spacer Spacer Sequence Sequence Spacer Sequence Construct (SEQ ID NO) (SEQ ID NO) (SEQ ID NO) 174.11.30 3627 3631 3643 229.11.30 3627 3632 3644 230.11.30 3627 3633 3645 231.11.30 3627 3634 3646 232.11.30 3627 3635 3647 233.11.30 3627 3636 3648 234.11.30 3627 3637 3649 235.11.30 3627 3638 3650 236.11.30 3627 3639 3651 237.11.30 3627 3640 3652 174.11.31 3628 3641 3653 235.11.31 3628 3631 3654 174.11.1 3629 3631 3655 235.11.1 3629 3642 3656 235.NT 3630 3631 3657
TABLE-US-00028 TABLE 24 Guide sequences cloned into p59.491.U6.X.Y. plasmids. (X = guide; Y = spacer) with spacer length variants Spacer Guide Guide + Spacer Guide.spacer Spacer Sequence Sequence Sequence Construct length (SEQ ID NO) (SEQ ID NO) (SEQ ID NO) 174.11.30 20 nt 3658 3669 3671 174.11.39 19 nt 3659 3669 3672 174.11.38 18 nt 3660 3669 3673 174.11.31 20 nt 3661 3669 3674 174.11.37 19 nt 3662 3669 3675 174.11.36 18 nt 3663 3669 3676 235.11.1 20 nt 3664 3670 3677 235.11.41 19 nt 3665 3670 3678 235.11.40 18 nt 3666 3670 3679 235.11.2 20 nt 3667 3670 3680 235.11.43 19 nt 3668 3670 3681 235.11.42 18 nt 40542 3670 3682#
TABLE-US-00029 TABLE25 SequencesofAAVvectorcomponentscommontotheplasmids DNAsequence Lengthof Component PartName orSEQIDNO Component(bp) 5ITR 3683 130 bufferseq 3684 23 enhancer CMV 3685 380 PolIIpromoter CMV 3619 204 bufferseq 3686 15 Kozak 3687 12 startcodon MA ATGGCC 6 5NLS SV40 3689 21 5linker SR TCTAGA 6 3NLSlinker GS GGATCC 6 3NLS SV40 3692 21 tag HA 3693 27 linker GS GGATCCTAA 9 bufferseq 3695 30 Poly(A) BgHpolyA 3696 209 bufferseq GGTACCGT 8 PolIIIpromoter U6promoter 3698 242 buffer GAAACACC 8 buffer 3700 17 3ITR 3701 141
TABLE-US-00030 TABLE 26 DNA sequences encoding CasX utilized in AAV CasX SEQ Length of coding protein no. ID NO: sequence (bp) 438 3702 2931 491 3703 2932 527 3704 2934 535 3705 2935 536 3706 2935 537 3707 2935 583 3708 2935 668 3709 2938 672 3710 2934 669 3711 2938 670 3712 2938 676 3713 2938
Reporter Cell Lines:
[0554] A neural progenitor cell line isolated from the Ai9-tdTomato was cultured in suspension in pre-equilibrated mNPC medium (DMEM/F12 with GlutaMax, 10 mM HEPES, 1MEM Non-Essential Amino Acids, 1 penicillin/streptomycin, 1:1000 2-mercaptoethanol, 1B-27 supplement, minus vitamin A, 1N2 with supplemented growth factors bFGF and EGF). Prior to testing, cells were dissociated using accutase, with gentle resuspension, monitoring for complete separation of the neurospheres. Cells were then quenched with media, spun down and resuspended in fresh media. Cells were counted and directly used for nucleofection or 10,000 cells were plated in a 96-well plate coated with PLF (1Poly-DL-ornithine hydrobromide, 10 mg/mL in sterile diH20, 1 Laminin, and 1 Fibronectin), 2 days prior to AAV transduction.
[0555] A HEK293T dual reporter cell line was generated by knocking into HEK293T cells two transgene cassettes that constitutively expressed exon 1 of the human RHO gene linked to GFP and exon 1 of the human P23H.RHO gene linked to mScarlet. The modified cells were expanded by serial passage every 3-5 days and maintained in Fibroblast (FB) medium, consisting of Dulbecco's Modified Eagle Medium (DMEM; Corning Cellgro, #10-013-CV) supplemented with 10% fetal bovine serum (FBS; Seradigm, #1500-500), and 100 Units/mL penicillin and 100 mg/mL streptomycin (100-Pen-Strep; GIBCO #15140-122), and can additionally include sodium pyruvate (100, Thermofisher #11360070), non-essential amino acids (100 ThermoFisher #11140050), HEPES buffer (100 ThermoFisher #15630080), and 2-mercaptoethanol (1000 ThermoFisher #21985023). The cells were incubated at 37 C. and 5% CO2. After 1-2 weeks, GFP+/mscarlet+ cells were bulk sorted into FB medium. The reporter lines were expanded by serial passage every 3-5 days and maintained in FB medium in an incubator at 37 C. and 5% CO2. Reporter clones were generated by a limiting dilution method. The clonal lines were characterized via flow cytometry, genomic sequencing, and functional modification of the RHO locus using a previously validated RHO targeting CasX molecule. The optimal reporter lines were identified as ones that: i) had a single copy of WTRHO.GFP and mutRHO.mScarlet correctly integrated per cell; ii) maintained doubling times equivalent to unmodified cells; and iii) resulted in reduction in GFP and mscarlet fluorescence upon disruption of the RHO gene when assayed using the methods described below.
Plasmid Nucleofection:
[0556] AAV cis-plasmids driving expression of the CasX-scaffold-guide system were nucleofected in mNPCs using the Lonza P3 Primary Cell 96-well Nucleofector Kit. For the ARPE-19 line, the Lonza SF solution and supplement was used. Plasmids were diluted to concentrations of 200 ng/l, 100 ng/L. 5 L of DNA per construct was added to the P3 or SF solution containing 200,000 tdTomato mNPCs or ARPE-19 cells respectively. The combined solution was nucleofected using a Lonza 4D Nucleofector System according to manufacturer's guidelines. Following nucleofection, the solution was quenched with appropriate culture media. The solution was then aliquoted in triplicate (approx. 67,000 cells per well) in a 96-well plate. 48 hours after transfection, treated mNPCs were replenished with fresh mNPC media containing growth factors and treated ARPE-19 cells were replenished with fresh FB medium. 5 days after transfection, tdTomato mNPCs and ARPE-19 cells were lifted and activity was assessed by FACS.
AAV Vectors Production:
[0557] Suspension HEK293T cells were adapted from parental HEK293T and grown in FreeStyle 293 media. For screening purposes, small scale cultures (20-30 mL cultured in 125 mL Erlenmeyer flasks and agitated at 110 rpm) were diluted to a density of 1.5e+6 cells/mL on the day of transfection. Endotoxin-free pAAV plasmids with the transgene flanked by ITR repeats were co-transfected with plasmids supplying the adenoviral helper genes for replication and encoding AAV rep/cap proteins using PEI MAX (Polysciences) in serum-free Opti-MEM media. Cultures were supplemented with 10% CDM4HEK293 (HyClone) 3 hours post-transfection. Three days later, cultures were centrifuged at 1000 rpm for 10 minutes to separate the supernatant from the cell pellet. The supernatant was mixed with 40% PEG 2.5M NaCl (8% final concentration) and incubated on ice for at least 2 hours to precipitate AAV viral particles. The cell pellet, containing the majority of the AAV vectors, was resuspended in lysis media (0.15M NaCl, 50 mM Tris HCl, 0.05% Tween, pH 8.5), sonicated on ice (15 seconds, 30% amplitude) and treated with Benzonase (250 U/L, Novagen) for 30 minutes at 37 C. Crude lysate and PEG-treated supernatant were then spin at 4000 rpm for 20 minutes at 4 C. to resuspend the PEG precipitated AAV (pellet) with cell debris-free crude lysate (supernatant) clarified further using a 0.45 M filter.
[0558] To determine the viral genome titer, 1 L from crude lysate viruses was digested with DNase and proteinase K, followed by quantitative PCR. 5 L of digested virus was used in a 25 L qPCR reaction composed of IDT primetime master mix and a set of primer and 6FAM/Zen/IBFQ probe (IDT) designed to amplify the CMV promoter region or a 62 bp-fragment located in the AAV2-ITR. Ten-fold serial dilutions (5 pl each of 2e+9 to 2e+4 DNA copies/mL) of an AAV ITR plasmid was used as reference standards to calculate the titer (viral genome (vg)/mL) of viral samples.
AAV Transduction:
[0559] 10,000 cells/well of mNPCs were seeded on PLF-coated wells in 96-well plates 48-hours before AAV transduction. All viral infection conditions were performed in triplicate, with normalized number of vg among experimental vectors, in a series of 3-fold dilution of multiplicity of infection (MOI) ranging from 1.0e+6 to 1.0e+4 vg/cell. Calculations were based on an estimated number of 20,000 cells per well at the time of transfection. Final volume of 50 L of AAV vectors diluted in pre-equilibrated mNPC medium supplemented with bFGF/EGF growth factors (20 ng/ml final concentration) were applied to each well. 48 hours post-transfection, complete media change was performed with fresh media supplemented with growth factors. Editing activity (tdT+ cell quantification) was assessed by FACS 5 days post-transfection.
[0560] Assessing editing activity by FACS: 5 days after transfection, treated tdTomato mNPCs or ARPE-19 cells in 96-well plates were washed with dPBS and treated with 50 L TrypLE and Trypsin (0.25%) for 15 and 5 minutes respectively. Following cell dissociation, treated wells were quenched with media containing DMEM, 10% FBS and 1penicillin/streptomycin. Resuspended cells were transferred to round-bottom 96-well plates and centrifuged for 5 min at 1000g. Cell pellets were then resuspended with dPBS containing 1DAPI, and plates were loaded into an Attune NxT Flow Cytometer Autosampler. The Attune NxT flow cytometer was run using the following gating parameters: FSC-ASSC-A to select cells, FSC-HFSC-A to select single cells, FSC-AVL1-A to select DAPI-negative alive cells, and FSC-AYL1-A to select tdTomato positive cells.
[0561] NGS analysis of indels at mRHO exon 1 locus: 5 days after transfection, treated tdTomato mNPCs in 96-well plates were washed with dPBS and treated with 50 L TrypLE and trypsin (0.25%) for 15 and 5 minutes respectively. Following cell dissociation, treated wells were quenched with media containing DMEM, 10% FBS and 1 penicillin/streptomycin. Cells were then spun down and resulting cell pellets washed with PBS prior to processing them for gDNA extraction using the Zymo mini DNA kit according to the manufacturer's instructions. For assessing editing levels occurring at the mouse RHO exon 1 locus, amplicons were amplified from 200ng of gDNA with a set of primers targeting the RHO exon 1 locus, bead-purified (Beckman coulter, Agencourt Ampure XP) and then re-amplified to incorporate Illumina adapter sequences. Specifically, these primers contained an additional sequence at the 5 ends to introduce Illumina read and 2 sequences as well as a 16 nt random sequence that functions as a unique molecular identifier (UMI). Quality and quantification of the amplicon was assessed using a Fragment Analyzer DNA analyzer kit (Agilent, dsDNA 35-1500 bp). Amplicons were sequenced on the Illumina Miseq according to the manufacturer's instructions. Raw fastq files from sequencing were processed as follows: (1) the sequences were trimmed for quality and for adapter sequences using the program cutadapt (v. 2.1); (2) the sequences from read 1 and read 2 were merged into a single insert sequence using the program flash2 (v2.2.00); and (3) the consensus insert sequences were run through the program CRISPResso2 (v 2.0.29), along with the expected amplicon sequence and the spacer sequence. This program quantifies the percent of reads that were modified in a window around the 3 end of the spacer (30 bp window centered at 3 bp from 3 end of spacer). The activity of the CasX molecule was quantified as the total percent of reads that contain insertions, substitutions and/or deletions anywhere within this window.
Results
[0562] Different editing experiments were conducted to quantify on-target cleavage mediated by CasX 491 paired with gRNA scaffold variants (guides 174 & 229-237) with different spacers targeting multiple genomic loci of interest. Constructs were cloned into the AAV backbone p59, flanked by ITR2 sequences, driving expression of the protein Cas 491 under the control of a CMV promoter, as well as the scaffold-spacer under the control of the human U6 promoter.
[0563] The mNPC-tdT reporter cell line was used to assess single-cut efficiency at the endogenous mouse RHO exon 1 locus (spacer 11.30, CTC PAM). A dual reporter system integrated in a ARPE-19 derived cell line was also used to assess on-target editing at the exogenously expressed human WT RHO locus (spacer 11.1, CTC PAM).
[0564] Scaffold variants with spacer 11.30 were tested via nucleofection in the mouse NPC cell line at two different doses, 1000ng and 500ng. Constructs were compared to the current benchmark gRNA scaffold 174 activity. Constructs expressing scaffold variants 231, 233, 234, 235 performed at higher levels than ones with scaffold 174.11.30 (
[0565] Experiments were performed to test whether these scaffold variants packaged efficiently in AAV and remained potent when delivered virally. mNPC transduced with AAV vectors expressing guide scaffold 235 with spacer 11.30 (on-target, mouse WT RHO) showed increased activity at the on-target locus (>5-fold increase,
[0566] Assessing effects of spacer length: Another set of experiments was conducted to test whether spacer length variants could improve on-target activity. Spacers 11.39, 11.38 and spacer 11.37 (19 nt P23H RHO), 11.36 (18 nt P23H RHO) were designed from parental spacer 11.30 (20 nt WT RHO) and 11.31 (20 nt P23H RHO), respectively, harboring 1 or 2 bp truncations on the 3 end of the sequence. mfNPC-tdT cells were nucleofected with 1000 ng and 500 ng of constructs p59.491.174.11.30 (20 nt WT RHO), p59.491.174.11.39 (19 nt WT RHO), p49.491.174.11.38 (18 nt WT RHO), and editing levels were assessed 5 days later. All truncated spacer versions improved editing levels (
[0567] These results support that scaffold variants with structural mutations can be engineered with increased activity in dual reporter systems investigating therapeutically relevant genomic targets such as the mouse and human RHO exon 1 loci. Furthermore, while the newly characterized scaffold displayed overall >2-fold increase in activity, no off-target cleavage with a 1-bp mismatch spacer region was detected. This is relevant for allele-specific therapeutic strategy such as autosomal dominant retinitis pigmentosa P23H RHO, which mutated allele differs from WT sequence by 1 nucleotide, targeted by spacer 11.31. This study further validates the use of guide scaffold 235 in AAV vectors designed for P23H RHO rescue and genotoxic studies as well as for other therapeutic targets.
Example 13: Improved Scaffold and Guide Variants Demonstrate Enhanced On-Target Activity In Vivo
[0568] Experiments were conducted to demonstrate that engineered CasX & gRNA-guide and spacer variants harboring structural mutations that improve selectivity and on-target activity lead to increase edits when delivered in vivo to photoreceptors in the mouse retina, with a spacer targeting the P23 residue at a therapeutically relevant level in the WT. Here, it was assessed whether vector expressing CasX variant 491, guide variant 235 and spacer 11.39 improves editing levels compared to parental CasX 491, guide variant 174 and spacer 11.30 in vivo.
Materials and Methods
[0569] Generation of AAV Plasmids and Viral Vectors: The CasX variant 491 under the control of the RHO promoter, and gRNA.guide variant 174 with spacer 11.30 and spacer 11.31 (AAGTGGCTCCGCACCACGCC (SEQ ID NO: 3628)) or gRNA-guide variant 235 with spacer 11.39 (AAGGGGCTCCGCACCACGCC (SEQ ID NO: 3658)) and 11.37 (AAGTGGCTCCGCACCACGC (SEQ ID NO: 3662)) targeting mouse RHO exon 1 at P23 residues) under the U6 promoter were cloned into the p59 plasmid flanked with AAV2 ITR.
[0570] Cloning: Each part in the AAV genome was separated by restriction enzyme sites to allow for modular cloning. Parts were ordered as gene fragments from Twist, PCR amplified, and digested with corresponding restriction enzymes, cleaned, then ligated into a vector also digested with the same enzymes. Cas X variant 491 under the RHO promoter and scaffold variants 174 and 235, under the control of the human U6 promoter, were cloned into an AAV backbone, flanked by AAV2 ITRs. Spacers 11.30, 11.31 and variants 11.39, 11.37 were cloned respectively into pAAV.RHO.491.174 and pAAV.RHO.491.235 using Golden Gate cloning. New AAV constructs were then transformed into chemically competent E. coli (Stbl3s). Validated constructs were maxi-prepped. To assess the quality of maxi-preps, constructs were processed in two separate digests with XmaI (which cuts at several sites in each of the ITRs) and XhoI which cuts once in the AAV genome. If the plasmid was >90% supercoiled, the correct size, and the ITRs were intact, the construct was subsequently used for AAV vector production.
AAV Vectors Production:
[0571] Suspension HEK293T cells were adapted from parental HEK293T and grown in FreeStyle 293 media. 500 mL cultures were diluted to a density of 2e+6 cells/mL on the day of transfection. Endotoxin-free pAAV plasmids with the transgene flanked by ITR repeats were co-transfected with plasmids supplying the adenoviral helper genes for replication and encoding AAV rep/cap proteins using PEI MAX (Polysciences) in serum-free Opti-MEM media. Three days later, cultures were centrifuged to separate the supernatant from the cell pellet, and the AAV particles were collected, concentrated, and filtered following standard procedures.
[0572] To determine the viral genome titer, 1 L from crude lysate viruses was digested with DNase and proteinase K, followed by quantitative PCR. 5 L of digested virus was used in a 25 L qPCR reaction composed of IDT primetime master mix and a set of primers and 6FAM/Zen/IBFQ probe (IDT) designed to amplify a 62 bp-fragment located in the AAV2-ITR. An AAV ITR plasmid was used as reference standards to calculate the titer (viral genome (vg)/mL) of viral samples.
[0573] Subretinal injections C57BL6J mice were obtained from the Jackson Laboratories and were maintained in a normal 12-hour light/dark cycle. Subretinal injections were performed on 3-4 weeks old mice. Mice were anesthetized with isoflurane inhalation. Proparacaine (0.5%) was applied topically on the cornea and the eyes were dilated with drops of tropicamide (1%) and phenylephrine (2.5%). Eyes were kept lubricated with Genteal gel during the surgery. Under a surgical microscope, an ultrafine 30-gauge disposable needle was passed through the sclera, at the equator and next to the limbus, to create a small hole into the vitreous cavity. Using a blunt-end needle, 1-1.5 L of virus was injected directly into the subretinal space, between the RPE and retinal layer. Each mouse from the experimental groups was injected with 1.5.0e+9 viral genome (vg)/eye.
[0574] NGS analysis: 3 weeks post-injection, animals were sacrificed, and the eyes enucleated in fresh PBS. Whole retinae were isolated from the eye cups and processed for gDNA extraction using the DNeasy Blood & Tissue Kit (Qiagen) according to the manufacturer's instructions. Amplicons were amplified from 200 ng of gDNA with a set of primers targeting the mouse RHO, exon 1 locus, bead-purified (Beckman coulter, Agencourt Ampure XP) and then re-amplified to incorporate Illumina adapter sequences. Specifically, these primers contained an additional sequence at the 5 ends to introduce Illumina read and 2 sequences, as well as a 16 nt random sequence that functions as a unique molecular identifier (UMI). Quality and quantification of the amplicon was assessed using a Fragment Analyzer DNA analyzer kit (Agilent, dsDNA 35-1500 bp). Amplicons were sequenced on the Illumina Miseq according to the manufacturer's instructions. Raw fastq files from sequencing were processed as follows: (1) the sequences were trimmed for quality and for adapter sequences using the program cutadapt (v. 2.1); (2) the sequences from read 1 and read 2 were merged into a single insert sequence using the program flash2 (v2.2.00); and (3) the consensus insert sequences were run through the program CRISPResso2 (v 2.0.29), along with the expected amplicon sequence and the spacer sequence. This program quantifies the percent of reads that were modified in a window around the 3 end of the spacer (30 bp window centered at 3 bp from 3 end of spacer). The activity of the CasX molecule was quantified as the total percent of reads that contain insertions, substitutions and/or deletions anywhere within this window.
Results
[0575] The benchmark vector, AAV.491.174.11.30 (on-target) achieved 8% editing across all samples (
[0576] These experiments demonstrate proof-of-concept that CasX 491 expression driven by a rod photoreceptor-selective promoter with scaffold 174, and a spacer targeting the mouse P23 RHO locus can achieve therapeutic-relevant levels of edits at the P23 mouse locus when sub-retinally delivered via AAV in the murine retina. These results also support that editing levels achieved from engineered gRNA guide (235) and spacer variants (11.39) screened previously in vitro translate as well in vivo, and retain allele-specific selectivity. This study further validates the use of guide scaffold 235 in AAV vectors designed for P23H RHO rescue and genotoxic studies, as well as for other therapeutic targets.
[0577] The results of Examples 11 and 12 support that scaffold variants with structural mutation can be engineered with increased activity in dual reporter systems investigating therapeutically relevant genomic targets such as the mouse and human RHO exon 1 loci. Furthermore, while the newly characterized 235 scaffold displayed an overall >2-fold increase in activity, no off-target cleavage with 1-bp mismatch spacer region was detected. This is relevant for allele-specific therapeutic strategy such as autosomal dominant retinitis pigmentosa P23H RHO, which mutated allele differs from WT sequence by 1 nucleotide, targeted by spacer 11.31. The present study was conducted to further validate the use of guide scaffold 235 in AAV vectors designed for mouse P23H RHO rescue and genotoxic studies, as well as for other therapeutic targets.
Example 14: Improved CasX Variants Demonstrate Enhanced On-Target Activity In Vitro
[0578] The CasX protospacer adjacent motif allows for genomic targeting with precision, which is necessary for various genome editing therapeutic applications, such as autosomal dominant RHO, which requires an allele-specific targeting of the P23H mutation without altering the wild-type sequence.
[0579] Experiments were conducted to investigate whether rationally-designed engineered CasX nucleases, with introduced mutations predicted to increase CTC-PAM mediated on-target activity while keeping fidelity high, and with reduced off-target events, improved editing levels at the endogenous mouse RHO locus when delivered in vivo to rod photoreceptors cells,
[0580] Additionally, experiments were conducted to further validate the use of guide scaffold 235 in AAV vectors designed for mouse P23H RHO rescue and genotoxic studies, as well as for other therapeutic targets.
Methods
[0581] CasX protein variants identified in different assays looking at PAM activity were selected for their increased activity at CTC PAM. The CasX proteins were cloned into an AAV transgene construct for plasmid and viral vector validation. The AAV transgene was conceptually broken up between ITRs into different parts, which consisted of the therapeutic cargo and accessory elements relevant to expression in mammalian cells and the nuclease-guide RNA complex (Protein, scaffold, spacer).
Cloning:
[0582] Each part in the AAV genome was separated by restriction enzyme sites to allow for modular cloning. Parts were ordered as gene fragments from Twist, PCR amplified, and digested with corresponding restriction enzymes, cleaned, then ligated into a vector also digested with the same enzymes. New AAV constructs were then transformed into chemically competent E. coli (Stbl3s). Validated constructs were maxi-prepped. To assess the quality of maxi-preps, constructs were processed in two separate digests with XmaI (which cuts at several sites in each of the ITRs) and XhoI which cuts once in the AAV genome. These digests and the uncut construct were then run on a 1% agarose gel. If the plasmid was >90% supercoiled, the correct size, and the ITRs were intact, the construct moved on to be tested via nucleofection and subsequently used for AAV vector production.
Reporter Cell Lines:
[0583] An immortalized neural progenitor cell line isolated from the Ai9-tdTomato was cultured in suspension in pre-equilibrated mNPC medium (DMEM/F12 with GlutaMax, 10 mM HEPES, 1MEM Non-Essential Amino Acids, 1 penicillin/streptomycin, 1:1000 2-mercaptoethanol, 1B-27 supplement, minus vitamin A, 1N2 with supplemented growth factors bFGF and EGF. Prior to testing, cells were lifted using accutase, with gentle resuspension, monitoring for complete separation of the neurospheres. Cells were then quenched with media, spun down and resuspended in fresh media. Cells were counted and directly used for nucleofection or 10,000 cells were plated in a 96-well plate coated with PLF (1Poly-DL-ornithine hydrobromide, 10 mg/mL in sterile diH20, 1Laminin, and 1Fibronectin), 2 days prior to AAV transduction.
[0584] A HEK293T dual reporter cell line was generated by knocking into HEK293T cells two transgene cassettes that constitutively expressed exon 1 of the human RHO gene linked to GFP and exon 1 of the human P23H.RHO gene linked to mscarlet. The modified cells were expanded by serial passage every 3-5 days and maintained in Fibroblast (FB) medium, consisting of Dulbecco's Modified Eagle Medium (DMEM; Corning Cellgro, #10-013-CV) supplemented with 10% fetal bovine serum (FBS; Seradigm, #1500-500), and 100 Units/mL penicillin and 100 mg/mL streptomycin (100-Pen-Strep; GIBCO #15140-122), and can additionally include sodium pyruvate (100, Thermofisher #11360070), non-essential amino acids (100 ThermoFisher #11140050), HEPES buffer (100 ThermoFisher #15630080), and 2-mercaptoethanol (1000 ThermoFisher #21985023). The cells were incubated at 37 C. and 5% CO2. After 1-2 weeks, GFP+/mscarlet+ cells were bulk sorted into FB medium. The reporter lines were expanded by serial passage every 3-5 days and maintained in FB medium in an incubator at 37 C. and 5% CO2. Reporter clones were generated by a limiting dilution method. The clonal lines were characterized via flow cytometry, genomic sequencing, and functional modification of the RHO locus using a previously validated RHO targeting CasX molecule. The optimal reporter lines were identified as ones that: i) had a single copy of WT-RHO.GFP and P23H-RHO.mScarlet correctly integrated per cell; ii) maintained doubling times equivalent to unmodified cells; and iii) resulted in reduction in GFP and mScarlet fluorescence upon disruption of the RHO gene when assayed using the methods described below.
Plasmid Nucleofection:
[0585] AAV cis-plasmids driving expression of the CasX-scaffold-guide system were nucleofected in mNPCs using the Lonza P3 Primary Cell 96-well Nucleofector Kit. For the ARPE-19 line, the Lonza SF solution and supplement was used. Plasmids were diluted to concentrations of 200 ng/ul, 100 ng/L. 5 L of DNA per construct was added to the P3 or SF solution containing 200,000 tdTomato mNPCs or ARPE-19 cells respectively. The combined solution was nucleofected using a Lonza 4D Nucleofector System according to manufacturer's guidelines. Following nucleofection, the solution was quenched with appropriate culture media. The solution was then aliquoted in triplicate (approx. 67,000 cells per well) in a 96-well plate. 48 hours after transfection, treated cells were replenished with fresh mNPC media containing growth factors. 5 days after transfection, tdTomato mNPCs were lifted and activity was assessed by FACS.
AAV Vectors Production:
[0586] Suspension HEK293T cells were adapted from parental HEK293T and grown in FreeStyle 293 media. For screening purposes, small scale cultures (20-30 mL) were diluted to a density of 1.5e+6 cells/mL on the day of transfection. Endotoxin-free pAAV plasmids with the transgene flanked by ITR repeats were co-transfected with plasmids supplying the adenoviral helper genes for replication and encoding AAV rep/cap proteins using PEI MAX (Polysciences) in serum-free Opti-MEM media. Three days later, cultures were centrifuged to separate the supernatant from the cell pellet, and the AAV particles were collected, concentrated, and filtered following standard procedures.
[0587] To determine the viral genome titer, 1 L from crude lysate viruses was digested with DNase and proteinase K, followed by quantitative PCR. 5 L of digested virus was used in a 25 L qPCR reaction composed of IDT primetime master mix and a set of primers and 6FAM/Zen/IBFQ probe (IDT) designed to amplify the CMV promoter region or a 62 nucleotide-fragment located in the AAV2-ITR. Ten-fold serial dilutions (5 pl each of 2e+9 to 2e+4 DNA copies/mL) of an AAV ITR plasmid was used as reference standards to calculate the titer (viral genome (vg)/mL) of viral samples.
AAV Transduction:
[0588] 10,000 cells/well of mNPCs were seeded on PLF-coated wells in 96-well plates 48-hours before AAV transduction. All viral infection conditions were performed in triplicate, with normalized number of vg among experimental vectors, in a series of 3-fold dilution of multiplicity of infection (MOI) ranging from 1.0e+6 to 1.0e+4 vg/cell. Calculations were based on an estimated number of 20,000 cells per well at the time of transfection. Final volumes of 50 L of AAV vectors diluted in pre-equilibrated mNPC medium supplemented with bFGF/EGF growth factors (20 ng/ml final concentration) were applied to each well. 48 hours post-transfection, complete media change was performed with fresh media supplemented with growth factors. Editing activity (tdT+ cell quantification) was assessed by FACS 5 days post-transfection.
Assessing Editing Activity by FACS:
[0589] 5 days after transfection, treated tdTomato mNPCs or ARPE-19 cells in 96-well plates were washed with dPBS and treated with 50 L TrypLE and Trypsin (0.25%) for 15 and 5 minutes, respectively. Following cell dissociation, treated wells were quenched with media containing DMEM, 10% FBS and 1 penicillin/streptomycin. Resuspended cells were transferred to round-bottom 96-well plates and centrifuged for 5 min at 1000g. Cell pellets were then resuspended with dPBS containing 1DAPI, and plates were loaded into an Attune NxT Flow Cytometer Autosampler. The Attune NxT flow cytometer was run using the following gating parameters: FSC-ASSC-A to select cells, FSC-HFSC-A to select single cells, FSC-AVL1-A to select DAPI-negative alive cells, and FSC-AYL1-A to select tdTomato positive cells.
NGS Analysis of Indels at mRHO Exon I Locus:
[0590] 5 days after transfection, treated tdTomato mNPCs in 96-well plates were washed with dPBS and treated with 50 L TrypLE and trypsin (0.25%) for 15 and 5 minutes, respectively. Following cell dissociation, treated wells were quenched with media containing DMEM, 10% FBS and 1 penicillin/streptomycin. Cells were then spun down and resulting cell pellets washed with PBS prior to processing them for gDNA extraction using the Zymo mini DNA kit according to the manufacturer's instructions. For assessing editing levels occurring at the mouse RHO exon 1 locus, amplicons were amplified from 200 ng of gDNA with a set of primers targeting the mouse RHO exon 1 locus, bead-purified (Beckman coulter, Agencourt Ampure XP) and then re-amplified to incorporate Illumina adapter sequences. Specifically, these primers contained an additional sequence at the 5 ends to introduce Illumina read and 2 sequences as well as a 16 nt random sequence that functions as a unique molecular identifier (UMI). Quality and quantification of the amplicon was assessed using a Fragment Analyzer DNA analyzer kit (Agilent, dsDNA 35-1500 bp). Amplicons were sequenced on the Illumina Miseq according to the manufacturer's instructions. Raw fastq files from sequencing were processed as follows: (1) the sequences were trimmed for quality and for adapter sequences using the program cutadapt (v. 2.1); (2) the sequences from read 1 and read 2 were merged into a single insert sequence using the program flash2 (v2.2.00); and (3) the consensus insert sequences were run through the program CRISPResso2 (v 2.0.29), along with the expected amplicon sequence and the spacer sequence. This program quantifies the percent of reads that were modified in a window around the 3 end of the spacer (30 bp window centered at 3 bp from 3 end of spacer). The activity of the CasX molecule was quantified as the total percent of reads that contain insertions, substitutions and/or deletions anywhere within this window.
Results
[0591] Engineered mutations in prior assays identified CasX variants with the ability to increase both overall activity, specificity of the nuclease, as well as increased activity with spacers targeting CTC-PAM sites. These mutations to the CasX 491 protein gave rise to CasX variant proteins 515, 527, 528, 535, 536 and 537 (see Table 5 for sequences).
[0592] Multiple editing screens were conducted to quantify on-target editing levels mediated by these CasX variant proteins paired with gRNA scaffolds 174 or 235 and different spacers targeting multiple genomic loci of interest (the encoding sequences of the guides and spacers are presented in Tables 23 and 24). Constructs were cloned into the AAV backbone p59, flanked by ITR2 sequences, driving expression of the Cas X under the control of a CMV promoter, as well the scaffold-spacer under the control of the human U6 promoter. The mNPC-tdT reporter cell line was used to assess single-cut efficiency at the endogenous mouse RHO exon 1 locus (spacer 11.39, CTC PAM,
[0593] The CasX protein variants with spacer 11.39 were tested via nucleofection in the mouse NPC cell line at two different doses, 1000 ng and 500 ng. Constructs were compared to the parental CasX 491 activity. AAV constructs expressing CasX 535 and 537 with scaffold 174 and spacer 11.30 demonstrated the greatest editing activity at the mRHO exon 1 locus of any of the CasX variants (by percent editing,
[0594] Experiments were then conducted to determine whether the improvements observed at the mouse RHO locus with the mutated variants translated at the human RHO locus, which is more clinically-relevant. The dual reporter ARPE-19 cell line was nucleofected with constructs expressing the CasX variant proteins paired with either gRNA-scaffold 235 with spacer 11.41 or spacer11.43, targeting human RHO. CasX 535 and 537 also displayed over 1.5-fold increased editing activity compared to CasX 491 (4.3% and 4.1% editing compared to 2.4% editing of Rho-GFP cells respectively,
[0595] Finally, experiments were performed to assess whether these protein variants packaged efficiently in AAV and remained potent when delivered virally. mNPC transduced with AAV vectors expressing CasX 527, 535 and 537 and guide scaffold 235 with spacer 11.39 (on target, mouse WT RHO) showed increased activity at the on-target locus (>2-fold increase,
[0596] These results support that CasX variants with structural mutations can be engineered resulting in increased editing activity in dual reporter systems at therapeutically-relevant genomic targets, such as the mouse and human RHO exon 1 loci. Furthermore, while the newly-characterized variants displayed an overall 1.5-2-fold increase in activity, they retained allele-specific targeting with no off-target cleavage detected with a 1-bp mismatch spacer. This is relevant for allele-specific therapeutic strategy, such as editing at autosomal dominant retinitis pigmentosa P23H RHO, where the mutated allele differs from WT sequence by 1 nucleotide (targeted by spacer 11.37). This study further validates the use of CasX variants 527, 535, 536 with scaffold 235 in AAV vectors designed for P23H RHO rescue and genotoxic studies, as well as for other therapeutic targets.
Example 15: AAV Constructs with CasX and Targeted Guides Edit the P23 RHO Locus In Vivo in C57BL/6J Mice
[0597] Experiments were conducted to demonstrate the ability of CasX to edit in vivo the endogenous RHO locus in the mouse retina, with a spacer targeting the P23 residue at a therapeutically relevant level, to generate proof-of-concept data that is expected to justify and inform experiments in the P23H mouse disease model. Here, it was assessed whether CasX variant 491 and guide variant 174, and a spacer targeting the P23 locus of the mouse RHO gene can generate significant, detectable in the retina when injected sub-retinally, and evaluate efficacy and safety of two different viral doses (1.0e+9 and 1.0e+10 vg). Rescue of 10% of rod photoreceptors can restore vision in cases of autosomal dominant retinitis pigmentosa (adRP). Therefore, editing 10% of the RHO loci in rod photoreceptors in the retina may provide a therapeutic benefit in a disease context by reducing the levels of the mutant rhodopsin protein and preventing rod photoreceptor degeneration.
Materials and Methods
Generation of AAV Plasmids and Viral Vectors:
[0598] The CasX variant 491 under the control of the CMV promoter and RNA guide variant 174/spacer 11.30 (AAGGGGCTCCGCACCACGCC (SEQ ID NO: 3627), targeting mouse RHO exon 1 at P23 residues) under the U6 promoter were cloned into a pAAV plasmid flanked with AAV2 ITR. AAV.491.174.11.30 vectors were produced in HEK293 cells using the triple-transfection method.
Subretinal Injections:
[0599] C57BL/6J mice were obtained from the Jackson Laboratories and maintained in a normal 12-hour light/dark cycle. Subretinal injections were performed on 5-6 weeks old mice. Mice were anesthetized with isoflurane inhalation. Proparacaine (0.5%) was applied topically on the cornea and the eyes were dilated with drops of tropicamide (1%) and phenylephrine (2.5%). Eyes were kept lubricated with Genteal gel during the surgery. Under a surgical microscope, an ultrafine 30-gauge disposable needle was passed through the sclera, at the equator and next to the limbus, to create a small hole into the vitreous cavity. Using a blunt-end needle, 1-1.5 L of virus was injected directly into the subretinal space, between the RPE and retinal layer. Each experimental group (n=5) were injected in one eye with 1e+9 vg or 1e+10 viral genome (vg)/eye, and the contralateral eye injected with the AAV formulation buffer.
NGS Analysis:
[0600] 3 weeks post-injection, animals were sacrificed, and the eyes enucleated in fresh PBS. Whole retinae were isolated from the eye cups and processed for gDNA extraction using the DNeasy Blood & Tissue Kit (Qiagen) according to the manufacturer's instructions. Amplicons were amplified from 200ng of gDNA with a set of primers targeting the mouse RHO, exon 1 locus, bead-purified (Beckman coulter, Agencourt Ampure XP) and then re-amplified to incorporate Illumina adapter sequences. Specifically, these primers contained an additional sequence at the 5 ends to introduce Illumina read and 2 sequences as well as a 16 nt random sequence that functions as a unique molecular identifier (UMI). Quality and quantification of the amplicon was assessed using a Fragment Analyzer DNA analyzer kit (Agilent, dsDNA 35-1500 bp). Amplicons were sequenced on the Illumina Miseq according to the manufacturer's instructions. Raw fastq files from sequencing were processed as follows: (1) the sequences were trimmed for quality and for adapter sequences using the program cutadapt (v. 2.1); (2) the sequences from read 1 and read 2 were merged into a single insert sequence using the program flash2 (v2.2.00); and (3) the consensus insert sequences were run through the program CRISPResso2 (v 2.0.29), along with the expected amplicon sequence and the spacer sequence. This program quantifies the percent of reads that were modified in a window around the 3 end of the spacer (30 bp window centered at 3 bp from 3 end of spacer). The activity of the CasX molecule was quantified as the total percent of reads that contain insertions, substitutions and/or deletions anywhere within this window.
Immunohistology:
[0601] Mice were euthanized 3-4 weeks post-injection. Enucleated eyes were placed in 10% formalin overnight at 4 C. Retinae were dissected out from the eye cups, rinsed in PBS thoroughly and immersed in 15%-30% sucrose gradient. Tissues were embedded in optimal cutting temperature (OCT), froze on dry ice before being transferred to 80C storage. 20 M sections were cut using a cryostat. The sections were blocked for 1 hour at room temperature in blocking buffer (2% normal goat serum, 1% BSA, 0.1% Triton-X 100) before antibody labeling. The antibodies used were anti-mouse HA (Abcam, 1:500) and Alexa Fluor 488 rabbit anti-mouse (Invitrogen, 1:2000). Sections were counterstained with DAPI to label nuclei, mounted on slides and imaged on a fluorescent microscope.
Results
[0602] The ability of CasX to edit the P23 RHO locus in the mouse retina was assessed. Two therapeutically relevant doses, 1.0e+9 and 1.0E+10 vg of AAV-CasX.491.174.11.30 were administered in the subretinal space of 5-6 weeks old C57BL/6J mice. Three weeks post-injections, retinae were harvested and editing levels quantified via NGS and the CRISPResso analysis pipeline. The spacer 11.30 targets the WT P23 genomic locus (
[0603] Immunohistochemistry performed on injected retinal cross-sectioned confirmed CasX expression in the photoreceptor layers, but also showed spread of the virus to the inner layers as show in in
[0604] Under the conditions of the experiments, the results demonstrate proof-of-concept that CasX 491, scaffold 174, and a spacer targeting the mouse P23 RHO locus can achieve therapeutically-relevant levels of edits at the P23 mouse locus when sub-retinally delivered via AAV in the murine retina.
Example 16: AAV-Mediated Selective Expression of CasX in Photoreceptors Result in Strong On-Target Activity In Vivo by NGS and Structural Analysis
[0605] Experiments were conducted to demonstrate the ability of CasX to edit selectively photoreceptors in the mouse retina by restricting its expression with a selective photoreceptor promoter, with a spacer targeting the P23 residue at a therapeutically relevant level in the wild-type retina. Further, a strong correlation between editing and proteomic levels was shown in a transgenic reporter model expressing GFP only in rod photoreceptors. Here, it was assessed whether CasX variant 491 and guide variant 174 with a spacer targeting the integrated GFP locus generated significant, detectable editing levels in the retina when injected sub-retinally, and evaluated the efficacy of two different viral doses (1.0e+9 and 1.0e+10 vg per eye).
Methods
[0606] Generation of AAV Plasmids and Viral Vectors: The CasX variant 491 under the control of the various photoreceptor-specific promoters (RP1, RP2, RP3 based on endogenous rhodopsin RHO promoter, and RP4, RP5 based on endogenous G-coupled Retinal Kinase GRK1 promoter; sequences in Table 27) as well as the CMV promoter, and the gRNA guide variant 174/spacer 11.30 (AAGGGGCUCCGCACCACGCC; SEQ ID NO: 9340), targeting mouse RHO exon 1 at P23 residue) under the U6 promoter were cloned into pAAV plasmid flanked with AAV2 ITR. A WPRE sequence was also included in the p59.RP4.491.174.11.30, and p59.RP5.491.174.11.30 plasmids. For the efficacy study in the Nrl-GFP model, spacer 4.76 (UGUGGUCGGGGUAGCGGCUG; SEQ ID NO: 9341) targeting GFP was cloned into AAV-cis plasmid p59.RP1.491.174 using the standard cloning methods.
TABLE-US-00031 TABLE 27 Rhodopsin promoter sequences PR SEQ Promoter construct ID NO: RHO RP1 3714 RHO535-CAG RP2 3715 RHO-intron RP3 3716 GRK1 RP4 3717 GRK1-SV40 RP5 3718 GRK1-CAG RP6 3719
[0607] AAV vector production and titering were performed as described in Example 1.
[0608] The AAV vector AAV.RP1.491.174.4.76 was produced at the University of North Carolina (UNC) Vector Core using the triple transfection methods in HEK239T.
Subretinal Injections:
[0609] C57BL/6J mice and heterozygous Nrl-GFP/C57BL/5J mice (Jackson Laboratories) were maintained in a normal 12-hour light/dark cycle. Subretinal injections were performed on 4-5 week-old mice. Mice were anesthetized with isoflurane inhalation. Proparacaine (0.5%) was applied topically on the cornea and the eyes were dilated with drops of tropicamide (1%) and phenylephrine (2.5%). Eyes were kept lubricated with Genteal gel during the surgery. Under a surgical microscope, an ultrafine 30-gauge disposable needle was passed through the sclera, at the equator and next to the limbus, to create a small hole into the vitreous cavity. Using a blunt-end needle, 1-1.5 L of virus was injected directly into the subretinal space, between the RPE and retinal layer. Each mouse from the experimental groups was injected in one eye with 1.0e+9, 5.0e+9 or 1.0e+10 genome (vg)/eye, and the contralateral eye injected with the AAV formulation buffer.
Western Blot:
[0610] To generate protein lysates, eyes were freshly enucleated and dissected in ice-cold PBS, snap-frozen in dry ice, and resuspended in RIPA buffer (150 mM NaCl, 1% NP40, 0.5% deoxycholate, 0.1% SDS, 50 mM Tris pH8.0, dH20) freshly supplemented with protease inhibitors (5 mg/mL final concentration), DTT and PMSF (final concentration 1 mM respectively) in individual 1.5 mL Eppendorf tube per retina. Retinal tissue was further homogenized in small pieces using an RNA-free disposable pellet pestles (Fisher scientific, #12-141-364) and incubated on ice for 30 minutes, flipping the tube occasionally to gently mix. Samples were then centrifuged at 4 C. at full speed for 20 minutes to pellet genomic DNA. Protein extracts and gDNA cell pellets were then separated. For protein extracts, supernatants were collected. Protein concentrations were determined by BCA assay and read on Tecan plate reader. 15 g of total protein lysate of mouse retina were separated by SDS-PAGE (Bio-Rad TGX gels) and transferred to polyvinylidene difluoride membranes using the Transblot Turbo. The membranes were blocked with 5% nonfat dry milk for 1 hour at room temperature and incubated overnight at 4 C. with the primary antibody. Then, blots were washed with Tris-buffered saline with the Tween-20 (137 mM sodium chloride, 20 mM Tris, 0.1% Tween-20, pH 7.6) for three times and incubated with the horseradish peroxidase-conjugated anti-rabbit or anti-mouse secondary antibody for 1 hour at room temperature. After washing three times, the membranes were developed using Chemiluminescent substrate ECL and imaged on the ChemicDoc. Blot images were processed with ImageLab.
Tissue Processing and NGS Analysis:
[0611] Animals were sacrificed and the eyes enucleated in fresh PBS. Whole retinae were isolated from the eye cups and processed for gDNA extraction as described previously in western blot section. Genomic gDNA pellets were processed with the DNeasy Blood & Tissue Kit (Qiagen) according to the manufacturer's instructions. Amplicons were amplified from 200 ng of gDNA with a set of primers targeting the genomic region of interest. Amplicons were bead-purified (Beckman coulter, Agencourt Ampure XP) and then re-amplified to incorporate Illumina adapter sequence. Specifically, these primers contained an additional sequence at the 5 ends to introduce Illumina read and 2 sequences as well as a 16 nt random sequence that functions as a unique molecular identifier (UMI). Quality and quantification of the amplicon was assessed using a Fragment Analyzer DNA analyzer kit (Agilent, dsDNA 35-1500 bp). Amplicons were sequenced on the Illumina Miseq according to the manufacturer's instructions. Raw fastq files from sequencing were processed as follows: (1) the sequences were trimmed for quality and for adapter sequences using the program cutadapt (v. 2.1); (2) the sequences from read 1 and read 2 were merged into a single insert sequence using the program flash2 (v2.2.00); and (3) the consensus insert sequences were run through the program CRISPResso2 (v 2.0.29), along with the expected amplicon sequence and the spacer sequence. This program quantifies the percent of reads that were modified in a window around the 3 end of the spacer (30 bp window centered at 3 bp from 3 end of spacer). The activity of the CasX molecule was quantified as the total percent of reads that contain insertions, substitutions and/or deletions anywhere within this window.
Immunohistology:
[0612] Enucleated eyes were placed in 10% formalin overnight at 4 C. Retinae were dissected out from the eye cups, rinsed in PBS thoroughly and immersed in 15%-30% sucrose gradient. Tissues were embedded in optimal cutting temperature (OCT), frozen on dry ice before being transferred to 80C storage. 20 M sections were cut using a cryostat. The sections were blocked for 1 hour at room temperature in the blocking buffer (2% normal goat serum, 1% BSA, 0.1% Triton-X 100) before antibody labeling. The antibodies used were: anti-mouse HA (Abcam, 1:500); Alexa Fluor 488 rabbit anti-mouse (Invitrogen, 1:2000). Slides were counterstained with Hoechst 33342 (Thermo Fisher Scientific, Hemel Hempstead, UK) and mounted with Prolong Diamond antifade mounting medium (Thermo Fisher Scientific, Hemel Hempstead, UK). Confocal fluorescence imaging was subsequently performed using the LSM-710 inverted confocal microscope system (Carl Zeiss, Cambridge, UK).
Results
[0613] Editing levels were quantified at the mRHO exon locus in 3 week-old C57BL/6J that were injected sub-retinally with AAV vectors expressing CasX 491 under the control of multiple engineered retinal and ubiquitous promoters to identify promoters driving strong levels of editing in the photoreceptors, with spacer 11.30. Rod-specific RP1, RP2, RP3, RP4 promoters mediated very similar levels of editing (20%). Vectors AAV.RP5.491.174.11.30 and AAV RP5.491.WPRE.174.11.30 led to lower expression levels (10 and 8% respectively,
[0614] Editing levels were confirmed by structural and proteomic analysis. Western blot analysis of 12-week post-injection retinal lysates showed strong correlation between levels of editing and reduction in GFP protein (
[0615] These results were also confirmed by in vivo fundus imaging of GFP fluorescence. The ratio of superior to inferior retina mean grey values showed a reduction in 20% and 50% GFP fluorescence by week 12 (
[0616] Immunochemistry staining confirmed (
[0617] The results demonstrate proof-of-concept that CasX with a gRNA targeting the mouse P23 RHO locus can achieve therapeutically-relevant levels of editing at the mouse P23 locus when only expressed in rod-photoreceptors, the therapeutic cell target, via AAV-mediated subretinal delivery. Furthermore, the specificity and efficacy of the vector were demonstrated by conducting a follow-up study targeting a GFP locus integrated in a reporter model overexpressing GFP in photoreceptors in which the results show a strong correlation between editing levels and protein knock-down assessed by western blot, fundus imaging and histology.
Example 17: Demonstration that the CasX:gNA System can Edit Human Neural Progenitor Cells and Induced Neurons Efficiently when Packaged and Delivered Via AAVs
[0618] Experiments were performed to demonstrate the efficiency of AAV-expressed CasX:gNA system in editing human neural progenitor cells (hNPCs) and induced neurons (iNs) in vitro.
Materials and Methods
AAV Construct Cloning:
[0619] CasX variant 491 and guide scaffold variant 235 were used in these experiments.
[0620] To evaluate the editing capability of AAV-expressed CasX:gNA system in hNPCs, AAV constructs containing a UbC promoter driving CasX expression and a Pol III promoter scaffold driving the expression of a gRNA with scaffold variant 235 and spacer 7.37 (GGCCGAGAUGUCUCGCUCCG; SEQ ID NO: 4059; incorporated in construct ID 183), which targeted the endogenous B2M locus, were generated using standard molecular cloning techniques. Cloned and sequence-validated constructs were maxi-prepped and subjected to quality assessment prior to transfection for AAV production.
[0621] For experiments assessing the editing capability of AAV-expressed CasX:gNA system in human iNs, AAV constructs encoding for CasX protein and gRNA with AAVS1-targeting spacer 31.12 (UUCUCGGCGCUGCACCACGU; SEQ ID NO: 4060; incorporated in construct ID 188), 31.63 (CAAGAGGAGAAGCAGUUUGG; SEQ ID NO: 4061; incorporated in construct ID 189), or 31.82 (GGGGCCUGUGCCAUCUCUCG; SEQ ID NO: 4062; construct ID 190), were similarly generated as described. The non-targeting spacer 0.1 (AGGGGUCUUCGAGAAGACCC; SEQ ID NO: 4063) was also used in these experiments. For experiments assessing various protein promoters driving the expression of CasX 491 with gRNA spacer 7.37 to edit the B2M locus in human iNs, AAV constructs containing these protein promoter variants were similarly generated as described (see Table 28 for sequences of protein promoter variants). The sequences of the additional components of the AAV constructs, except for sequences encoding the CasX protein (Table 26), are listed in Table 45.
TABLE-US-00032 TABLE 28 Sequences of protein promoter variants, construct IDs of AAV constructs that comprise each respective protein promoter variant, and SEQ ID NOs for the sequences of each protein promoter variant. Promoter Construct SEQ Length of variant ID ID NO: Promoter (bp) UbC 183 3720 400 Jet 191 3721 164 U1a 177 3722 252 MeP426 192 3723 229 miniCMV 193 3724 38 SFCp 194 3725 354 miniSV40 195 3726 197 pJB42CAT5 196 3727 178 MLP 197 3728 41 CMV core 198 3729 204 EFS ND 3730 234 miniEF1 ND 3731 212 hRPL30 ND 3732 325 hRPS18 ND 3733 243 hRPL13a ND 3734 223 *ND = no description.
AAV Production:
[0622] Suspension-adapted HEK293T cells, maintained in FreeStyle 293 media, were seeded in 20-30 mL of media at 1.5E6 cells/mL on the day of transfection. Endotoxin-free pAAV plasmids with the transgene flanked by ITR repeats were co-transfected with plasmids supplying the adenoviral helper genes for replication and encoding AAV rep/cap proteins using PEI MAX (Polysciences) in serum-free Opti-MEM media. Three days later, cultures were centrifuged to separate the supernatant from the cell pellet, and the AAV particles were collected, concentrated, and filtered following standard procedures.
[0623] To determine the viral genome (vg) titer, 1 L from crude lysate viruses was digested with DNase and proteinase K, followed by quantitative PCR. 5 L of digested virus was used in a 25 L qPCR reaction composed of IDT primetime master mix and a set of primer and 6FAM/Zen/IBFQ probe (IDT) designed to amplify a 62 bp-fragment located in the AAV2-ITR. An AAV ITR plasmid was used as reference standards to calculate the titer (vg/mL) of viral samples.
Culturing hNPCs In Vitro:
[0624] Immortalized hNPCs were cultured in hNPC medium (DMEM/F12 with GlutaMax, 10 mM HEPES, 1NEAA, 1B-27 without vitamin A, 1N2 supplemented growth factors hFGF and EGF, Pen/Strep, and 2-mercaptoethanol). Prior to testing, cells were lifted with TrypLE, gently resuspended to dissociate neurospheres, quenched with media, spun down, and resuspended in fresh media. Cells were counted and directly seeded at a density of 10,000 cells per well on a 96-well plate coated with PLF (poly-DL-omithine hydrobromide, laminin, and fibronectin) 24 hours prior to AAV transduction.
AAV Transduction of hNPCs, Followed by HLA Immunostaining and Flow Cytometry:
[0625] 7,000 cells/well of hNPCs were seeded on PLF-coated 96-well plates. 24 hours later, seeded cells were treated with AAVs expressing the CasX:gRNA system. All viral infection conditions were performed at least in duplicate, with normalized number of viral genomes (vg) among experimental vectors, in a series of three-fold serial dilution of MOI ranging from 1E4 to 1E6 vg/cell. Five days post-transduction, AAV-treated hNPCs were lifted with TrypLE. After cell dissociation, staining buffer (3% fetal bovine serum in dPBS) was used for quenching. The dissociated cells were transferred to a round-bottom 96-well plate, followed by centrifugation and resuspension of cell pellets with staining buffer. After another centrifugation, cell pellets were resuspended in staining buffer containing the antibody (BioLegend) that would detect the B2M-dependent HLA protein expressed on the cell surface. After HLA immunostaining, cells were stained with DAPI to label cell nuclei. HLA+hNPCs were measured using the Attune NxT flow cytometer. Decreased or lack of HLA protein expression would indicate successful editing at the B2M locus in these hNPCs. A subset of transduced hNPCs were also lifted for genomic DNA extraction and editing analysis via next-generation sequencing (NGS).
NGS Processing and Analysis:
[0626] Genomic DNA (gDNA) from harvested cells were extracted using the Zymo Quick-DNA Miniprep Plus kit following the manufacturer's instructions. Target amplicons were formed by amplifying regions of interest from 200 ng of extracted gDNA with a set of primers specific to the target locus, such as the human B2M locus. These gene-specific primers contain an additional sequence at the 5 end to introduce an Illumina adapter and a 16-nucleotide unique molecule identifier. Amplified DNA products were purified with the Ampure XP DNA cleanup kit. Quality and quantification of the amplicon were assessed using a Fragment Analyzer DNA Analysis kit (Agilent, dsDNA 35-1500 bp). Amplicons were sequenced on the Illumina Miseq according to the manufacturer's instructions. Raw fastq files from sequencing were quality-controlled and processed using cutadapt v2.1, flash2 v2.2.00, and CRISPResso2 v2.0.29. Each sequence was quantified for containing an insertion or deletion (indel) relative to the reference sequence, in a window around the 3 end of the spacer (30 bp window centered at 3 bp from 3 end of spacer). CasX activity was quantified as the total percent of reads that contain insertions, substitutions, and/or deletions anywhere within this window for each sample.
Reprogramming of Induced Pluripotent Stem Cells (iPSCs):
[0627] Fibroblast cells from a patient were obtained from the Coriell Cell Repository. iPSCs were generated from these lines by episomal reprogramming and genetically engineered to ectopically express Neurogenin 2 (Neurog2) to accelerate neuronal differentiation. Three iPSC clones were selected for downstream experiments.
Neuronal Cell Culture:
[0628] All neuronal cell culture was performed using N2B27-based media. To induce neuronal differentiation, iPSCs were plated in neuronal plating media (N2B27 base media with 1 g/mL doxycycline, 200 M L-ascorbic acid, 1 M dibutyryl cAMP sodium salt, 10 M CultureOne, 100 ng/ml of BDNF, 100 ng/ml of GDNF). iNs were dissociated, aliquoted, and frozen for long term storage after three days of differentiation (DIV3). DIV3 iNs were thawed and seeded on a 96-well plate at 30,000 cells per well. iNs were cultured for one week in plating media and thereafter, half-media changes were performed once every week using feeding media (N2B27 base media with 200 M L-ascorbic acid, 1 M dibutyryl cAMP sodium salt, 200 ng/ml of BDNF, 200 ng/ml of GDNF).
AAV Transduction of iNs In Vitro:
[0629] 24 hours prior to transduction, -30,000-50,000 iNs per well were seeded on Matrigel-coated 96-well plates. AAVs expressing the CasX:gRNA system were then diluted in neuronal plating media and added to cells, with six wells per condition used as replicates. Cells were transduced at various MOIs (1E4 or 1E5 vg/cell for
Results
[0630]
[0631]
[0632] The results of these experiments demonstrate that CasX variant 491 and guide scaffold 235 with spacer targeting either the human B2M locus or the human AAVS1 locus can edit on-target efficiently when packaged and delivered in vitro via AAVs into human NPCs or iNs.
Example 18: CpG-Depleted AAVs Demonstrate CasX-Mediated Editing In Vitro
[0633] Pathogen-associated molecular patterns (PAMPs) such as unmethylated CpG motifs are small molecular motifs conserved within a class of microbes. They are recognized by toll-like receptors (TLRs) and other pattern recognition receptors in eukaryotes and often induce a non-specific immune activation. In the context of gene therapy, therapeutics containing PAMPs are often not as well-tolerated and are rapidly cleared from the patient given the strong immune response triggered, which ultimately leads to reduced therapeutic efficiency. As a result, there is an unmet need for well-tolerated gene therapy vectors that are not cleared rapidly to achieve the necessary therapeutic benefit.
[0634] CpG motifs are short single-stranded DNA sequences containing the dinucleotide CG. When these CpG motifs are unmethylated, they act as PAMPs and therefore potently stimulate the immune response. In this example, experiments were performed to deplete CpG motifs in the AAV construct encoding CasX variant 491, guide scaffold variant 235, and spacer 7.37 targeting the endogenous B2M(beta-2-microglobulin) locus to demonstrate that CpG-depleted AAV vectors can edit effectively in vitro. The editing activity induced from use of the individual elements of the AAV genome and their respective CpG-reduced versions, as well as combinations of these elements, was assessed in vitro. In vitro assessment of immunogenicity is presented in Example 19.
Materials and Methods
Design of CpG-Depleted AAV Components:
[0635] Nucleotide substitutions to replace native CpG motifs in AAV components were designed in silico. For exemplary regulatory elements, nucleotide substitutions to replace native CpG motifs were designed based on homologous nucleotide sequences from related species to produce CpG-reduced variants for the following elements: the murine U1a snRNA (small nuclear RNA) gene promoter, the human UbC (polyubiquitin C) gene promoter, and the human U6 promoter. See Table 29, which provides parental sequences of a murine U1a promoter, a human UbC promoter, and a human U6 promoter prior to CpG reduction and Table 30, which provides sequences of CpG-reduced variants of the promoters listed in Table 29. Similar modifications were made to produce a CpG-reduced variant of a bGHpA (bovine growth hormone polyadenylation) sequence. See Table 31, which provides a parental sequence of a bGHpA prior to CpG reduction and Table 32, which provides a sequence of a CpG-reduced variant of the bGHpA listed in Table 31.
[0636] AAV2 ITRs were CpG-depleted as previously described (Pan X, Yue Y, Boftsi M. et al., 2021, Rational engineering of a functional CpG-free ITR for AAV gene therapy. Gene Ther.) See Table 33, which provides parental ITR sequences prior to CpG reduction and Table 34, which provides sequences of CpG-reduced variants of the ITRs listed in Table 33.
[0637] Nucleotide substitutions to replace native CpG motifs in exemplary Cas protein variants (CasX variants) were rationally designed with codon optimization, so that the amino acid sequence of the CpG-reduced Cas-encoding sequence would be the same as the amino acid sequence of the corresponding native Cas-encoding sequence. See Table 35, which provides parental Cas sequences prior to CpG reduction and Table 36, which provides sequences of CpG-reduced variants of the Cas proteins listed in Table 35. Furthermore, nucleotide substitutions to replace native CpG motifs within the base gRNA scaffold variants (gRNA scaffold 235 and 316) were rationally designed with the intent to preserve editing activity. The rational design process for the CpG reduction of the gRNA sequences is further described herein below. See Table 37, which provides parental gRNA sequences prior to CpG reduction and Table 38, which provides sequences of CpG-reduced variants of the gRNAs listed in Table 37.
[0638] All resulting sequences were ordered from a third-party commercial source as synthesized gene fragments with the appropriate overhangs for cloning and isothermal assembly to replace individually the corresponding elements of the existing base AAV plasmid (construct ID 183). Spacer 7.37 (GGCCGAGAUGUCUCGCUCCG; SEQ ID NO: 4059), which targets the endogenous B2M gene, was used for the relevant experiments discussed in this example. The resulting AAV constructs were generated using standard molecular cloning techniques. Cloned and sequence-validated plasmid constructs were midi-prepped for subsequent nucleofection and AAV vector production.
TABLE-US-00033 TABLE 29 Parental sequences of promoters SEQ Parental element ID NO Parental UbC promoter (human) 3533 Parental U1A promoter (murine) 3722 Parental U6 promoter (human) 3563
TABLE-US-00034 TABLE 30 Sequences of CpG-reduced or depleted promoters AAV SEQ CpG-reduced or depleted element construct ID ID NO CpG-reduced UbC promoter (human) 184 3735 Strongly CpG-reduced UbC promoter 185 3736 (human) CpG-depleted UbC promoter (human) 186 3737 CpG-reduced U1a promoter (murine) 178, 206 3738 CpG-depleted U1a promoter (murine) 179, 205 3739 CpG-reduced U6 promoter (human) 180 3740 CpG-depleted U6 promoter (human) 181, 205, 206 3741 CpG-reduced hU6 Isoform 2 3742 CpG-depleted hU6 Isoform 2 4743 CpG-depleted hU6 Isoform 3 3744 CpG-depleted hU6 Isoform 4 3745 CpG-depleted hU6 Isoform 5 3746
TABLE-US-00035 TABLE 31 Parental sequence for Poly(A) signal sequence Parental element SEQ ID NO Parental bGH-polyA 3401 sequence (bovine)
TABLE-US-00036 TABLE 32 Sequences of CpG-reduced Poly(A) signal sequence CpG-reduced or depleted element AAV construct ID SEQ ID NO CpG-depleted bGH-polyA sequence 182, 205, 206 3748 (bovine)
TABLE-US-00037 TABLE 33 Sequences of parental AAV ITR sequences Parental element SEQ ID NO 5ITR 17 3ITR 3701
TABLE-US-00038 TABLE 34 Sequences of CpG-reduced or depleted AAV ITR sequences CpG-reduced or depleted element SEQ ID NO CpG-depleted 5ITR 3749 CpG-depleted 3ITR 3750
TABLE-US-00039 TABLE 35 Parental sequences of CasX proteins Parental element SEQ ID NO: CasX 491 9320 CasX 515 9321 CasX 676 9322 CasX 593 9323 CasX 812 9324 CasX 668 9325 CasX 672 9326
TABLE-US-00040 TABLE 36 CpG- depleted sequences of CasX proteins CpG- depleted element AAV construct ID: SEQ ID NO: CpG-depleted CasX 491 205, 206 9327 CpG-depleted CasX 515 9328 CpG-depleted CasX 593 9329 CpG-depleted CasX 812 9330 CpG-depleted CasX 668 9331 CpG-depleted CasX 676 9332 CpG-depleted CasX 672 9333
TABLE-US-00041 TABLE 37 Parental sequences of gRNA scaffolds Parental element SEQ ID NO: Scaffold 235 9334 Scaffold 316 9335
TABLE-US-00042 TABLE 38 Sequences of CpG-reduced or depleted gRNA scaffolds Scaffold ID: Derived from parent scaffold: SEQ ID NO: Scaffold 320 Scaffold 235 3751 Scaffold 321 Scaffold 235 3752 Scaffold 322 Scaffold 235 3753 Scaffold 323 Scaffold 316 3754 Scaffold 324 Scaffold 235 3755 Scaffold 325 Scaffold 235 3756 Scaffold 326 Scaffold 316 3757 Scaffold 327 Scaffold 235 3758 Scaffold 328 Scaffold 235 3559 Scaffold 329 Scaffold 316 3760 Scaffold 330 Scaffold 235 3761 Scaffold 331 Scaffold 235 3762 Scaffold 332 Scaffold 316 3763 Scaffold 333 Scaffold 235 3764 Scaffold 334 Scaffold 235 3765 Scaffold 335 Scaffold 316 3766 Scaffold 336 Scaffold 235 3767 Scaffold 337 Scaffold 235 3768 Scaffold 338 Scaffold 316 3769 Scaffold 339 Scaffold 235 3770 Scaffold 340 Scaffold 235 3771 Scaffold 341 Scaffold 316 3772
Design of CpG-Depleted Guide Scaffolds:
[0639] Nucleotide substitutions were rationally-designed to replace native CpG motifs within the base gRNA scaffold variant (gRNA scaffold 235) with the intent to preserve editing activity while reducing scaffold immunogenicity. CpG-motifs were removed from the scaffold coding sequence to reduce immunogenicity. Scaffold 235 contains a total of eight CpG elements; six of which are predicted to basepair and form complementary strands of a double-stranded secondary structure (
[0640] In the pseudoknot stem (region 1), the CpG pair was flipped to a GpC to minimize the alteration of the base composition and sequence. Based on previous experiments involving replacing individual base pairs, it was anticipated that this mutation was not likely to be detrimental to the structure and function of the guide RNA scaffold.
[0641] Similarly, in the scaffold stem (region 2) the CpG pair was flipped to a GpC to minimize the alteration of the base composition and sequence. It was anticipated that this mutation was likely to be detrimental to the structure and function of the guide RNA scaffold because strong sequence conservation was seen in this region in previous experiments mutating individual bases or base pairs. This strong sequence conservation is likely due to the scaffold stem loop being important in interacting with the CasX protein as well as in the formation of a triplex structural element with the pseudoknot region.
[0642] In the extended stem bubble (region 3) the single CpG was removed by one of three strategies. First, the bubble was deleted by mutating CG->C (removing the guanine from the CpG dinucleotide). Second, the bubble was resolved to restore ideal basepairing by mutating CG->CT (substituting thymine for guanine in the CpG dinucleotide). Third, the entire extended stem loop was replaced with the extended stem loop of scaffold 174. Note that, by itself, the replacement of the extended stem loop with that of scaffold 174 recapitulates scaffold 316, which has previously been shown to edit efficiently. There are no CpG motifs in the extended stem loop of scaffold 174. Therefore, replacing the extended stem loop with that of scaffold 174 also removes the CpG motif in the extended stem (region 4). Based on previous experiments showing the relative robustness of the extended stem to small changes, it was anticipated that mutating the extended stem bubble was moderately likely to be detrimental to the structure and function of the guide RNA scaffold.
[0643] In the extended stem (region 4), the CpG pair could not be flipped to GpC without generating additional CpG motifs. Therefore, the CpGs were changed to a GG and a complementary CC motif Similar to region 3, based on the relative robustness of the extended stem to small changes, it was anticipated that this mutation was not likely to be detrimental to the structure and function of the guide RNA scaffold.
[0644] Finally, the extended stem loop (region 5) was mutated in one of three ways that were designed based on previous experiments examining the stability of the stem loop. In particular, several variations of the stem loop had previously been shown to have similar stability levels, and some of these variations of the stem loop do not contain CpGs. Based on these findings, first, the loop was replaced with a new loop with a CUUG sequence. Second, the loop was replaced with a new loop with a GAAA sequence. Since the GAAA loop replacement would generate a novel CpG adjacent to the loop, it was combined with a C->G base swap and the corresponding G->C base swap on the complementary strand, ultimately resulting in a CUUCGG->GGAAAC exchange. Third, the loop was mutated by the insertion of an A to interrupt the CpG motif and thereby increase the size of the loop from 4 to 5 bases. It was anticipated that randomly mutating the extended stem loop would likely have detrimental effects on secondary structure stability and hence on editing. However, relying on previously confirmed sequences was believed to have a lower risk associated with a replacement.
[0645] To generate guide RNA scaffolds encoded by DNA with reduced CpG levels, the mutations described above were combined in various configurations. Table 39, below, summarizes combinations of the mutations that were used. In Table 39, a 0 indicates that no mutation was introduced to a given region, a 1, 2, or 3 indicates that a mutation was introduced in that region, as diagrammed in
TABLE-US-00043 TABLE 39 Summary of mutations for CpG-reduction and depletion in guide scaffold 235 Region 3 Region 1 Region 2 (Extended Region 4 Region 5 Scaffold (Pseudoknot (Scaffold stem (Extended (Extended ID stem) stem) bubble) stem) stem loop) 320 1 0 0 1 0 321 1 0 1 1 0 322 1 0 2 1 0 323 1 0 3 n/a 0 324 1 0 1 1 1 325 1 0 2 1 1 326 1 0 3 n/a 1 327 1 0 1 1 2 328 1 0 2 1 2 329 1 0 3 n/a 2 330 1 0 1 1 3 331 1 0 2 1 3 332 1 0 3 n/a 3 334 1 1 2 1 1 335 1 1 3 n/a 1 336 1 1 1 1 2 337 1 1 2 1 2 338 1 1 3 n/a 2 339 1 1 1 1 3 340 1 1 2 1 3 341 1 1 3 n/a 3 235 0 0 0 0 0
Generation of CpG-Depleted AAV Plasmids to Assess CpG-Reduced or Depleted gRNA Scaffolds:
[0646] The CpG-reduced or depleted gRNA scaffolds were tested in the context of AAV vectors that were otherwise CpG-depleted, with the exception of the AAV2 ITRs. Specifically, nucleotide substitutions to replace native CpG motifs in AAV components were designed in silico based on homologous nucleotide sequences from related species for the following elements: the murine U1a snRNA (small nuclear RNA) gene promoter, the bGHpA (bovine growth hormone polyadenylation) sequence, and the human U6 promoter. The coding sequence for CasX 491 was optimized for CpG depletion. All resulting sequences (Tables 38 and 40) were ordered as gene fragments with the appropriate overhangs for cloning and isothermal assembly to replace individually the corresponding elements of the existing base AAV plasmid (construct ID 183). Spacer 7.37 (GGCCGAGAUGUCUCGCUCCG; SEQ ID NO: 4059), which targets the endogenous B2M gene, was used for the experiments discussed in this example. The first time that the experiment was performed (N=1), a sample with the non-targeting spacer 0.0 was also included as a control (CGAGACGUAAUUACGUCUCG; SEQ ID NO: 9342).
[0647] The resulting AAV constructs were generated using standard molecular cloning techniques. Cloned and sequence-validated plasmid constructs were midi-prepped for subsequent nucleofection and AAV vector production. The sequences of the additional components of AAV constructs, with the exception of sequences encoding the gRNAs (Table 38), are listed in Table 40.
TABLE-US-00044 TABLE 40 Sequences of AAV elements (5-3 in AAV construct) Element SEQ ID NO: AAV2 5 ITR 17 CpG-depleted U1a promoter 3739 CpG-depleted cMycNLS-CasX491-cMycNLS 3747 CpG-depleted bGH-polyA sequence 3748 CpG-depleted U6 promoter 3741 AAV2 3 ITR 3701
AAV Production
[0648] Suspension-adapted HEK293T cells, maintained in FreeStyle 293 media, were seeded in 20-30 mL of media at 1.5E6 cells/mL on the day of transfection. Endotoxin-free pAAV plasmids with the transgene flanked by ITR repeats were co-transfected with plasmids supplying the adenoviral helper genes for replication and encoding AAV rep/cap proteins using PEI MAX (Polysciences) in serum-free Opti-MEM media. Three days later, cultures were centrifuged to separate the supernatant from the cell pellet, and the AAV particles were collected, concentrated, and filtered following standard procedures.
[0649] To determine the viral genome (vg) titer, 1 L from crude lysate viruses was digested with DNase and proteinase K, followed by quantitative PCR. 5 L of digested virus was used in a 25 L qPCR reaction composed of IDT primetime master mix and a set of primer and 6FAM/Zen/IBFQ probe (IDT) designed to amplify a 62 bp-fragment located in the AAV2-ITR. An AAV ITR plasmid was used as reference standards to calculate the titer (vg/mL) of viral samples.
Culturing Human Neural Progenitor Cells (hNPCs) In Vitro:
[0650] Immortalized hNPCs were cultured in hNPC medium (DMEM/F12 with GlutaMax, 10 mM HEPES, 1NEAA, 1B-27 without vitamin A, 1N2 supplemented growth factors hFGF and EGF, Pen/Strep, and 2-mercaptoethanol). Prior to testing, cells were lifted with TrypLE, gently resuspended to dissociate neurospheres, quenched with media, spun down, and resuspended in fresh media. Cells were counted and directly used for nucleofection or are seeded at a density of 10,000 cells per well on a 96-well plate coated with PLF (poly-DL-ornithine hydrobromide, laminin, and fibronectin) 48 hours prior to AAV transduction.
Plasmid Nucleofection into Human Neural Progenitor Cells (hNPCs):
[0651] AAV plasmids encoding the CasX:gRNA system, with or without CpG depletion of the individual elements of the AAV genome, were nucleofected into hNPCs using the Lonza P3 Primary Cell 96-well Nucleofector Kit. Plasmids were diluted into two concentrations: 50 ng/L and 25 ng/L. 5 L of DNA was mixed with 20 L of 200,000 hNPCs in the Lonza P3 solution supplemented with 18% V/V P3 supplement. The combined solution was nucleofected using the Lonza 4D Nucleofector System following program EH-100. The nucleofected solution was subsequently quenched with the appropriate culture media and then divided into three wells of a 96-well plate coated with PLF. Seven days post-nucleofection, hNPCs were lifted for B2M protein expression analysis via HLA immunostaining followed by flow cytometry. Subsequently, stacking of individual CpG-depleted elements to create a combined AAV genome with substantial CpG depletion was performed and similarly tested for editing assessment at the B2M locus in vitro.
Editing Activity Assessment by HLA Immunostaining and Flow Cytometry:
[0652] Seven days after nucleofection, AAV-treated hNPCs were lifted with TrypLE. After cell dissociation, staining buffer (3% fetal bovine serum in dPBS) was used for quenching. The dissociated cells were transferred to a round-bottom 96-well plate, followed by centrifugation and resuspension of cell pellets with staining buffer. After another centrifugation, cell pellets were resuspended in staining buffer containing the antibody (BioLegend) that would detect the B2M-dependent HLA protein expressed on the cell surface. After HLA immunostaining, cells were stained with DAPI to label cell nuclei. HLA+hNPCs were measured using the Attune NxT flow cytometer.
Reprogramming of Induced Pluripotent Stem Cells (iPSCs):
[0653] Fibroblast cells from a patient were obtained from the Coriell Cell Repository. iPSCs were generated from these lines by episomal reprogramming and genetically engineered to ectopically express Neurogenin 2 (Neurog2) to accelerate neuronal differentiation. Three iPSC clones were selected for downstream experiments.
Neuronal Cell Culture:
[0654] All neuronal cell culture was performed using N2B27-based media. To induce neuronal differentiation, iPSCs were plated in neuronal plating media (N2B27 base media with 1 g/mL doxycycline, 200 M L-ascorbic acid, 1 M dibutyryl cAMP sodium salt, 10 M CultureOne, 100 ng/ml of BDNF, 100 ng/ml of GDNF). iNs (induced neurons) were dissociated, aliquoted, and frozen for long term storage after three days of differentiation (DIV3). DIV3 iNs were thawed and seeded on a 96-well plate at 30,000-50,000 cells per well. iNs were cultured for one week in plating media and thereafter, half-media changes were performed once every week using feeding media (N2B27 base media with 200 M L-ascorbic acid, 1 M dibutyryl cAMP sodium salt, 200 ng/ml of BDNF, 200 ng/ml of GDNF).
AAV Transduction of iNs in Vitro:
[0655] 24 hours prior to transduction, 30,000-50,000 iNs per well were seeded on Matrigel-coated 96-well plates. AAVs expressing the CasX:gRNA system, with or without CpG depletion of the individual elements of the AAV genome, were then diluted in neuronal plating media and added to cells. Cells were transduced at two MOIs (1E3 or 3E3vg/cell). Seven days post-transduction, iNs were replenished using feeding media. Seven days post-transduction, cells were lifted using lysis buffer, 4-well replicates were pooled per experimental condition, and genomic DNA (gDNA) was harvested and prepared for editing analysis at the B2M locus using next generation sequencing (NGS). Subsequently, combining individual CpG-reduced or CpG-depleted elements to create a combined AAV genome with substantial CpG depletion was performed and similarly tested for editing assessment at the B2M locus in vitro. Experiments assessing the effects of incorporating CpG-depleted gRNA scaffold constructs on editing at the B2M locus in vitro are also conducted.
[0656] In a separate experiment, CpG-depleted guide scaffolds were assessed. Here, iNs were transduced with AAVs expressing the CasX:gRNA system with various versions of the guide scaffold. The first time that the experiment was performed (N=1), cells were transduced at an MOI of 4e3 vg/cell (see
NGS Processing and Analysis:
[0657] Genomic DNA (gDNA) from harvested cells was extracted using the Zymo Quick-DNA Miniprep Plus kit following the manufacturer's instructions. Target amplicons were formed by amplifying regions of interest from 200 ng of extracted gDNA with a set of primers specific to the target locus, such as the human B2M gene. These gene-specific primers contained an additional sequence at the 5 end to introduce an Illumina adapter and a 16-nucleotide unique molecule identifier. Amplified DNA products were purified with the Ampure XP DNA cleanup kit. Quality and quantification of the amplicon were assessed using a Fragment Analyzer DNA Analysis kit (Agilent, dsDNA 35-1500 bp). Amplicons were sequenced on the Illumina Miseq according to the manufacturer's instructions. Raw fastq files from sequencing were quality-controlled and processed using cutadapt v2.1, flash2 v2.2.00, and CRISPResso2 v2.0.29. Each sequence was quantified for containing an insertion or deletion (indel) relative to the reference sequence, in a window around the 3 end of the spacer (30 bp window centered at 3 bp from 3 end of spacer). CasX activity was quantified as the total percent of reads that contain insertions, substitutions, and/or deletions anywhere within this window for each sample.
Results
Assessment of Use of CpG-Depleted AAV Vector Elements on Editing in a Cell-Based Assay:
[0658] The findings of an assay assessing the editing activity at the B2M locus in hNPCs nucleofected with CpG-containing (CpG.sup.+) or CpG-reduced/depleted (CpG.sup.) AAV vectors are illustrated in
[0659] The results presented in bar plot in
[0660] In addition to evaluating the effects of depleting CpGs in different protein promoters (e.g., U1a compared to UbC) on editing mediated by the CasX:gRNA system delivered by AAVs, the effects of depleting CpGs in other elements on editing were analyzed at two MOIs (
[0661]
[0662] Several key conclusions were determined from these results, illustrated in
[0663] Additionally, results from experiments aimed to assess the effects of incorporating CpG-depleted gRNA scaffold constructs into a combined AAV genome with substantial CpG depletion on editing at the B2M locus may reveal that varying levels of editing potency can be achieved when delivered and packaged via AAVs.
[0664] These experiments demonstrated that using AAV elements with different levels of CpG depletion can result in varying levels of editing mediated by the CasX:gRNA system when packaged and delivered in vitro via AAVs. The data also demonstrated that depleting CpGs in certain elements could result in similar levels of editing as that achieved when using their WT counterparts. Incorporating CpG-reduced or CpG-depleted elements further expands the inventory of diverse sequences that could be used to build an AAV genome, potentially reducing the risk of recombination during AAV packaging and production.
Assessment of Use of CpG-Depleted Guide Scaffolds on Editing in a Cell-Based Assay:
[0665] Mutations were introduced into the guide scaffold 235 to reduce the CpG content of the DNA sequence coding the guide scaffold. Surprisingly, compared to scaffold 235, all CpG-reduced and CpG-depleted scaffold variants produced higher levels of editing in induced neurons. This was the case with two independent repeats of the experiment (with the results from the first repeat of the experiment shown in
[0666] Notably, scaffold 320 showed a significant increase in potency over scaffold 235. Scaffold 320 includes mutations to only two regions of the scaffold: in the pseudoknot stem and the extended stem (regions 1 and 4). Further, some combinations of mutations produced worse editing than scaffold 320. However, even the CpG-reduced scaffolds that performed worse than scaffold 320, such as scaffolds 331 and 334, performed similarly to or better than scaffold 235.
[0667] Based on these results, without wishing to be bound by theory, it is believed that the boost in potency seen in many of the CpG-reduced and CpG-depleted scaffolds is likely caused by one of the mutations present in all CpG-reduced scaffolds (i.e., region 1 and/or 4). Since the mutation to region 4 is not present in the scaffolds with the extended stem loop replacement (i.e., the third mutation to region 3) and these scaffolds show a similar improvement in potency over 235 as 320 did, it is believed that the beneficial effect is likely caused by the mutation in region 1 (pseudoknot stem), which is present in all tested scaffolds. Further experiments are performed to test the effect of the individual mutations in the pseudoknot stem (region 1) and the extended stem (region 4) separately.
[0668] Further, the N=1 data as presented in
[0669] The results described here demonstrate that introducing mutations that reduced the CpG content of the DNA encoding the guide RNA scaffold resulted in improvements in gene editing relative to guide scaffold 235.
Example 19: CpG-Depleted AAVs Induce Less TLR9-Mediated Immune Response In Vitro
[0670] In the preceding example, CpG-reduced and CpG-depleted AAVs were shown to achieve effective editing at the targeted human B2M locus (as exemplary). Here, experiments are performed to assess the effects of CpG reduction or CpG depletion on the activation of TLR9-mediated immune response in vitro. Individual elements of the AAV genome and their respective CpG-reduced or CpG-depleted versions are subjected to in vitro assessment of immunogenicity to identify the optimal CpG-depleted sequences that reduce undesired TLR9 activation and yield potent editing (as demonstrated in Example 18), before being combined to generate an AAV genome with drastically reduced CpG presence for further evaluation.
Materials and Methods
[0671] AAV plasmid cloning, production of AAV vectors, and titering are performed as described in Example 18.
Use of Human TLR9 Reporter HEK293 Cells (HEK-Blue hTLR9) for the In Vitro Immunogenicity Assessment Post-Transduction with CpG-Containing (CpG+) or CpG-Depleted (CpG) AAVs:
[0672] The HEK-Blue hTLR9 line (InvivoGen) is derived from HEK293 cells, specifically designed for the study of TLR9-induced NF-B signaling. These HEK-Blue hTLR9 cells overexpress the human TLR9 gene, as well as a SEAP (secreted embryonic alkaline phosphatase) reporter gene under the control of an NF-B inducible promoter. SEAP levels in the cell culture medium supernatant, which can be quantified using colorimetric assays, report TLR9 activation.
[0673] For this experiment, 5,000 HEK-Blue hTLR9 cells are plated in each well of a 96-well plate in DMEM medium with 10% FBS and Pen/Strep. The next day, seeded cells were transduced with CpG.sup.+ or CpG.sup. AAVs expressing the CasX:gRNA system. All viral infection conditions are performed at least in duplicate, with normalized number of viral genomes (vg) among experimental vectors, in a series of three-fold serial dilution of MOI starting with the effective MOI of 1E6 vg/cell. Levels of secreted SEAP in the cell culture medium supernatant are assessed using the HEK-Blue Detection kit at 1, 2, 3, and 4 days post-transduction following the manufacturer's instructions.
[0674] The experiments using HEK-Blue hTLR9 cells to assess TLR9-modulated immune response are expected to show reduced levels of secreted SEAP from cells treated with CpG-AAVs in comparison to levels from cells treated with unmodified CpG.sup.+ AAVs. Reduced SEAP levels would indicate decreased TLR9-mediated immune activation.
Example 20: In Vivo Administration of AAV Vectors with or without CpG-Depleted Genomes to Assess the Effects on Inflammatory Cytokine Production and CasX-Mediated Editing
[0675] Experiments are performed to assess the effects of administering AAV vectors with or without CpG-depleted genomes in vivo. Briefly, AAV particles expressing the CasX:gRNA system (with or without CpG depletion) are administered into C57BL/6J mice. In these experiments, the combined AAV genome with substantial CpG depletion are used for assessment. After AAV administration, mice are bled at various time points to collect blood samples. Production of inflammatory cytokines such as IL-1, IL-6, IL-12, and TNF- is measured using ELISA and an assay that assesses transgene-specific T cell populations generated against the SIINFEKL (SEQ ID NO: 9589) peptide.
Materials and Methods
Generation of CpG-Depleted AAV Plasmids:
[0676] To assess the generation of transgene-specific T cells, a sequence encoding a SIINFEKL peptide (SEQ ID NO: 9589) is cloned into an AAV transgene plasmid on the 5- and 3-terminus of the encoded CasX protein, along with a gRNA with a ROSA26-targeting spacer. The SIINFEKL peptide (SEQ ID NO: 9589) is an ovalbumin-derived peptide that is well-characterized and has widely available reagents to probe for T cells specific for this peptide epitope.
[0677] Production of AAV vectors and determination of viral genome titer is performed as described earlier in Example 17.
Measurement of Inflammatory Cytokines to Assess Humoral Immune Activation:
[0678] 1E12 vg AAVs are injected intravenously or intraperitoneally into C57BL/6J mice. Blood is drawn daily from the tail vein or saphenous vein for seven days after AAV injection. Collected blood serum is assessed for the levels of inflammatory cytokines, such as IL-1, IL-6, IL-12, and TNF- using commercially available ELISA kits according to the manufacturer's recommendations for murine blood samples (Abcam). Briefly, 50 L of standard, control buffer, and sample is loaded to the wells of an ELISA plate, pre-coated with a specific antibody to IL-1, IL-6, IL-12, or TNF-, incubated at room temperature (RT) for two hours, washed, and incubated with horseradish peroxidase enzyme (HRP) for two hours at RT, followed by additional washes. Wells are treated with TMB ELISA substrate and incubated for 30 minutes at RT in the dark, followed by quenching with H.sub.2SO.sub.4. Absorbance is measured at 450 nm using a TECAN spectrophotometer with wavelength correction at 570 nm.
Assessment of Transgene-Specific T Cell Populations:
[0679] Ten days after intravenous injection with AAVs, the spleen is collected from mice, and T cells are isolated using the EasySep Mouse T Cell Isolation kit. Isolated T cells are incubated with the following: FITC mouse anti-human CD4 antibody (BD Biosciences), APC mouse anti-human CD8 antibody (BD Biosciences), and BV421 ovalbumin SIINFEKL MHC tetramer (Tetramer Shop). The percentage of CD4+ and CD8+ T cells specific to the SIINFEKL MHC tetramer is quantified using flow cytometry. FITC, APC, and BV421 are excited by the 488 nm, 561 nm, and 405 nm lasers and signal are quantified using suitable filter sets.
Quantification of AAV-Mediated Genome Editing at the ROSA26 Locus:
[0680] To demonstrate that CpG.sup. AAVs exhibit enhanced CasX editing activity relative to CpG.sup.+ AAVs in vivo, 1E12 AAV particles containing CasX protein 491 with gRNA targeting the ROSA26 locus are administered intravenously via the facial vein of C57BL/6J mice. Four weeks post-injection, mice are euthanized, and the liver and/or muscle tissue are harvested for gDNA extraction using the Zymo Quick DNA/RNA miniprep Kit following the manufacturer's instructions. Target amplicons are amplified from 200 ng of extracted gDNA with a set of primers targeting the mouse ROSA26 locus of interest and processed for NGS as described earlier in Example 18.
[0681] In vivo experiments measuring serum inflammatory cytokine levels are expected to show that CpG-depleted AAVs would significantly dampen production of inflammatory cytokines, such as IL-1, IL-6, IL-12, and TNF-, thereby reducing immunogenicity and toxicity. In addition, CpG-depleted AAVs are likely to cause less TLR9 activation leading to reduced expansion of T cells against the SIINFEKL peptide (SEQ ID NO: 9589)fused to CasX. Therefore, injections with CpG-depleted AAVs are expected to yield decreased levels of SIINFEKL-specific CD4+ and CD8+ T cells compared to levels from AAV constructs containing CpG elements.
[0682] Since CpG-depleted AAVs are likely to cause less humoral immune activation and non-specific inflammation, as well as less T-cell mediated immunity, titers of CasX-reactive antibodies are also expected to be reduced (i.e., lower ELISA signal quantifying CasX antibodies are anticipated).
[0683] Finally, editing capabilities of CpG-depleted AAVs are assessed by harvesting muscle and/or liver tissue for genomic DNA extraction and subjected to NGS to determine editing levels at the ROSA26 locus. Enhanced CasX editing activity at the ROSA26 locus is anticipated with CpG-depleted AAVs, given their expected likelihood to elicit less humoral immune response in vivo.
Example 21: Use of Muscle-Specific Promoters to Drive CasX Expression Results in Editing Activity in Muscle Cells and Tissue when the CasX:gRNA System is Expressed from a Transfected AAV Plasmid In Vitro or Packaged and Delivered Via AAVs In Vitro and In Vivo
[0684] Experiments were performed to demonstrate that use of muscle-specific promoters to drive CasX expression in an AAV vector results in higher and more selective editing activity in muscle cells than in non-muscle cell types, when the CasX:gRNA system is expressed from an AAV plasmid transfected in vitro. Experiments were also performed to demonstrate that use of muscle-specific promoters to drive CasX expression results in editing at a target locus in muscle cells when the CasX:gRNA system is packaged and delivered via AAVs in vitro and in vivo.
Materials and Methods
[0685] CasX variant 491 and guide scaffold variant 235 were used in these experiments. AAV construct cloning was performed as similarly described in Example 1. Briefly, AAV constructs containing a muscle-specific promoter driving CasX expression and a Pol III U6 promoter driving the expression of gRNA scaffold 235 and a ROSA26-targeting spacer (spacer 35.2; refer to Table 41 for sequences) were generated using standard molecular cloning techniques. Sequence-validated plasmid constructs were midi-prepped for subsequent nucleofection.
TABLE-US-00045 TABLE41 SequencesofAAVconstructsusedinthisexamplefortestingmuscle-specific promoters. DNAsequence Lengthof ConstructID ComponentName orSEQIDNO Component(bp) 215through220 5ITR 3683 130 buffersequence 3684 23 215,220 UbCpromoter 3720 400 216 CK8epromoter 3775 450 217 MHCK7promoter 3777 776 218 Desminpromoter 3774 724 219 MHCKpromoter 3776 742 215through220 buffersequence 9302 18 Kozak GCCACC 6 startcodon ATGGCC 6 c-MYCNLS 9290 27 linker 9306 6 CasX491 9291 2931 linker GGCTCC 6 c-MYCNLS 9292 27 stopcodon TAA 3 buffersequence 3695 30 bGHpoly(A) 3696 209 buffersequence GGTACCGT 8 U6promoter 3698 242 buffersequence GAAACACC 8 Scaffold235 3631 89 215through219 Spacer35.2 9317 20 220 SpacerNT 9314 18 215through220 buffersequence 3700 17 3ITR 3701 141 *Components are listed in a 5to 3order within the constructs
Plasmid Nucleofection into Mouse NPCs and Mouse C2C12 Myoblasts:
[0686] Briefly, 1 g of individual AAV plasmids (Table 41) expressing the CasX under the control of different muscle promoters were nucleofected into mouse muscle C2C12 myoblast cells, as well as neuronal NPCs for each experimental condition using methods as described in Example 1. Full media replacement was performed 48 hours post-nucleofections. Five days post-nucleofection, treated cells were harvested for gDNA extraction using the Zymo Quick DNA 96 Kit following the manufacturer's instructions. Target amplicons were then amplified from 200 ng of extracted gDNA with a set of primers targeting the mouse ROSA26 locus and processed as described earlier in Example 18 for editing assessment by NGS. As experimental controls, AAV plasmid constructs encoding the following were also tested: 1) UbC promoter driving CasX expression with gRNA containing spacer 35.2; and 2) UbC promoter driving CasX expression with a non-targeting gRNA. A no treatment control was also included as an experimental control.
[0687] AAV production and AAV titering were performed as described in Example 1.
AAV Transduction of C2C12 Myoblasts and Myotubes:
[0688] AAVs were used to transduce two differentiated states of C2C12 cellsmyoblasts and myotubes.
[0689] To determine the level of CasX-mediated editing in myoblasts, 5,000 C2C12 myoblasts were plated and transduced the next day with AAVs encoding the various CasX:gRNA systems (Table 41) at varying MOIs. Five days following transduction, cells were harvested for gDNA extraction for editing analysis at the ROSA26 locus as described above.
[0690] To determine the level of CasX-mediated editing in myotubes, 10,000 C2C12 myoblasts were plated and cultured in differentiation media for seven days to induce differentiation into myotubes. After myotube formation, cells were transduced with AAVs encoding the various CasX:gRNA systems (Table 41) at varying MOIs. Five days following transduction, cells were harvested for gDNA extraction for editing analysis at the ROSA26 locus as described above.
In Vivo Administration of AAVs and Tissue Processing:
[0691] 8E11 AAV viral particles encoding the various CasX:gRNA systems (Table 41) were administered retro-orbitally in C57BL/6J adults. Nave, untreated mice served as experimental controls. Mice were euthanized at four weeks post-injection. Various tissues were harvested for gDNA extraction using the Zymo Quick DNA/RNA miniprep Kit following the manufacturer's instructions. Tissues harvested were skeletal muscles (i.e., tibialis anterior (TA), gastrocnemius (GA), quadriceps (Quad), heart, and diaphragm (DIA)) and non-muscle organs (i.e., liver and lung). Target amplicons were amplified from 200 ng of extracted gDNA with a set of primers targeting the mouse ROSA26 locus and processed as described in Example 18 for editing assessment by NGS. The number of AAV viral genomes (vg) per diploid genome (dg) was determined in the harvested gDNA samples by droplet digital PCR (ddPCR) using the Bio-Rad QX200 Droplet Digital PCR instrument according to standard methods and following the manufacturer's guidelines (see additional detail in Example 28). The vg/dg analysis is an indication of the amount of AAV viral particles delivered into that specific tissue.
Results
[0692] AAV plasmids containing constructs encoding for muscle-specific promoters used to drive CasX expression were nucleofected into C2C12 myoblasts and mouse NPCs to assess the level of specificity of the editing activity in muscle cells compared to neuroprogenitor cells.
[0693] Furthermore, the percent editing at the ROSA26 locus was plotted against the size of the muscle-specific protein promoter, with the results presented in
[0694] AAVs encoding the CasX:gRNA system, in which muscle-specific promoters were used to drive CasX expression, were used to transduce C2C12 myoblasts and myotubes to assess the level of editing activity in muscle cells at the ROSA26 locus, and the editing results are illustrated in
[0695] An initial proof-of-concept experiment assessing use of the four different muscle-specific promoters was performed in vivo. AAVs containing CasX protein 491, driven by the muscle-specific promoters or the UbC promoter, and guide scaffold 235 with the ROSA26-targeting spacer were delivered in vivo. Both muscle and non-muscle organs were harvested for editing and vg/dg analyses, depicted in bar graphs in
[0696] AAV biodistribution was evaluated by quantifying AAV viral particles delivered for a specific tissue using a vg/dg analysis. The vg/dg analysis revealed that similar biodistribution levels were achieved for AAVs containing a muscle-specific promoter or the UbC promoter within a particular tissue (data not shown). Further analysis was performed to determine the relative CasX expression (normalized by vg/dg) driven by muscle-specific promoters CK8e or MHC7 compared to that driven by UbC, and the results are illustrated in
[0697] The results demonstrate that muscle-specific promoters can be used to drive CasX expression and induce higher editing activity in muscle cell types than in non-muscle cell types when delivered via nucleofection. The data also show that AAVs produced from these AAV plasmids containing muscle-specific promoters were able to induce CasX expression and editing activity in muscle cells in vitro and in vivo when delivered via transduction. The findings also indicate the tissue specificity of using muscle-specific promoters to drive CasX expression compared to use of ubiquitous promoter like UbC.
Example 22: Use of Muscle-Specific Regulatory Elements to Generate AAV Constructs to Produce AAVs that would Transduce and Express CasX More Selectively in Muscle Cells and Tissue
[0698] Experiments are performed to demonstrate that incorporation of muscle-specific regulatory elements, e.g., promoters and enhancers, into AAV plasmids used for AAV production, results in more selective expression of CasX and higher editing activity in muscle cell types than in non-muscle cell types when the CasX:gRNA system is delivered by AAVs.
Materials and Methods
[0699] CasX variant 491, 515, 593, 668, 672, 676, or 812 are used for the experiments described herein. AAV construct cloning, AAV production, and AAV titering are performed as described in Example 1. Various muscle-specific regulatory elements, e.g., promoters (Table 42) and enhancers (Table 43), are individually cloned into AAV plasmids harboring sequences encoding for a CasX protein and a gRNA with scaffold 235 and an AAVS1-targeting spacer. The resulting AAV plasmids are used for AAV production and transduction of human skeletal muscle cells (hSKMCs) to determine editing levels at the AAVS1 locus.
TABLE-US-00046 TABLE 42 Sequences of muscle-specific promoters. SEQ ID NO Promoter Promoter length (bp) 3773 SP-301 579 3774 Desmin 724 3775 CK8e 450 3776 MHCK 742 3777 MHCK7 776 3778 SpC5-12 358
TABLE-US-00047 TABLE 43 Sequences of muscle-specific enhancers. SEQ ID NO Enhancer Enhancer length (bp) 3779 Muscle Enhancer 1 495 3780 Muscle Enhancer 2 344 3781 Muscle Enhancer 3 429 3782 Muscle Enhancer 4 434 3783 Muscle Enhancer 5 171 3784 Muscle Enhancer 6 51 3785 Muscle Enhancer 7 60 3786 Muscle Enhancer 8 41 3787 Muscle Enhancer 9 120 3788 Muscle Enhancer 10 474 3789 Muscle Enhancer 11 519 3790 Muscle Enhancer 12 372 3791 MyoD Enhancer 256 3792 Cardiac Muscle Enhancer 1 206 3793 Cardiac Muscle Enhancer 2 255 3794 Cardiac Muscle Enhancer 3 277 3795 Cardiac Muscle Enhancer 4 660 3796 Myoblast Muscle Enhancer 1 221 3797 Myoblast Muscle Enhancer 2 310 3798 Myoblast Muscle Enhancer 3 218 3799 Myoblast Muscle Enhancer 4 353 3800 Myoblast Muscle Enhancer 5 50 3801 Skeletal Muscle Enhancer 1 395 3802 Skeletal Muscle Enhancer 2 382 3803 Skeletal Muscle Enhancer 3 135 3804 Skeletal Muscle Enhancer 4 326 3805 Skeletal Muscle Enhancer 5 273 3806 Skeletal Muscle Enhancer 6 148 3807 Skeletal Muscle Enhancer 7 80 3808 Skeletal Muscle Enhancer 8 437 3809 Skeletal Muscle Enhancer 9 297
AAV Transduction In Vitro:
[0700] AAVs are used to transduce two differentiated states of hSKMCsmyoblasts versus myotubes.
[0701] 500,000 primary hSKMC cells (ATCC, PCS-950-010) are plated per 2-415 cm dishes in growth media (DMEM/F-12, 20% FBS, 1% PenStrep, 2.5 ng/mL b-FGF). Once cells reach 7000 confluency, cells are lifted and re-seeded in a 96-well plate at 5,000-10,000 cells per well in differentiation media (DMVEM, 200 horse serum, 1% PenStrep).
[0702] To determine level of CasX-mediated editing in myoblasts, hSKMCs are transduced with AAVs 4-6 hours after re-seeding in differentiation media at multiple MOIs. Five days following transduction, cells are harvested for gDNA extraction for editing analysis at the AAVS1 locus by NGS. Briefly, target amplicons are amplified from 200 ng of extracted gDNA with a set of primers targeting the human AAVS1 locus and processed for NGS as described in Example 18.
[0703] To determine the level of CasX-mediated editing in myotubes, re-seeded hSKMCs into differentiation media are cultured in differentiation media for an additional 7-10 days to promote differentiation into myotubes. After myotube formation, cells are transduced with AAVs at multiple MOIs. Five days following transduction, cells are harvested for editing assessment at the AAVS1 locus by NGS as described above.
[0704] As a comparison to assess muscle-cell specificity of the produced AAVs, non-muscle cells such as HepG2 hepatocytes or human NPCs are also transduced with AAVs produced from the same AAV plasmids containing the muscle-specific regulatory elements described herein.
[0705] In addition, assessing the incorporation of muscle-specific regulatory elements within an AAV transgene to selectively express CasX in muscle-specific cell types in vivo are also investigated. These methods for these in vivo experiments are further described in Example 23.
[0706] The results of these experiments are expected to demonstrate that AAVs produced from AAV plasmids containing constructs incorporating muscle-specific regulatory elements (promoter and/or enhancer, see Tables 42 and 43) to drive CasX expression, demonstrate higher editing activity in muscle-specific cell lines compared to non-muscle cell types.
Example 23: Use of Muscle-Specific AAV Serotypes to Increase Muscle-Specific Cellular and Tissue Tropism to Enhance CasX-Mediated Editing In Vivo
[0707] Experiments are performed to demonstrate that use of muscle-specific AAV serotypes may improve specific cellular and tissue tropism and, therefore, enhance delivery and potency of AAVs in the target muscle cells with minimal editing in off-target cell types in vivo.
Materials and Methods
[0708] AAV plasmid cloning and AAV production and titering are performed using similar methods described in Example 1. Specifically, the sequences encoding the AAV VP1 serotypes and variants listed in Table 44 are cloned into relevant pRep/Cap plasmids for use in AAV production.
TABLE-US-00048 TABLE 44 Sequences of AAV serotypes to be assessed in vivo. Amino acid sequence AAV serotype (SEQ ID NO) AAV6 3810 Rh74 3811 RhM4-1 3812 AAV9 3813 MyoAAV 1A1 3814 MyoAAV 1A2 3815 MyoAAV 2A 3816
In Vivo Administration of AAVs and Tissue Processing:
[0709] A dose response experiment is performed, where 1E9 to 1E12 AAV viral particles containing CasX protein 491, 515, 672, or 676 and guide scaffold variant 235 with spacer 35.2 targeting the safe harbor ROSA26 locus are administered retro-orbitally in C57BL/6J adults. Nave, untreated mice serve as experimental controls. Mice are euthanized at different time points, up to four weeks post-injection. Various tissues, including skeletal muscles (e.g., tibialis anterior, gastrocnemius, soleus, quadriceps, heart, and diaphragm) and other organs (liver, spleen, lung etc.) are harvested for gDNA extraction using the Zymo Quick DNA/RNA miniprep Kit following the manufacturer's instructions. Target amplicons are then amplified from 200 ng of extracted gDNA with a set of primers targeting the mouse ROSA26 locus and processed as described earlier in Example 18 for editing assessment by NGS.
[0710] Results from the experiments are expected to show that AAVs containing CasX protein and guide scaffold 235 with the ROSA26-targeting spacer are able to edit the target ROSA26 locus in various muscle tissues. Furthermore, it is expected that higher editing activity is detected in muscle tissues compared to that detected in other tissues, such as the liver or spleen, which would indicate the ability to increase muscle-specific tissue tropism in vivo by incorporating constructs encoding for muscle-specific AAV serotypes into the pRep/Cap plasmid.
Example 24: Small Class 2, Type V CRISPR Proteins can Edit the Genome when Expressed from an AAV Episome In Vitro
[0711] Experiments are conducted to demonstrate that small Class 2, Type V CRISPR proteins, such as CasX, are able edit a genome when expressed from an AAV plasmid or an AAV vector in vitro.
Materials and Methods
[0712] The AAV transgene is conceptually broken up between ITRs into different parts, consisting of the therapeutic cargo and accessory elements relevant to expression of the therapeutic cargo in mammalian cells. AAV vectorology consists of identifying the relevant parts and subsequently designing, building, and testing vectors in both plasmid and AAV vector form in mammalian cells. A schematic of one configuration of its components is shown in
[0713] For the experiments in this example, constructs encoding for CasX variants 515, 593, 668, 672, 676, or 812 with gRNA scaffold variant 235 are used to generate AAV plasmids for AAV production.
[0714] AAV vector cloning and quality control are performed as described in Example 1.
[0715] Method for plasmid nucleofection are performed as described in Example 1.
[0716] AAV production and titer determination are performed as described in Example 1.
[0717] AAV transduction of mNPCs and subsequent FACS analysis for tdTomato+ cell quantification are performed as described in Example 1.
[0718] The results are expected to demonstrate that small CRISPR proteins, such as CasX, and targeted gRNAs are able to edit the genome when expressed from an AAV transgene plasmid or episome in vitro. For the experiments described in this example, the results are expected to show that CasX variant proteins complexed with a gRNA containing scaffold 235 and a tdTomato-targeting spacer are able to edit the target STOP cassette in mNPCs as measured by FACs.
Example 25: Packaging of Small Class 2, Type V CRISPR Systems within an AAV Vector
[0719] Experiments are conducted to demonstrate that systems of small Class 2, Type V CRISPR proteins, such as CasX, and gRNA can be encoded and efficiently packaged within a single AAV vector.
Materials and Methods
[0720] For this experiment, AAV vectors are generated with transgenes packaging CasX variant 515, 668, 672, or 676, with gRNA scaffold variant 235 and spacer 12.7 using the methods for AAV production, purification and characterization, as described in Example 24. For characterization, AAV viral genomes are titered by qPCR, and the empty-full ratio are quantified using scanning transmission electron microscopy (STEM). AAVs are negatively stained with 1% uranyl acetate and visualized. Empty particles are identified by the presence of a dark electron dense circle at the center of the capsid.
[0721] The results from these experiments are expected to demonstrate that the CRISPR system (CasX variant proteins and gRNA) can be efficiently packaged within a single AAV vector. qPCR results reveal high AAV genome titers, and STEM micrographs are expected to show that a vast majority of the AAV particles contain viral genomes.
Example 26: Demonstration of In Vivo Editing with Small Class 2, Type V CRISPR Proteins Expressed from an AAV Episome
[0722] Experiments are conducted to demonstrate that small Class 2, Type V CRISPR proteins, such as CasX, can edit the genome when expressed from an AAV episome in vivo.
Materials and Methods
[0723] For this experiment, AAV vectors are generated using the methods for AAV production, purification and characterization, as described in Example 24.
In Vivo Administration of AAVs and Tissue Processing:
[0724] Ai9 neonate mice are injected with AAVs with a transgene encoding CasX variant 515, 593, 668, 672, 676, or 812, and gRNA scaffold variant 235 with spacer 12.7. Briefly, mice are cryo-anesthetized, and 1E11 viral genomes of AAV particles are unilaterally injected into the intracerebroventricular (ICV) space. One month after ICV injections, animals are terminally anesthetized with an intraperitoneal injection of ketamine/xylazine and perfused transcardially with saline and fixative (4% PFA). Brains are dissected and further post-fixed in 4% PFA, followed by infiltration with 30% sucrose solution, and OCT embedding. OCT-embedded brains are coronally sectioned using a cryostat. Sections are mounted on slides, counterstained with DAPI to label cell nuclei, cover-slipped and imaged on a fluorescence microscope. Images are processed using the ImageJ software and editing levels are quantified by counting the number of tdTomato+ cells as a percentage of DAPI-labeled nuclei.
[0725] In a subsequent experiment to assess editing in peripheral tissues, particularly in the liver and heart, P0-P1 pups from Ai9 mice are cryo-anesthetized and intravenously injected with 1E12 viral genomes (vg) of the same AAV construct. One month post-AAV administration, animals are terminally anesthetized, and heart and liver tissues are necropsied and processed as described above.
[0726] The results of these experiments are expected to demonstrate that AAVs encoding small CRISPR proteins, such as CasX, and a targeting gRNA can be distributed within the tissues, when delivered either locally (brain) or systemically. Given the use of the Ai9 mouse model, the results are expected to show tdTomato fluorescence throughout the target tissue, an indication that the AAV delivery modality would be able to achieve sufficient biodistribution. The results are also expected to show that the CasX:gRNA system can edit the target genome (here, the tdTomato locus) when expressed from single AAV episomes in vivo.
Example 27: Small CRISPR Protein Potency is Enhanced by AAV Vector Protein Promoter Choice
[0727] Experiments are conducted to demonstrate that small CRISPR protein expression, such as CasX, can be enhanced by utilizing different promoters in an AAV construct for the encoded protein. Cargo space in the AAV transgene can be maximized with the use of short promoters in combination with CasX. Additionally, experiments are conducted to demonstrate that expression can be enhanced with the use of promoters that would otherwise be too long to be efficiently packaged within an AAV vector, if combined with larger CRISPR proteins such as Cas9. The use of long, cell-type-specific promoters to enhance small CRISPR proteins is an advantage to the AAV system described herein, and not possible in traditional CRISPR systems due to the size of other CRISPR proteins.
Materials and Methods
[0728] Cloning and QC are conducted as described in Example 24. Promoter variants (listed in Table 7 in example 4) are cloned upstream of the CasX gene in an AAV-cis plasmid. The sequences of additional components of the AAV constructs, with the exception of sequences encoding the CasX (Table 26) and the one or more gRNA (Tables 23 and 24), are listed in Table 45.
Method for Plasmid Nucleofection:
[0729] Immortalized neural progenitor cells are nucleofected as described in Example 24.
[0730] AAV viral production and QC, and AAV transduction and editing level assessment in mNPTC-tdT cells by FACS are conducted as described in Example 24.
[0731] The results of these experiments are expected to demonstrate that several different promoters used to drive CasX expression, when delivered by nucleofection as an AAV transgene plasmid or by transduction of AAV vectors, are able to induce editing of the target STOP cassette in mNPCs. It is possible that use of certain promoters results in higher editing than use of other promoters. These data are expected to demonstrate that expression of small CRISPR proteins, such as CasX, can be enhanced by utilizing long promoters that would otherwise be unusable with traditional CRISPR proteins due to the size constraints of the AAV genome. Furthermore, combining short promoters with small CRISPR proteins, such as CasX, is expected to allow for significant reductions in the AAV transgene cargo capacity without compromising expression efficiency. This conservation of space allows for the inclusion of additional accessory elements, such as enhancers and regulatory elements in the transgene, which would enable increased editing potential.
TABLE-US-00049 TABLE45 AAVtransgeneconstructsandcomponentsequences* *Tablelistscomponentsequencesexceptforsequencesencodingnuclease,guideRNA,and linkingpeptides SEQ Component Name IDNO Constructs 5ITR AAV2ITR(alternate) 3817 1-174,177-186,188-198,207-220 CpG-depleted5ITR 3749 none Enhancer+ CMV 4048 1-3,7,24-33,44-52,103-117,211-214 core N/A 3562 1-3,7,24-33,44-52,64-71,103-117,156 promoter Syn1 3818 65 NPC5 3819 66 NPC7 3820 67 NPC127 3821 68 NPC190 3822 69 NPC249 3823 70 NPC286 3824 71 Enhancer MuscleEnhancer1 3825 none MuscleEnhancer2 3826 none MuscleEnhancer3 3827 none MuscleEnhancer4 3828 none MuscleEnhancer5 3829 none MuscleEnhancer6 3830 none MuscleEnhancer7 3831 none MuscleEnhancer8 3832 none MuscleEnhancer9 3833 none MuscleEnhancer10 3834 none MuscleEnhancer11 3835 none MuscleEnhancer12 3836 none MyoDEnhancer 3837 none CardiacMuscleEnhancer 3838 none 1 CardiacMuscleEnhancer 3839 none 2 CardiacMuscleEnhancer 3840 none 3 CardiacMuscleEnhancer 3841 none 4 MyoblastMuscle 3842 none Enhancer1 MyoblastMuscle 3843 none Enhancer2 MyoblastMuscle 3844 none Enhancer3 MyoblastMuscle 3845 none Enhancer4 MyoblastMuscle 3846 none Enhancer5 SkeletalMuscleEnhancer 3847 none 1 SkeletalMuscleEnhancer 3848 none 2 SkeletalMuscleEnhancer 3849 none 3 SkeletalMuscleEnhancer 3850 none 4 SkeletalMuscleEnhancer 3851 none 5 SkeletalMuscleEnhancer 3852 none 6 SkeletalMuscleEnhancer 3853 none 7 SkeletalMuscleEnhancer 3854 none 8 SkeletalMuscleEnhancer 3855 none 9 Protein CMV 3856 1-3,7,24-33,44-52,103-117,211-214 promoter UbC 3857 4,34-37,53,78,79-102,119-155,157- 174,183,188-190,207-210,215,220 EFS 3858 5,38-40 CMV-s 3859 6,41-43 CMVd1 3860 8 CMVd2 3861 9 miniCMV 3862 10 HSVTK 3863 11 miniTK 3864 12 miniIL2 3865 13 GRP94 3866 14 Supercore1 3867 15 Supercore2 3868 16 Supercore3 3869 17 Mecp2 3870 18,192 CMVmini 3871 19 CMVmini2 3872 20 miniCMVIE 3873 21,193 adML 3874 22 hepB 3875 23 RSV 3876 54 hSyn 3877 55 SV40 3878 56 hPGK 3879 57 Jet 3880 58,72-74,191 Jet+UsPintron 3881 59,75-77 hRLP30 3882 60 hRPS18 3883 61 CBA 3884 62 CBH 3885 63 CMVcore 3562 64,198 U1a 3886 177,180,181,182, CpG-reducedU1a 3887 178,206 promoter CpG-depletedU1a 3888 179,205 promoter CpG-reducedUbC 3889 184 promoter StronglyCpG-reduced 3890 185 UbCpromoter CpG-depletedUbC 3891 186 promoter SFCp 3892 194 miniSV40 3893 195 pJB42CAT5 3894 196 MLP 3895 197 miniEF1 3896 none hRPL13a 3897 none CK8epromoter 3898 216 MHCK7promoter 3899 217 Desminpromoter 3900 218 MHCKpromoter 3901 219 SP-301 3902 none SpC5-12 3903 none 5NLSaa 1XSV40NLS 3904 sequence 4XSV40NLS 3905 121-123 1XCmycNLS 3906 83,84,89-102,124-131,135-137,141-155, 157-174,177-186,188-198,207-210215- 220 2XCmycNLS 3907 127-129 4XCmycNLS 3908 130,131 6XCmycNLS 3909 135-137,142 1XNucleoplasminNLS 3910 132-134 2XNucleoplasminNLS 3911 138-140 1XCmyc1XSV40NLS 3912 none 1XCmyc21XSV40 3913 none NLS 1XCmyc2NLS 3914 none 3XCmyc2NLS 3915 none 4XCmyc2NLS 3916 none 1XCPVNLSIN 3917 none 2XCPVNLSIN 3918 none 1XhBOVcNLSIN 3919 none 1XhBOVcNLS2N 3920 none 1XSIRTNLS 3921 none 2XSIRTNLS 3922 none 1XCmycNLS1X 3923 none BPSV40NLSGGS 1XCmycNLS1X 3924 none BPSV40NLSPPPPG 1XCmycNLS1X 3925 none BPSV40NLSpx330PG 1XCmycNLS1X 3926 none BPSV40NLS(GGGS)2 PG 1XCmycNLS1X 3927 none BPSV40NLSP(GGGS)2 PG 1XCmycNLS1X 3928 none BPSV40NLSalphaPG 1XCmycNLS1X 3929 none BPSV40NLSPG 1XCmycGGS1XSV40 3930 none GGS 1XCmycPPP1XSV40 3931 none PG 1XCmycPG 3932 none 1XCmyc(GGGS)3 3933 none 1XCmycPPP 3934 none 1XCmyc(GGGS)3PPP 3935 none 1XSV40PPP 3936 none 1XSV40GGS 3937 none CasX CpG-freecMycNLS- 3938 205,206 Stx491-cMycNLS 3NLSaa 1XSV40NLS 3940 211-214 sequence 4XSV40NLS 3941 149 6SSV40NLS 3942 none 1XCmycNLS 3939 141,142,150,157-174,177-186,188-198, 207-210 2XCmycNLS 3943 151 4xCmycNLS 3944 none 6xCmycNLS 3945 152 1XNucleoplasminNLS 3946 119,122,125,128,130,133,136,139,153 2XNucleoplasminNLS 3947 120,123,126,129,131,134,137,140,154 2xNucleoplasmin2x 3948 155 SV40NLS B19NLS1C 3949 none BoVNLS3C 3950 none 1XSV40GS1X 3951 none NuceloplasminNLS GPvBPSV4012aaSV40 3952 143 NLS (GGGs)2vBPSV4012aa 3953 none SV40 3alphahelixvBPSV40 3954 144 12aaSV40 GPSV40GGSvBPSV40 3955 none 12aaSV40 GPalphahelixCmyc 3956 145 NLS GP(GGGS)3CmycNLS 3957 146 GPSV40PPPCmyc 3958 148 NLS GPCmycNLS 3959 147 TGGGPGGGAAAGSGS- 3960 none 1xSV40-GS-Nuc TGGGPGGGAAAGSGS- 3961 none 1xSV40-GS PPPlinker1xSV40 3962 none PPPlinker GGSlinker1xSV40 3963 none PPPlinker PPPlinker1xSV40 3964 none GGSlinker1xSV40 3965 none GGSlinker1xSV40 3966 none (GGS)3linker GGSlinker2xSV40 3967 none (GGS)3linker1xSV40 3968 none GGS1XSV40 PPP(GGGS)3linker 3969 none 1xCmyc PPPlinker1xCmyc 3970 none PPP(GGGS)3linker 3971 none 1xCmyc PTRE WPRE1 3972 35,38,41,72,75,78,81,83 WPRE2 3973 36,39,42,73,76,79,82,84,188-190 WPRE3 3974 34,37,40,43,74,77,80 Poly(A) bGH 3975 1-23,32,33,35-174,177-181,183-186, signal 188-198,207-220 hGH 3976 24 hGHshort 3977 25 HSVTK 3978 26 SynPolyA 3979 27 SV40 3980 28 SV40short 3981 29 bglob 3982 30 bglobshort 3983 31 SV40polyAlate 3984 34 CpG-depletedbGH- 3985 182,205,206 polyAsequence RNA humanU6 3986 1-31,34-84,103-157,177-179,182-186, promoter 188-198,207,209,211-220 humanU6(revcomp) 3987 208,210 H1 3988 32,158 7SK 3989 33 hU6variant1 3990 85,89 hU6variant2 3991 86 hU6variant3 3992 87 hU6variant4 3993 88 hU6variant5 3994 90 hU6variant6 3995 91 hU6variant7 3996 92 hU6variant8 3997 93 hU6variant9 3998 94 hU6variant10 3999 95 hU6variant11 4000 96 hU6variant12 4001 97 hU6variant13 4002 98 hU6variant14 4003 99 hU6variant15 4004 100 hU6variant16 4005 101 hU6variant17 4006 102 H1core 4007 159 H1core+7SKhybrid1 4008 160 H1core+7SKhybrid2 4009 161 H1core+7SKhybrid3 4010 162 H1core+7SKhybrid4 4011 163 H1core+7SKhybrid5 4012 164 H1core+7SKhybrid6 4013 165 H1core+7SKhybrid7 4014 166 H1core+7SKhybrid8 4015 167 H1core+7SKhybrid9 4016 168 H1core+U6hybrid1 4017 169 H1core+U6hybrid2 4018 170 H1core+7SK+U6 4019 171 hybrid1 H1core+U6hybrid3 4020 172 H1core+7SK+U6 4021 173 hybrid2 H1core+7SK+U6 4022 174 hybrid3 hU6isoform2 4023 none hU6isoform3 4024 none hU6isoform4 4025 none hU6isoform5 4026 none CpG-reducedU6 4027 180 promoter CpG-depletedU6 4028 181,205,206 promoter CpG-reducedhU6 4029 none Isoform2 CpG-depletedhU6 4030 none Isoform2 CpG-depletedhU6 4031 none Isoform3 CpG-depletedhU6 4032 none Isoform4 CpG-depletedhU6 4033 none Isoform5 mU6 4034 none mU6isoform 4035 none gorillaU6 4036 none SaimiriU6 4037 none MacacaU6 4038 none PapioU6 4039 none RhinopithecusU6 4040 none MiniGorillaU6 4041 none MiniSaimiriU6 4042 none MiniMacacaU6 4043 none MiniPapioU6 4044 none MiniRhinopithecusU6 4045 none 3ITR AAV2ITR 4046 1-174,177-186,188-198,207-220 CpG-depleted3ITR 4047 none
Example 28: AAV-Mediated Selective Expression of CasX in Rod and Cone Photoreceptors Results in Strong On-Target Activity at a Safe Harbor Locus in the Murine Retinae
[0732] Experiments were performed to demonstrate the ability of CasX to edit selectively rod and cone photoreceptors in the mouse retina by restricting its expression with a selective photoreceptor promoter, with a gRNA spacer targeting a safe harbor locus in the mouse genome. The correlation between editing and proteomic levels was demonstrated in a transgenic reporter mouse model that expressed GFP only in the rod photoreceptors.
Materials and Methods
Generation of AAV Plasmids and Viral Vectors:
[0733] CasX variant 491, flanked on either side by a c-MYC NLS, under the control of the various photoreceptor-specific promoters (listed in Table 46) based on the endogenous G-coupled Rhodopsin Kinase 1 (GRK1) promoter, and the gRNA guide variant 235 with spacer 35.2 (AGAAGAUGGGCGGGAGUCUU; SEQ ID NO: 9343) targeting the mouse ROSA26 locus under the U6 promoter, were cloned into a pAAV plasmid flanked with AAV2 ITR using standard cloning methods.
TABLE-US-00050 TABLE 46 Sequences of GRK1 promoter variants. Promoter SEQ ID NO GRK1(93) 9344 GRK1(94) 9345 GRK1(174) 9346 GRK1(199) 9347 GRK1(241) 9348 GRK1(292) 9349 GRK1(292)-SV40 9350 GRK1-SV40 3718
[0734] AAV production and AAV titering were performed as described in Example 1.
[0735] Subretinal injections were performed in C57BL/6J mice as described in Example 16. Each mouse from the experimental groups was injected in one eye with 5E8 vg per eye. AAVs containing the GRK1-SV40 with a non-targeting (NT) gRNA served as an experimental control.
[0736] The processing of tissues, which were harvested three weeks post-injection, and subsequent NGS analysis were performed as described in Example 16. Briefly, gDNA was extracted using the Zymo Quick DNA/RNA miniprep Kit following the manufacturer's instructions and used for the amplification of the target amplicon at the ROSA26 locus. Target amplicons were sequenced and processed as described in Example 16.
ddPCR Analysis of AAV Genomes (Vg Dg):
[0737] The number of AAV viral genomes (vg) per diploid genome (dg) was determined in gDNA samples extracted from harvested tissues by ddPCR using the Bio-Rad QX200 Droplet Digital PCR instrument according to standard methods and following the manufacturer's protocol and guidelines. Briefly, ddPCR reactions containing the extracted gDNA samples were set up, serially diluted, and subjected to droplet formation using the droplet generator. Within each droplet, a PCR amplification reaction was performed using a primer-probe set specific to CasX, an indicator of the transgene, and mouse RPP30, an indicator of the mouse genome. Subsequently, droplet fluorescence was determined using a QX200 Droplet Reader with Bio-Rad QuantaSoft software. To calculate total vg/dg for each tissue, the total quantified copy amount for CasX was divided by the copy amount calculated for RPP30, and then divided by 2 (diploid genome per cell).
Results
[0738] Editing levels at the ROSA26 locus were quantified in retinae harvested from mice injected sub-retinally with AAVs expressing CasX 491 under the control of various engineered retinal promoters (listed in Table 46) to identify promoters driving the strongest levels of CasX-mediated editing in the photoreceptors.
[0739] Additional analyses were performed by correlating editing levels achieved when using a particular promoter variant with the vg/dg quantification, to account for potential variation in AAV delivery. The editing profile for each promoter variant was plotted with the corresponding vg/dg value, and a nonlinear regression curve was fitted to assess the correlation (
TABLE-US-00051 TABLE 47 Slope values calculated from the nonlinear regression curves in FIGS. 82A-82C. Promoter Slope value Standard deviation of slope GRK1(292)-SV40 23.78 5.809 GRK1(292) 26.65 8.124 GRK1(241) 15.17 11.78 GRK1(199) 8.792 21.35 GRK1(94) 11.44 12.02 GRK1(93) 16.6 15.31
[0740] The results from these experiments demonstrate proof-of-concept that CasX, driven by the various photoreceptor-specific promoters with the targeting gRNA, can achieve editing in the photoreceptor cells of the retinae when delivered by AAVs via subretinal administration. Variable levels of editing were achieved when using the different promoter variants. Furthermore, given the limited cargo capacity of the AAV transgene, use of a shorter tissue-specific promoter to drive sufficient CasX expression to induce editing would be especially beneficial in the context of a dual-guide AAV vector.
Example 29: Demonstration that Varying the Placement and Orientation of the gRNA Promoter in the CasX:Dual-gRNA System Expressed from an all-In-One AAV Vector can Affect Editing of the Target Locus
[0741] The experiments in Example 9 showed that the CasX:dual-gRNA system packaged and delivered within a single AAV was able to edit the target gene. Here, experiments were performed to demonstrate that placement and orientation of the gRNA promoters within the AAV transgene to drive expression of dual gRNAs can affect the efficiency of the dual-cut editing of a target locus. Within the AAV plasmid, gRNA promoters could be placed upstream, downstream, or flanking the CasX construct and could be in a forward or reverse orientation. The various configurations of the dual-gRNA transcriptional units relative to the CasX construct within the AAV transgene are illustrated in
Materials and Methods
[0742] AAV plasmid constructs were generated and cloned into a pAAV plasmid flanked with AAV2 ITRs using standard molecular cloning methods as described in Example 1. Briefly, dual-gRNA AAV plasmids were generated to express CasX variant 491 driven by the ubiquitous UbC promoter and two gRNA transcriptional units that each expressed a Pol III U6 promoter-guide scaffold 235-a specific spacer combination (spacer 12.7 targeting the tdTomato locus (SEQ ID NO: 4049) and/or a non-targeting spacer. In this example, the two gRNA transcriptional units were cloned relative to the CasX construct using configuration #1, #2, and #4 (illustrated in
TABLE-US-00052 TABLE 48 Combinations of a tdTomato-targeting spacer (12.7) and a non-targeting (NT) spacer tested in this example in configuration #1, #2, and #4 (illustrated in FIGS. 38-39) of dual gRNA units relative to the CasX 491 construct. The R preceding the spacer denotes the reverse orientation of the transcription of the indicated gRNA unit. Configuration # Specific spacer combination tested #1 NT-CasX 491-NT #1 12.7-CasX 491-NT #1 NT-CasX 491-12.7 #1 12.7-CasX 491-12.7 #4 R.NT-CasX491-NT #4 R.12.7-CasX 491-NT #4 R.NT- CasX 491-12.7 #4 R.12.7- CasX 491-12.7 #2 CasX 491-NT-NT #2 CasX 491-12.7-NT #2 CasX 491-NT-12.7 #2 CasX-12.7-12.7
[0743] AAV nucleofection of tdTomato mNPCs was performed as described in Example 1. Briefly, 125 ng of AAV plasmid encoding for XAAVs expressing the CasX:dual-gRNA system with the various configurations listed in Table 48 were nucleofected mNPCs. Five days post-nucleofection, mNPCs were harvested for editing analysis at the tdTomato locus by FACS, as described in Example 1. For comparison, AAV plasmid encoding for XAAVs expressing CasX 491 with a single gRNA transcriptional unit using spacer 12.7 was also used in this example.
[0744] AAV production and AAV titering were performed as described in Example 1.
AAV Transduction of tdTomato mNPCs, Followed by Flow Cytometry:
[0745] 10,000 mNPCs were seeded per well in PLF-coated 96-well plates; 48 hours later, seeded cells were transduced with AAVs expressing the CasX:dual-gRNA system of various configurations (Table 48). All viral infection conditions were performed in triplicate, with a normalized number of viral genomes (vg) among experimental vectors, in a series of three-fold dilution of MOI ranging from 1E5 to 1E3 vg/cell. Five days post-transduction, XAAV-treated mNPCs were harvested for editing analysis at the tdTomato locus by FACS, as described earlier in Example 1. For comparison, AAVs expressing CasX 491 with a single gRNA transcriptional unit using spacer 12.7 were also assayed in this example.
Results
[0746] tdTomato mNPCs were nucleofected with AAV plasmids encoding for dual-guide AAVs expressing the CasX:dual-gRNA system in various vector configurations with different spacer combinations of spacer 12.7 or a non-targeting spacer (listed in Table 48). Editing levels at the tdTomato locus were subsequently assessed to determine the difference in editing level achieved and driven by a spacer in a particular orientation and position, and the results are illustrated in
[0747] tdTomato mNPCs were also transduced with dual-guide AAVs expressing the CasX:dual-gRNA system in configurations #1, #2, and #4 (
[0748] The results from these experiments demonstrate that use of gRNAs in different positions and orientations relative to the CasX encoding construct within the AAV transgene can achieve efficient dual-cut editing at the target locus. Furthermore, varying the specific position and orientation of the gRNA unit can affect the editing efficiency.
Example 30: Further Demonstration that Altering the Placement and Orientation of the gRNA Promoter in the CasX:Dual-gRNA System Expressed from an all-In-One AAV Vector Affects Editing of the Target Locus
[0749] Experiments were performed to demonstrate further that placement and orientation of the gRNA promoters within the AAV transgene to drive expression of dual gRNAs can affect the efficiency of the dual-cut editing of a target locus. As discussed in Examples 9 and 31, gRNA promoters may be placed upstream, downstream, or flanking the CasX construct and may be in a forward or reverse orientation. The various configurations of the dual-gRNA transcriptional units relative to the CasX construct within the AAV transgene are illustrated in
Materials and Methods
[0750] AAV plasmid constructs were generated and cloned into a pAAV plasmid flanked with AAV2 ITRs using standard molecular cloning methods as described in Example 1. Briefly, dual-gRNA AAV plasmids were generated to express CasX variant 515 driven by the U1A promoter and two gRNA transcriptional units that each expressed a Pol III U6 promoter-guide scaffold 235-a specific spacer combination (spacer 31.63 targeting the AAVS1 locus and spacer 7.37 targeting the B2M locus). In this example, efforts were made to clone the two gRNA transcriptional units relative to the CasX construct using all 12 configurations (illustrated in
TABLE-US-00053 TABLE 49 Combinations of a B2M-targeting spacer (7.37) and an AAVS1-targeting spacer (31.63) spacer designed using all 12 configurations (FIGS. 38-39, and FIG. 75) of dual gRNA units relative to the CasX 515 construct. The R preceding the spacer denotes the reverse orientation of the transcription of the indicated gRNA unit. Configuration Specific spacer AAV # combination tested construct ID #1 31.63-CasX 515-7.37 299 #2 CasX 515-31.63-7.37 300 #3 CasX 515-31.63-R.7.37 N/A #4 R.31.63-CasX 515-7.37 301 #5 31.63-CasX515-R.7.37 N/A #6 7.37-R.31.63-CasX 515 N/A #7 7.37-31.63-CasX 515 302 #8 R.7.37-R.31.63-CasX 515 303 #9 CasX 515-R.31.63-7.37 N/A #10 CasX 515-R.31.63-R.7.37 304 #11 R.7.37-31.63-CasX 515 N/A #12 R.31.63-CasX 515-R.7.37 N/A
TABLE-US-00054 TABLE 50 Sequences of AAV elements for constructs with varying positions and orientations of gRNA transcriptional units. Note that the table does not contain buffer sequences. Rev comp denotes the reverse complementary sequence. Length of AAV SEQ Component construct ID Component Name ID NO (bp) 299 through 304 5 ITR 17 130 UlA promoter 3722 252 cMyc NLS 9290 27 CasX 515 9352 2934 cMyc NLS 9353 27 bGH poly(A) 3401 208 299 through 302 U6 promoter (Fwd) 3563 241 299 through 302 Scaffold 235 (Fwd) 3638 99 299, 300 AAVS1 Spacer 31.63 (Fwd) 9354 20 299 through 302 B2M Spacer 7.37 (Fwd) 9360 20 301 through 304 U6 promoter (Rev Comp) 3987 241 301 through 304 Scaffold 235 (Rev Comp) 9293 99 301 through 304 AAVSI Spacer 31.63 (Rev 9367 20 Comp) 303, 304 B2M Spacer 7.37 (Rev 9368 20 Comp) 299 through 304 3 ITR 3701 141
TABLE-US-00055 TABLE51 SequencesofAAVelementsforconstructswithsinglegRNAtranscriptional units. DNASequence Lengthof AAVconstructID ComponentName orSEQIDNO Component(bp) 305through307 5ITR 17 130 buffersequence 3684 23 UlApromoter 3722 252 buffersequence 9302 18 Kozak GCCACC 6 CasX515 9352 2934 stopcodon TGA 3 buffersequence 9366 30 bGHpoly(A) 3401 208 buffersequence GGTACCGT 8 U6promoter 3563 241 buffersequence GAAACACC 8 Scaffold235 3638 99 305 AAVS1spacer(31.63) 9354 20 306 B2Mspacer(7.37) 9360 20 307 Non-targetingspacer 9318 20 (0.0) 305through307 buffersequence 3700 17 3ITR 3701 141
AAV Production and Titering:
[0751] The resulting AAV constructs were used to produce AAVs following similar methods as described in Example 18. AAV titering was performed by ddPCR following similar methods as described in Example 31. Two separate primer-probe sets were used for AAV titering by ddPCR: a primer-probe set specific to BGH and another primer-probe set specific to CasX.
AAV Transduction of iNs (Induced Neurons) In Vitro:
[0752] Produced AAVs were used to transduce human iNs to assess editing level at the AAVS1 and B2M loci. AAV transduction of iNs was performed following similar methods as described in Example 32. In one replicate, cells were transduced at the following MOIs: 1.3E4, 4.33E3, or 1.44E3 vg/cell. In the second replicate, cells were transduced at the following MOIs: 1E4, 3E3, or 1E3 vg/cell. The following three constructs were included as experimental controls: 1) a single-guide AAV construct with the AAVS1-targeting spacer (AAV construct ID #305); 2) a single-guide AAV construct with the B2M-targeting spacer (AAV construct ID #306); 3) an AAV construct with a non-targeting spacer (AAV construct ID #307). The results of this experiment are illustrated in
Results
[0753] In this example, dual-guide AAV constructs were designed to harbor each of the 12 configurations shown in
[0754] Human iNs were transduced with AAVs containing the transgene encoding for dual-guide AAVs expressing the CasX:dual-gRNA system in various vector configurations with different spacer combinations of spacer 31.63 and spacer 7.37 (listed in Table 49). Editing levels at the AAVS1 and B2M loci were subsequently assessed to determine the difference in editing level achieved and driven by a spacer in a particular orientation and placement, and the results are illustrated in
[0755] The results from these experiments demonstrate that use of gRNAs in different positions and orientations relative to the CasX encoding construct within the AAV transgene can achieve efficient dual-cut editing at the target locus. Furthermore, varying the specific position and orientation of the gRNA unit can affect AAV production and editing efficiency.
Example 31: Assessment of U6 Isoforms as Alternative Guide RNA Promoters
[0756] Experiments were performed to assess various U6 isoforms as alternative gRNA promoters. Utilization of an alternative U6 gRNA promoter would enable the following: 1) in the context of a dual-guide AAV construct, mitigate the potential for recombination risk during cloning while also maintain a balance in editing levels between the two gRNA transcriptional units; 2) increase overall AAV editing efficiency and potency; and 3) result in the identification of smaller U6 promoter alternatives given the limited capacity of the AAV transgene.
Materials and Methods
[0757] AAV plasmid constructs were generated and cloned into a pAAV plasmid flanked with AAV2 ITRs using standard molecular cloning methods as described in Example 1. Briefly, AAV plasmids were generated to express CasX protein 515 driven by the U1A promoter with a bGH poly(A) signal sequence and a gRNA transcriptional unit that expressed a Pol III promoter-guide scaffold 235 with spacer 31.63 targeting the AAVS1 locus. In this example, various U6 isoforms were assessed as Pol III promoter variants, which were cloned downstream relative to the CasX construct in the AAV plasmid; the sequences of the U6 isoforms tested are shown in Table 52. Table 53 shows the sequences of the constructs encoding for full-length AAV transgene used in this example.
TABLE-US-00056 TABLE 52 Sequences of Pol III promoters assessed in this example. SEQ Pol AAV Length of ID NO: III promoter construct ID Promoter (bp) 3599 hU6 isoform 2 233 249 4743 CpG-depleted hU6 235 249 Isoform 2 4029 CpG-reduced hU6 234 249 Isoform 2 3600 hU6 isoform 3 236 249 3744 CpG-depleted hU6 237 249 Isoform 3 4025 hU6 isoform 4 238 249 4032 CpG-depleted hU6 239 249 Isoform 4 3602 hU6 isoform 5 240 249 3746 CpG-depleted hU6 241 244 Isoform 5 3563 hU6 isoform 1 242 241 3603 mU6 243 304 9351 mU6 with G 244 305
TABLE-US-00057 TABLE53 SequencesofAAVconstructsencodingforthetransgeneusedinthisexample. DNASequence Lengthof AAVconstructID ComponentName orSEQIDNO Component(bp) 233through244 5ITR 17 130 buffersequence 3684 23 UlApromoter 3722 252 buffersequence 9302 18 Kozak GCCACC 6 startcodon ATGGCC 6 c-MYCNLS 9290 27 linker TCTAGA 6 CasX515 9352 2934 linker GGATCC 6 c-MYCNLS 9353 27 stopcodon TAA 3 buffersequence 3695 30 bGHpoly(A) 3401 208 buffersequence GGTACCGT 8 U6promotervariants Seesequences listedin Table52above Scaffold235 3638 99 AAVS1spacer(31.63) 9354 20 buffersequence 3700 17 3ITR 3701 141 *Components are listed in a 5to 3order within the constructs
[0758] AAV production was performed following similar methods as described in Example 1. AAV titering was performed by ddPCR according to standard methods and following the manufacturer's protocol and guidelines. Briefly, ddPCR reactions containing the AAV viral samples were set up, serially diluted, and subjected to droplet formation using the droplet generator. Within each droplet, a PCR amplification reaction was performed using a primer-probe set specific to bGH, an indicator of the AAV transgene. Subsequently, droplet fluorescence was determined using a QX200 Droplet Reader with Bio-Rad QuantaSoft software.
AAV Transduction of iNs (Induced Neurons) In Vitro:
[0759] In a first transduction experiment, 50,000 iNs per well were seeded on Matrigel-coated 96-well plates 7 days prior to transduction. AAVs expressing the CasX:gRNA system, containing various U6 promoters listed in Table 52, were then diluted in neuronal plating media and added to cells. Cells were transduced at two MOIs (1E3 or 3E2 vg/cell). 7 days post-transduction, cells were lifted using lysis buffer, and gDNA was harvested and prepared for editing analysis at the AAVS1 locus using NGS following similar methods as described in Example 18. Samples that were not transduced with AAV were included as controls. Wild-type human U6 (hU6 isoform 1) served as the benchmark for comparison. Two replicates were performed, and the results of this experiment are shown in
[0760] In a second AAV transduction experiment, 50,000 iNs per well were seeded on Matrigel-coated 96-well plates 14 days prior to transduction. Cells were transduced at three MOIs (2E3, 6.67E2, or 2.2E2 vg/cell). Cells were harvested for editing analysis at the AAVS1 locus 7 days post-transduction using NGS following similar methods as described in Example 18. Samples that were not transduced with AAV were included as controls. Wild-type human U6 (hU6 isoform 1) served as the benchmark for comparison. Two replicates were performed, and the results of this experiment are shown in
[0761] In a third AAV transduction experiment, 50,000 iNs per well were seeded on Matrigel-coated 96-well plates 14 days prior to transduction. Cells were transduced at the following MOIs: 3E4, 1E3, 3.33E3, and 1.11E3. Cells were harvested for editing analysis at the AAVS1 locus 7 days post-transduction using NGS following similar methods as described in Example 18. Samples that were not transduced with AAV were included as controls. Wild-type human U6 (hU6 isoform 1) served as the benchmark for comparison. One replicate was performed, and the results of this experiment are shown in
Results
[0762] Three sets of experiments were performed in iNs to assess various U6 isoforms for use as alternative gRNA promoters. The results from the first AAV transduction experiment are portrayed in the bar plots shown in
[0763] The results from the second AAV transduction experiment are portrayed in the bar plots shown in
[0764] The results from the third AAV transduction experiment are portrayed in the bar plots shown in
[0765] These experiments demonstrate that alternative gRNA promoters, such as the various U6 isoforms evaluated in this example (in addition to the promoters identified and tested in Example 5), can be used to drive expression of the gRNA. Use of these alternative gRNA promoters would help reduce recombination risk during AAV production and packaging (especially if utilized in the context of a dual-guide AAV construct), while also modulate the resulting editing activity and potency of the Cas:gRNA system by differentially regulating the activity of the gRNAs. Furthermore, the identification and use of CpG-depleted U6 isoform promoters as alternative gRNA promoters would help mitigate potential undesired immune activation and enable therapeutic efficacy.
Example 32: Assessment of CpG-Depleted CasX 515 Variants on CasX-Mediated Editing
[0766] As discussed in Example 18, unmethylated CpG motifs act as PAMPs (pathogen associated molecular patterns) that potently trigger undesired immune activation. Therefore, experiments were performed to deplete CpG motifs in the AAV construct encoding for CasX protein 515 and demonstrate that these CpG-depleted CasX 515 variants can edit effectively in vitro.
Materials and Methods
Design of CpG-Depleted and Codon-Optimized CasX 515 Variants and AAV Plasmid Cloning:
[0767] Nucleotide substitutions to replace native CpG motifs in CasX protein 515, as well as the flanking c-MYC NLSes, were rationally designed with codon optimization using various publicly available algorithms. As a result, the amino acid sequence of the encoding sequence of CpG-depleted CasX 515 with flanking c-MYC NLSes would be the same as the amino acid sequence of the corresponding encoding sequence of native CasX 515 with flanking c-MYC NLSes. Table 54 provides the sequences of CpG-depleted and codon-optimized variants of CasX 515 with flanking c-MYC NLSes, as well as the corresponding non-CpG depleted CasX 515 with flanking c-MYC NLSes.
TABLE-US-00058 TABLE 54 Sequences of CpG-depleted and codon-optimized variants of CasX 515 with flanking c-MYC NLSes. CpG-depleted or non-CpG-depleted variant 515 with flanking c-MYC NLSes AAV SEQ (version no.) construct ID ID NO CpG-depleted 515 (v1) 290 9369 CpG-depleted 515 (v2) 291 9370 CpG-depleted 515 (v3) 292 9371 CpG-depleted 515 (v4) 293 9372 CpG-depleted 515 (v5) 294 9373 CpG-depleted 515 (v6) 295 9374 CpG-depleted 515 (v7) 296 9375 CpG-depleted 515 (v8) 9376 CpG-depleted 515 (v9) 9377 CpG-depleted 515 (v10) 9378 CpG-depleted 515 (v11) 297 9379 CpG-depleted 515 (v12) 9380 Non-CpG-depleted 515 298 9381
[0768] All resulting sequences of the CpG-depleted and codon-optimized variants of CasX 515 with flanking c-MYC NLSes were cloned into a base AAV plasmid (sequences shown in Table 55). gRNA scaffold 235 and spacer 31.63, which targets the AAVS1 locus, were used for the experiments discussed in this example. The resulting AAV constructs were generated using standard molecular cloning techniques. Cloned and sequence-validated plasmid constructs were midi-prepped for subsequent nucleofection and AAV vector production.
TABLE-US-00059 TABLE55 SequencesencodingforabaseAAVplasmidintowhichCpG-depletedvariants ofCasX515inTable54werecloned. DNASequence Lengthof AAVconstructID ComponentName orSEQIDNO Component(bp) 290through298 5ITR 17 130 buffersequence 3684 23 UIApromoter 3722 252 buffersequence 9302 18 Kozak GCCACC 6 startcodon+CpG- Seesequences depleted(ornon- listedin CpG-depleted)& Table54 codon-optimized CasX515with flankingc-MYC NLSes stopcodon TGA 3 buffersequence 9366 30 bGHpoly(A) 3401 208 buffersequence GGTACCGT 8 U6promoter 3563 241 buffersequence GAAACACC 8 Scaffold235 3638 99 AAVS1spacer 9354 20 (31.63) buffersequence 3700 17 3ITR 3701 141
Transfection of HEK293 Cells In Vitro:
[0769] 50,000 HEK293 cells per well were seeded on 24-well plates; two days later, cells were transfected with AAV plasmids containing sequences for a non-CpG-depleted (CpG.sup.+) CasX 515 (Table 54) or a version 1 of a CpG-depleted and codon-optimized CasX 515 variant (CpG.sup. vi CasX 515; SEQ ID NO: 9369, Table 54) following standard methods using lipofectamine. Two days later, cells were harvested to extract total protein lysate for western blotting analysis. Quantification of protein concentration and western blotting were performed using standard procedures. Three technical replicates were performed (Replicates 1-3) for the western blot. The results of this experiment are shown in
AAV Production and Titering:
[0770] AAV production was performed using similar methods as described in Example 18. AAV titering was performed by ddPCR using a primer-probe set specific to bGH, an indicator of the AAV transgene, following similar methods as described in Example 31.
AAV Transduction of iNs (Induced Neurons) In Vitro:
[0771] For one experiment, 30,000 iNs per well were seeded Matrigel-coated 96-well plates 7 days prior to transduction. Cells were transduced with AAVs expressing the CasX:gRNA system, a non-CpG-depleted CasX 515 (CpG.sup.+; Table 54) or version 1 of the CpG-depleted and codon-optimized CasX 515 variant (CpG.sup. v1; Table 54) and codon-optimized variants of CasX 515, at an MOI of 1E4 vg/cell. 7 days post-transduction, cells were harvested for gDNA extraction for editing analysis at the AAVS1 locus using NGS following similar methods as described in Example 18. One replicate was performed this experiment, and the results are shown in Table 56.
AAV Transduction of HEK293 Cells In Vitro:
[0772] In a second experiment, 5,000 HEK293 cells per well are seeded on 96-well plates two days prior to transduction. AAVs expressing the CasX:gRNA system, containing various CpG-depleted and codon-optimized variants of CasX 515, are diluted in neuronal plating media and added to cells. Cells are transduced at four MOIs (1E4, 3E3, 1E3, or 3.7E2 vg/cell). Five days post-transduction, cells are harvested for gDNA extraction for editing analysis at the AAVS1 locus using NGS following similar methods as described in Example 18.
Results
[0773] In one experiment, HEK293 cells were transiently transfected with AAV plasmids containing a CpG.sup.+ CasX 515 sequence or CpG.sup. v1 CasX 515 sequence. Four days post-transfection, CasX expression and editing activity at the AAVS1 locus were evaluated by western blotting and NGS respectively. The results of the western blotting analysis are portrayed in
TABLE-US-00060 TABLE 56 Results of the editing assay at the AAVS1 locus when using AAV plasmid containing either CpG.sup. or CpG.sup.+ CasX 515. Experimental condition Indel rate at AAVS1 locus AAV plasmid with CpG.sup.+ 515 20.82% AAV plasmid with CpG.sup. 515 (v1) 16.55% No plasmid control 0.06%
[0774] The experiments demonstrate that depleting CpG motifs in the AAV construct encoding for CasX protein 515 resulted in sufficient CasX expression to induce effective editing at the target locus in vitro. Incorporating CpG-depleted AAV elements into the AAV genome would potentially reduce the risk of immunogenicity post-delivery of AAVs into target cells and tissues.
Example 33: Additional Assessment of the Effects of Using CpG-Reduced or Depleted gRNA Scaffolds on CasX-Mediated Editing Activity
[0775] As discussed in Example 18, unmethylated CpG motifs act as PAMPs that potently trigger undesired immune activation; therefore, nucleotide substitutions to replace native CpG motifs in the AAV constructs, including that encoding for guide scaffold variants 235 and 316, were designed and generated. Here, experiments were performed to evaluate further the effects of using these resulting CpG-reduced or depleted gRNA scaffolds on CasX-mediated editing activity.
Materials and Methods
[0776] The CpG-reduced or depleted scaffolds 320-341 were evaluated in three in vitro experiments described below; the sequences of scaffolds 320-341 are listed in Table 38. In addition, two newly engineered gRNA scaffolds, scaffold 382 and 392 (sequences listed in Table 57), were also assessed. As benchmark comparisons, scaffold 174, 235, and 316 (sequences listed in Table 37 and Table 57) were also included for evaluation.
TABLE-US-00061 TABLE 57 Sequences of additional gRNA scaffolds tested in this example. Scaffold ID DNA SEQ ID NO: RNA SEQ ID NO: Scaffold 382 9355 9357 Scaffold 392 9356 9358 Scaffold 174 3631 2238
[0777] AAV constructs were designed and generated as previously described in Example 18. The CpG-reduced or depleted gRNA scaffolds were tested in two different AAV backbones. Specifically, for the experiment involving lipofection of HEK293 cells as described below, scaffolds 235 and 320-341 were tested in AAV vectors that were CpG-depleted, with the exception of AAV2 ITRs, as previously described in Example 18. Briefly, the CpG-depleted AAV backbone construct encoded for CpG-depleted versions of the following elements: U1A promoter, CasX 491, bGH poly(A) signal sequence, and U6 promoter. For the experiment involving AAV transduction of human induced neurons (iNs) and HEK293 cells as described below, scaffolds 174, 235, 316, 320-341, 382, and 392 were tested in an AAV backbone that was not CpG-depleted (see Table 58 for sequences). Furthermore, spacer 7.37 targeting the B2M locus was used in two experiments described below involving HEK293 cells: lipofection and AAV transduction. Spacer 31.63 targeting the AAVS1 locus was used in an experiment described below involving human iNs. Table 59 below lists the AAV constructs that were tested in the context of a non-CpG-depleted AAV vector and the experimental conditions in which these constructs were assessed.
TABLE-US-00062 TABLE58 SequencesencodingforabaseAAVplasmidintowhichgRNAscaffoldsinTable 57werecloned. Lengthof ComponentName DNAsequenceorSEQID Component(bp) 5ITR 17 130 buffersequence 3684 23 U1Apromoter 3722 252 buffersequence 9302 18 Kozak GCCACC 6 startcodon+c-MYCNLS 9359 33 linker TCTAGA 6 CasX515 9352 2934 linker GGATCC 6 c-MYCNLS 9353 27 stopcodon TAA 3 buffersequence 3695 30 bGHpoly(A) 3401 208 buffersequence GGTACCGT 8 U6promoter 3563 241 buffersequence GAAACACC 8 Scaffoldvariants Seesequenceslistedin Tables37,38,and57 B2Mspacer(spacer7.37) 9360 20 AAVS1spacer(spacer 9354 20 31.63) Non-targetingspacer 9318 20 (spacer0.0) buffersequence 3700 17 3ITR 3701 141
TABLE-US-00063 TABLE 59 List of AAV constructs and scaffold variants tested in a non-CpG- depleted AAV vector (see Table 58 for sequences) and the experimental conditions in which these constructs were assessed. AAV Scaffold construct ID variant Spacer Experimental conditions 262 235 31.63 AAV transduction in iNs 263 328 31.63 AAV transduction in iNs 264 329 31.63 AAV transduction in iNs 265 382 31.63 AAV transduction in iNs 266 174 31.63 AAV transduction in iNs 267 335 31.63 AAV transduction in iNs 268 325 31.63 AAV transduction in iNs 269 330 31.63 AAV transduction in iNs 270 327 31.63 AAV transduction in iNs 271 334 31.63 AAV transduction in iNs 272 339 31.63 AAV transduction in iNs 273 337 31.63 AAV transduction in iNs 274 235 Non-targeting AAV transduction in iNs 275 331 7.37 AAV transduction in HEK293s 276 335 7.37 AAV transduction in HEK293s 277 316 7.37 AAV transduction in HEK293s 278 392 7.37 AAV transduction in HEK293s 279 325 7.37 AAV transduction in HEK293s 280 334 7.37 AAV transduction in HEK293s 281 324 7.37 AAV transduction in HEK293s 282 336 7.37 AAV transduction in HEK293s 283 330 7.37 AAV transduction in HEK293s 284 320 7.37 AAV transduction in HEK293s 285 332 7.37 AAV transduction in HEK293s 286 321 7.37 AAV transduction in HEK293s 287 339 7.37 AAV transduction in HEK293s 288 235 7.37 AAV transduction in HEK293s 289 235 Non-targeting AAV transduction in HEK293s
[0778] AAV production was performed using similar methods described in Example 18. For the experiment involving lipofection of HEK293 cells as described below, AAV titering was performed following similar methods as described in Example 1. For the two experiments involving AAV transduction of human iNs or HEK293 cells as described below, AAV titering was performed by ddPCR following similar methods as described in Example 31.
Cell-Based Assays Evaluating the Effects of Using CpG-Depleted or Reduced gRNA Scaffolds on Editing Activity:
[0779] In one experiment, 20,000 HEK293 cells per well were seeded in 96-well plates 24 hours prior to transfection. Seeded cells were then transfected with CpG-depleted AAV plasmids containing various versions of the guide scaffold (scaffolds 320-341). 5 days post transfection, cells were harvested for B2M protein expression analysis via HLA immunostaining following by flow cytometry, following methods as described in Example 18. A CpG-depleted AAV plasmid with scaffold variant 235 served as an experimental control. An AAV plasmid with a CMV promoter driving mCherry expression was used as a transfection control, and a 41% transfection rate was observed. The results from this experiment are shown in
[0780] In a second experiment, 20,000 iNs per well were seeded on Matrigel-coated 96-well plates 7 days prior to transduction. AAVs expressing the CasX:gRNA system, containing various versions of the guide scaffold (AAV construct ID #262-274; see Table 59), were diluted in neuronal plating media and added to cells 7 days post-plating. Cells were transduced at three MOIs (3E4, 1E4 or 3E3 vg/cell). 7 days post-transduction, cells were gDNA extraction for editing analysis at the AAVS1 locus using NGS following similar methods as described in Example 18. The results from this experiment are shown in
[0781] In a third experiment, 10,000 HEK293 cells per well were seeded in 96-well plates 24 hours prior to transfection. Seeded cells were then transduced with AAVs expressing the CasX:gRNA system, containing various versions of the guide scaffold (AAV construct ID #275-289; see Table 59). Cells were transduced at three MOIs (1E4, 3E3, or 1E3 vg/cell). 5 days post-transduction, cells were harvested for B2M protein expression analysis via HLA immunostaining following by flow cytometry, following methods as described in Example 18. The results from this experiment are shown in
Results
[0782] Experiments were performed to evaluate further the effects of using CpG-reduced or depleted gRNA scaffolds on CasX-mediated editing activity. In the first experiment (N=1), HEK293 cells were lipofected with CpG-depleted AAV plasmids containing various versions of the gRNA scaffold (scaffolds 320-341). B2M protein expression was subsequently analyzed, and the results of the assay are shown in
[0783] In the second experiment (N=1), human iNs were transduced with AAV particles expressing the CasX:gRNA system, containing various versions of the guide scaffold (AAV construct ID #262-274). Editing at the AAVS1 locus was analyzed, and the results of the assay are shown in
[0784] In the third experiment (N=1), HEK293 cells were transduced with AAV particles expressing the CasX:gRNA system, containing various versions of the guide scaffold (AAV construct ID #275-289). B2M protein expression was subsequently analyzed, and the results of the assay are shown in
[0785] The results from the experiments described here demonstrate that use of guide scaffolds with different levels of CpG depletion can result in varying levels of editing mediated by the CasX:gRNA system, and that the resulting editing levels can vary by method of delivery (e.g., plasmid transfection vs. AAV transduction).
Example 34: Assessment of Editing by Engineered Variants of CasX Nucleases at a Target Locus in Human Cells Transduced by AAVs
[0786] Experiments were performed to demonstrate that engineered variants of CasX nucleases were able to edit a target locus in human cells when delivered via AAV transduction.
Materials and Methods
[0787] AAV plasmid constructs were generated and cloned into a pAAV plasmid flanked with AAV2 ITRs using standard molecular cloning methods as described in Example 1. Briefly, AAV plasmids were generated to express a CasX protein driven by the UbC promoter with a bGH poly(A) signal sequence and a gRNA transcriptional unit that expressed a Pol III promoter-guide scaffold 235 with spacer 31.63 targeting the AAVS1 locus. In this example, CasX variants 491, 515, 528, 572, 593, 672, 676, and 690 were assessed for their editing activity in human induced neurons (iNs). The sequences of the AAV constructs with the various CasX proteins and AAVS1-targeting gRNA are shown in Table 60.
TABLE-US-00064 TABLE60 SequencesofAAVconstructswithvariousCasXproteinsassessedinthis example. DNAsequenceor Lengthof AAVconstructID ComponentName SEQIDNO Component(bp) 245through252 5ITR 17 130 buffersequence 3684 23 UbCpromoter 3533 400 buffersequence 9302 18 Kozak GCCACC 6 startcodon+c-MYC 9359 33 NLS linker TCTAGA 6 245 CasX491 9291 2931 246 CasX672 3710 2934 247 CasX676 9361 2937 248 CasX528 9362 2934 249 CasX690 9363 2934 250 CasX515 9352 2934 251 CasX572 9364 2934 252 CasX593 9365 2934 245through252 linker GGATCC 6 c-MYCNLS 9353 27 stopcodon TAA 3 buffersequence 3695 30 bGHpoly(A) 3401 208 buffersequence GGTACCGT 8 U6promoter 3563 241 buffersequence GAAACACC 8 Scaffold235 3638 99 AAVS1spacer 9354 20 (31.63) buffersequence 3700 17 3ITR 3701 141 * Components are listed in a 5to 3order within the constructs
[0788] AAV production and titering were performed following similar methods as described in Example 1.
AAV Transduction of iNs (Induced Neurons) In Vitro:
[0789] 50,000 iNs per well were seeded on Matrigel-coated 96-well plates 7 days prior to transduction. AAVs expressing the CasX:gRNA system, containing various CasX proteins (sequences in Table 60), were diluted in neuronal plating media and added to cells. Cells were transduced at three MOIs (3E3, 1E3 or 3E2 vg/cell). 7 days post-transduction, cells were lifted using lysis buffer, and gDNA was harvested and prepared for editing analysis at the AAVS1 locus using NGS following similar methods as described in Example 18.
Results
[0790] Human iNs were transduced with AAVs containing CasX proteins 491, 515, 528, 572, 593, 672, 676, or 690 and guide scaffold variant 235 with spacer 31.63 targeting the safe harbor AAVS1 locus to assess the editing activity of these various CasX proteins. The results of this editing assay are displayed in
[0791] The experiments demonstrate that engineered variants of CasX nucleases, when paired with the appropriate spacer, were able to edit a target locus in human cells when delivered via AAV transduction.
Example 35: Assessment of Various Protein Promoters on CasX Protein Editing Activity
[0792] Experiments were performed to demonstrate that CasX protein editing activity and potency can be influenced by using different protein promoters in an AAV construct to drive expression of the encoded protein. Furthermore, the effects incorporating a WPRE element on editing activity were also evaluated.
Materials and Methods
[0793] AAV plasmid constructs were generated and cloned into a pAAV plasmid flanked with AAV2 ITRs using standard molecular cloning methods as described in Example 1. Briefly, AAV plasmids were generated to express CasX 491 driven by a protein promoter variant with a bGH poly(A) signal sequence and a gRNA transcriptional unit that expressed a Pol III promoter-guide scaffold 235 with spacer 31.63 targeting the AAVS1 locus. Three protein promoters were assessed in this example: U1A, Jet, and UbC, which were cloned upstream of the construct encoding for CasX 491. Each protein promoter variant was also assessed with or without a WPRE element (WPRE2 or WPRE3). For constructs with a WPRE element, the WPRE element was cloned downstream of the construct encoding for CasX 491. Sequences for the three protein promoters and two WPRE elements are listed in Table 61. The specific combinations of protein promoter and WPRE elements with the corresponding AAV construct IDs are listed in Table 62.
TABLE-US-00065 TABLE 61 Sequences of protein promoter variants and WPRE elements assessed in this example. SEQ AAV Length of ID NO Element construct ID element (bp) 3533 UbC protein promoter 253, 254, 255 400 3556 Jet protein promoter 256, 257, 258 164 3722 U1A protein promoter 259, 260, 261 252 3616 WPRE2 253, 256, 259 593 3617 WPRE3 254, 257, 260 247
TABLE-US-00066 TABLE 62 Combination of protein promoter and WPRE elements assessed in this example. AAV construct ID Protein promoter WPRE element 253 UbC WPRE2 254 UbC WPRE3 255 UbC N/A 256 Jet WPRE2 257 Jet WPRE3 258 Jet N/A 259 U1A WPRE2 260 U1A WPRE3 261 U1A N/A
[0794] AAV production and titering were performed following similar methods as described in Example 1.
AAV Transduction of iNs (Induced Neurons) In Vitro:
[0795] 50,000 iNs per well were seeded on Matrigel-coated 96-well plates 24 hours prior to transduction. AAVs expressing the CasX:gRNA system, containing various protein promoter variants with or without a WPRE element, were diluted in neuronal plating media and added to cells. Cells were transduced at two MOIs (1E3 or 1E4 vg/cell). 7 days post-transduction, cells were lifted using lysis buffer, and gDNA was harvested and prepared for editing analysis at the AAVS1 locus using NGS following similar methods as described in Example 18.
Results
[0796] The effects of using different protein promoters (U1A, Jet, and UbC), with or without a WPRE element, on editing activity were evaluated. The results of this editing assay are shown in
[0797] The experiments demonstrate that the editing activity of CasX proteins can be modulated by protein promoter choice; here, of the three protein promoters assessed, use of the U1A promoter resulted in the highest level of CasX editing activity.
Example 36: CasX:gRNA In Vitro Cleavage Assays
[0798] Experiments were performed to assess in vitro DNA cleavage by CasX:gRNA ribonucleoproteins (RNPs).
Materials and Methods
Assembly of RNP
[0799] RNPs of either CasX variant 119 (SEQ ID NO: 124), CasX variant 491 (SEQ ID NO: 190), CasX variant 515 (SEQ ID NO: 197), or CasX variant 812 (SEQ ID NO: 484) were assembled with single guide RNAs (sgRNA) with scaffold 316 (SEQ ID NO: 9588) and one of two spacers, as described in detail below. Separately, RNPs of CasX variant 515 were assembled with sgRNA with either scaffold 2 (SEQ ID NO: 5), 174 (SEQ ID NO: 2238), 235 (SEQ ID NO: 2292), or 316 (SEQ ID NO: 9588) and one of two spacers.
[0800] Purified RNP of CasX variants and sgRNA were prepared same-day prior to experiments. For experiments where protein variants were being compared, the CasX protein was incubated with sgRNA at 1:1.2 molar ratio. When scaffolds were compared, the protein was added in 1.2:1 ratio to guide. Briefly, sgRNA was added to Buffer #1 (20 mM Tris HCl pH 7.5, 150 mM NaCl, 1 mM TCEP, 5% glycerol, 10 mM MgCl.sub.2) on ice, then CasX was added to the sgRNA solution, slowly with swirling, and immediately incubated at 37 C. for 20 minutes to form RNP complexes. RNP complexes were centrifuged at 4 C. for 5 minutes at 16,000g to remove any precipitate. Formation of competent (active) RNP was assessed as described below.
In Vitro Cleavage Assays
[0801] The ability of CasX variants to form active RNP compared to a CasX variant 119 was determined using an in vitro cleavage assay. The beta-2 microglobulin (B2M) 7.9 and 7.37 target for the cleavage assay was created as follows. DNA oligos (sequences in Table 63) were generated with 5 terminal amino modification for conjugation to Cy-dyes with an amino-reactive handle (N-hydroxysuccinimide). Oligo-dye conjugation reactions of 100 uM oligo and 1 mM dye were performed in 100 mM sodium borate pH 8.3 at 4 C. for 16 h. Target strands (TS) were labeled with Cy5.5 and non-targeting strands (NTS) were labeled with Cy7.5. After quenching the reactions with 1 mM Tris pH 7.5, the conjugated oligos were purified via ethanol precipitation. Double-stranded DNA (dsDNA) targets were formed by mixing the oligos in a 1:1 ratio in 1 hybridization buffer (20 mM Tris HCl pH 7.5, 100 mM KCl, 5 mM MgCl.sub.2), heating to 95 C. for 10 minutes, and allowing the solution to cool to room temperature.
TABLE-US-00067 TABLE63 DNAsequencesanddescriptionsoftargetDNAs DNASequence(5-3)* SEQIDNO: Description /5AmMC6/TGAAGCTGACAGCATTCGGGCCGAGA 9591 7.37NTSwith5amineforNHSester TGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCT linkages** /5AmMC6/AGCGCGAGCACAGCTAAGGCCACGGA 9592 7.37TSwith5amine** GCGAGACATCTCGGCCCGAATGCTGTCAGCTTCA /5AmMC6/TGAAGCTGACAGCATTCGGGCCTAGA 9593 7.37gelprobeNTS,mismatchat5 TGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCT /5AmMC6/AGCGCGAGCACAGCTAAGGCCACGGA 9594 7.37gelprobeTS,mismatchat5 GCGAGACATCTAGGCCCGAATGCTGTCAGCTTCA /5AmMC6/TGAAGCTGACAGCATTCGGGCCGAGA 9595 7.37gelprobeNTS,mismatchat10 TATCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCT /5AmMC6/AGCGCGAGCACAGCTAAGGCCACGGA 9596 7.37gelprobeTS,mismatchat10 GCGAGATATCTCGGCCCGAATGCTGTCAGCTTCA /5AmMC6/TGAAGCTGACAGCATTCGGGCCGAGA 9597 7.37gelprobeNTS,mismatchat15 TGTCTCGATCCGTGGCCTTAGCTGTGCTCGCGCT /5AmMC6/AGCGCGAGCACAGCTAAGGCCACGGA 9598 7.37gelprobeTS,mismatchat15 TCGAGACATCTCGGCCCGAATGCTGTCAGCTTCA /5AmMC6/CTTTCAGCAAGGACTGGTCTTTCTAT 9599 7.9targetTS CTCTTGTACTACACTGAATTCACCCCCACTGAAA /5AmMC6/TTTCAGTGGGGGTGAATTCAGTGTAG 9600 7.9targetNTS TACAAGAGATAGAAAGACCAGTCCTTGCTGAAAG /5AmMC6/CTTTCAGCAAGGACTGGTCTTTCTAT 9601 7.9gelprobeTS,mismatchat5 CTCTTGTACGACACTGAATTCACCCCCACTGAAA /5AmMC6/TTTCAGTGGGGGTGAATTCAGTGTCG 9602 7.9gelprobeNTS,mismatchat5 TACAAGAGATAGAAAGACCAGTCCTTGCTGAAAG /5AmMC6/CTTTCAGCAAGGACTGGTCTTTCTAT 9603 7.9gelprobeTS,mismatchat10 CTCTCGTACTACACTGAATTCACCCCCACTGAAA /5AmMC6/TTTCAGTGGGGGTGAATTCAGTGTAG 9604 7.9gelprobeNTS,mismatchat10 TACGAGAGATAGAAAGACCAGTCCTTGCTGAAAG /5AmMC6/CTTTCAGCAAGGACTGGTCTTTCTGT 9605 7.9gelprobeTS,mismatchat15 CTCTTGTACTACACTGAATTCACCCCCACTGAAA /5AmMC6/TTTCAGTGGGGGTGAATTCAGTGTAG 9606 7.9gelprobeNTS,mismatchat15 TACAAGAGACAGAAAGACCAGTCCTTGCTGAAAG *5AmMC6 indicates the 5Amino Modifier C6. The target sequences are underlined. **The Kcleave assay using the mismatched position 5 dsDNA target was run at 37C.
Determining Cleavage-Competent Fractions for RNPs
[0802] Cleavage reactions were prepared with final RNP concentrations of 100 nM and final target concentration of 100 nM. Reactions were carried out at 37 C. and initiated by the addition of the dye-labeled dsDNA target. Aliquots were taken at 5, 30, and 60 minutes and quenched by adding to 9500 formamide, 25 mM EDTA. Samples were denatured by heating at 95 C. for 10 minutes and run on a 1000 urea-PAGE gel. The gels were imaged with a Cytiva Typhoon and quantified using the Cytiva IQTL software.
Kcleave Assay
[0803] Cleavage reactions were set up with a final RNP concentration of 200 nM and a final target concentration of 10 nM. Reactions were carried out at 16 C., except where otherwise noted, and initiated by the addition of the target DNA. Aliquots were taken at 15, 30, 60, 120, 180, 240, and 480 seconds, and quenched by adding to 9500 formamide, 25 mM EDTA. Samples were denatured by heating at 95 C. for 10 minutes and run on a 10o urea-PAGE gel. The gels were imaged with a Cytiva Typhoon and quantified using the Cytiva IQTL software. The apparent first-order rate constant of non-target strand cleavage (k.sub.cleave) was determined for each CasX:sgRNA combination replicate individually.
[0804] To test the relative specificities of engineered proteins in vitro, apparent cleavage rate constants were compared for targets with mismatched bases at various positions (5, 10, and 15 nt downstream of PAM, Table 63). Cleavage assays were performed in large excess of RNP (200 nM RNP and 1 nM target dsDNA) at 16 C., with the exception of assays measuring cleavage of the target with a mismatch at 5 nt, which were conducted at 37 C. in order to observe measurable cleavage rates. Aliquots were taken at 15, 30, 60, 120, 180, 240, and 480 seconds, and quenched by adding to 95% formamide, 25 mM EDTA. Samples were denatured by heating at 95 C. for 10 minutes and run on a 10% urea-PAGE gel. The gels were imaged with a Cytiva Typhoon and quantified using the Cytiva IQTL software. The apparent first-order rate constant of non-target strand cleavage (k.sub.cleave) was determined for each CasX:sgRNA combination replicate individually.
Results
Determining Cleavage-Competent Fractions for Protein Variants Compared to CasX Variant 119
[0805] To determine the cleavage-competent fraction for the tested CasX variants, it was assumed that CasX acts essentially as a single-turnover enzyme under the assayed conditions, as indicated by the observation that sub-stoichiometric amounts of enzyme fail to cleave a greater-than-stoichiometric amount of target even under extended time-scales and instead approach a plateau that scales with the amount of enzyme present. Thus, the fraction of target cleaved over long time-scales by an equimolar amount of RNP is indicative of what fraction of the RNP is properly formed and active for cleavage. Thus, the active (competent) fraction for each RNP was derived from the cleaved fraction over the total signal at the 60-minute timepoint, upon confirming an increase in cleaved fraction from the 5-minute timepoint, and relative plateau in cleaved fraction from the 30-minute timepoint.
[0806] Apparent competent fractions were determined for the RNPs with various CasX variants and are provided in Table 64.
TABLE-US-00068 TABLE 64 Protein variant RNP comparison of fraction competence and Kcleave rates Kcleave (sec.sup.1) On- Position 15 Position 10 Position 5 RNP Fraction competence* target mismatch mismatch mismatch (CasX.Scaffold.Spacer) (mean stdev) spacer spacer spacer spacer** 119.174.7.9 26.71 9.65% 0.0292 0.0158 0.0047 0.0127 491.174.7.9 49.23 6.37% 0.0966 0.0552 0.03 0.0616 515.174.7.9 30.15 3.58% 0.0782 0.0625 0.0324 0.0392 812.174.7.9 53.28 5.14% 0.0909 0.0512 0.0142 0.01 119.174.7.37 29.01 2.67% 0.0022 0.0061 0.0028 0.0034 491.174.7.37 48.73 5.44% 0.0425 0.015 0.0297 0.0301 515.174.7.37 43.54 16.19% 0.0396 0.0127 0.0297 0.0347 812.174.7.37 38.23 2.49% 0.027 0.0111 0.0119 0.014 *Active fraction was calculated by averaging three experimental replicates. **The Kcleave assay using the mismatched position 5 dsDNA target was run at 37 C.
[0807] For protein variant comparison, the following CasX variants were used with guide scaffold 316 and spacer 7.9 or guide 316 and spacer 7.37: CasX variant 119, CasX variant 491, CasX variant 515, and CasX variant 812. CasX variant 119 had the lowest active fraction for both spacers, indicating that CasX variant 491, CasX variant 515, and CasX variant 812 form more active and stable RNP with the identical guides under the tested conditions as compared to CasX variant 119. CasX variants 491, 515, and 812 did not show consistent trends in their competent fractions across the two spacers, consistent with the expectation that the additional engineering following CasX 491 primarily affects target engagement and cleavage, rather than guide binding or stability.
Kcleave Assay to Understand Specificity of RNPs Formed from CasX Variants
[0808] Assays were performed to measure the apparent first-order rate constant of non-target strand cleavage (k.sub.cleave), and the results are presented in Table 64, above. A drastic effect on the kinetics of CasX variant 812 RNP cleavage was observed for on-target versus the mismatched dsDNA target for both spacers. CasX variant 812 had comparable on-target cleavage rates to CasX variant 491 and CasX variant 515 for both spacers, with a slightly higher cleavage rate than CasX variant 515 on spacer 7.9, which might be explained by the lower competent fraction observed for the CasX variant 515 RNP with that spacer, and a lower cleavage rate on 7.37.
[0809] The off-target rates for CasX variant 812 were much more substantially reduced for most of the mismatched substrates. The difference in kcleave rates was readily apparent for the target with a mismatch at position 10, with 812 having a roughly 6-fold (7.9) and 2-fold (7.37) reduction in cleavage rate, as compared to its on-target rate. CasX variant 515, by comparison, exhibited a 2.4-fold and a 25% reduction on the same targets. A substantial difference was also observed for the position 5 mismatch targets. Even though the assay was run at 37 C. to enable measurable cleavage rates, as the position 5 mismatch targets were essentially uncleaved by the CasX RNPs at the lower temperature used for the other targets, CasX variant 812 against spacer 7.9 exhibited a 9-fold reduction in cleavage rate from on-target rate run at 16 C. and a 2-fold reduction for the 7.37 spacer with a position 5 mismatch. CasX variant 515 showed a 2-fold reduction for mismatched 7.9 and a nearly equivalent cleavage rate for 7.37 with the position 5 mismatch (note that the equivalent cleavage rate is due to the increased temperature).
[0810] For the position 15 mismatch substrate, CasX variant 812 exhibited modest reductions in cleavage rates relative to on-target rates, comparable to the reduction observed for 515. This suggests that the increased sensitivity of CasX variant 812 to mismatches declines by the PAM distal region, at least for the specific mismatches and spacers tested here. The increased sensitivity at positions 5 and 10 in particular correlates with the position of the G329K mutation present in CasX variant 812. This mutation introduces a positive charge near the RNA spacer around position 8 and may help CasX to better read out distortions caused by mismatches. Mismatches closer to this new site of contact would be more likely to significantly disrupt either R-loop propagation or allosteric activation of the RuvC (depending on the precise mechanism of increased specificity), while mismatches farther away (as in the position 15 mismatch) might have more variable effects depending on the nature of the mismatch and its effects on the broader heteroduplex structure. Taken together, these data confirm that CasX variant 812 is inherently more sensitive to mismatches between the RNA spacer and the DNA target and is not simply a less active enzyme, as the decrease in cleavage rate at mismatched targets is in excess of the decrease in cleavage rate at properly matched targets. This is consistent with the results in Examples 37 and 38 that indicate that CasX variant 812 is a highly specific enzyme, with lower off-target editing compared to the other nucleases tested.
Determining Cleavage-Competent Fractions for Single Guide Variants Relative to Reference Single Guide 2
[0811] RNPs were complexed using the aforementioned methods. To isolate the effect of sgRNA identity on RNP formation, guide-limiting conditions were employed. sgRNAs with scaffolds 2, 174, 235, or 316 with spacers 7.9 or 7.37 were mixed with CasX variant 515 at final concentrations of 1 M for the guide and 1.2 M for the protein. Fraction competence was calculated as described above, and the results are provided in Table 65.
TABLE-US-00069 TABLE 65 Guide variant RNP comparison of fraction competence and Kcleave assay RNP construct Competent fraction Kcleave (CasX.Scaffold.Spacer) (mean stdev) (sec.sup.1) 515.2.7.9 28.146.87% 0.1346 0.0118 515.174.7.9 42.779.62% 0.1723 0.0046 515.235.7.9 34.111.15% 0.1696 0.0571 515.316.7.9 30.896.87% 0.1413 0.0301 515.2.7.37 10.422.24% 0.0204 0.0002 515.174.7.37 19.962.88% 0.0534 0.0200 515.235.7.37 32.6411.60% 0.0647 0.0163 515.316.7.37 26.9811.08% 0.0851 0.0071 * active fraction was calculated by averaging two experimental replicates
[0812] Given the complex folding structure of the CasX guide, fraction competence is expected to largely be determined by how much of the guide is properly folded for interaction with the protein. All guides with engineered scaffolds showed improvements over scaffold 2, but guides with scaffold 235 or 316 showed improvements relative to 174 for spacer 7.37. This is consistent with the introduction of mutations in the pseudoknot and triplex that are expected to stabilize the properly folded form.
[0813] Higher competent fractions of all guides were observed for spacer 7.9. For this spacer, scaffold 174 had the highest competent fraction, followed by scaffolds 316, 235, and 2. Proper guide folding is expected to be highly dependent on the potential for undesired interactions between the scaffold and spacer sequences, so the observed differences may be attributable to differential sequence-specific interactions, variations in prep quality, or noise in the assay.
Determining k.sub.Cleave for Single Guide Variants Compared to Reference Scaffold 2
[0814] Cleavage assays were performed with CasX variant 515 and guides with reference scaffold 2 compared to guides with scaffolds 174, 235, or 316 with spacer 7.9 or 7.37 to determine relative cleavage rates. The mean and standard deviation of three replicates with independent fits are presented in Table 65, above.
[0815] To reduce cleavage kinetics to a range measurable with the assay, the cleavage reactions were incubated at 16 C. Under these conditions, all guides supported faster cleavage rates as compared to scaffold 2. For spacer 7.37, the cleavage kinetics aligned with those guides that contributed to the highest fraction competence, with the highest cleavage rate being sg174 (0.1723 s.sup.1), followed by scaffold 235 (0.1696 s.sup.1) and scaffold 316 (0.1413 s.sup.1), versus scaffold 2 (0.1346 s.sup.1). For spacer 7.9, scaffold 316 yielded the highest cleavage rate (0.0851 s.sup.1), followed by scaffold 235 (0.0647 s.sup.1) and sg174 (0.0534 s.sup.1), versus scaffold 2 (0.0204 s.sup.1). The fraction competence and k.sub.cleave data did not demonstrate differences across the engineered variants that were consistent across both spacers, although all are consistently better than scaffold 2. This suggests that the improvements seen for scaffold 235 and 316 over 174 are primarily due to behavior in the cell, whether it be stability in the cytoplasm, folding in the cytoplasm, transcription when delivered via plasmid or AAV, or refolding ability when delivered via LNP, that are not captured by guides that have been in vitro transcribed, refolded, and tested for cleavage biochemically.
Example 37: Identification of CasX Variants with Enhanced Activity or Specificity Relative to CasX Variant 515
[0816] An experiment was performed to identify CasX variants with single mutations and increased editing activity or improved specificity relative to CasX variant 515.
Materials and Methods
[0817] A multiplexed pooled approach was taken to assay clonal proteins derived from CasX variant 515 using a pooled activity and specificity (PASS) assay. A pooled HEK cell line, which was adapted to suspension culture from adherent cells, was generated and termed PASS_V1.03. Methods to complete the production of the PASS_V1.03 line were previously described in International Publication No. WO2022120095A1, incorporated herein by reference.
[0818] CasX variants were expressed using a relatively weakly-expressing promoter to reduce CasX protein expression and thereby improve the sensitivity of the assay. Samples were tested in quadruplicate. The list of CasX variants tested and their mutations relative to CasX variant 515 is provided in Tables 66 and 67, below. All of the tested CasX variants had single mutations (i.e., a single amino acid substitution, deletion, or insertion) relative to CasX variant 515, except for CasX variant 676, which has three mutations relative to CasX variant 515. Streptococcus pyogenes Cas9 without a guide RNA served as a negative control.
[0819] To assess the editing activity and specificity of the tested CasX variants at human target sites, two sets of target sites were quantified. First, editing was quantified at TTC PAM on-target sites in which the twenty nucleotides of each gRNA spacer targeting these on-target sites were perfectly complementary to the target site. For each sample and spacer-target pair, data based on <500 reads were removed. Fraction indel values for each sample and spacer-target pair were subtracted by the average fraction indel value across Cas9-treated samples with the same spacer-target pair; Cas9 served as a negative control due to the absence of a compatible guide RNA. Second, editing was quantified at TTC PAM off-target sites, in which one of the twenty nucleotides of the spacer was mismatched with the target site. As above, for each sample and spacer-target pair, data based on <500 reads were removed, and fraction indel values for each sample and spacer-target pair were subtracted by the average fraction indel value across Cas9-treated samples with the same spacer-target pair. Finally, for those TTC PAM spacer-target pairs that had both an on-target and an off-target version, the average editing activity and standard error of the mean (SEM) were calculated.
Results
[0820] Table 66 provides the level of on-target editing produced by various CasX variants with mutations relative to CasX variant 515, ranked from highest to lowest activity.
TABLE-US-00070 TABLE 66 Average on-targeting editing activity, ranked from highest to lowest Protein Designation Mutation relative to Average on-target TTC SEM on-target TTC (CasX variant no., CasX 515* PAM editing activity PAM editing activity or Cas9) (Position.Reference.Alternative) (fraction) (fraction) 607 398.Y.T 2.72E01 4.08E02 532 27..R 2.59E01 3.34E02 676 27..R & 170.L.K & 2.36E01 3.42E02 224.G.S 592 304.M.T 2.19E01 3.73E02 788 891.S.Q 2.18E01 3.43E02 583 169.L.K 2.17E01 3.66E02 555 171.A.D 2.14E01 3.73E02 515 2.09E01 3.82E02 569 9.K.G 2.08E01 3.12E02 787 826.V.M 2.07E01 3.45E02 561 5..G 1.98E01 3.41E02 577 64.R.Q 1.94E01 3.48E02 585 171.A.S 1.94E01 3.40E02 572 35.R.P 1.89E01 3.95E02 536 224.G.T 1.88E01 3.43E02 656 887.T.D 1.87E01 3.34E02 559 4.I.G 1.87E01 3.22E02 777 169.L.Q 1.84E01 3.36E02 584 171.A.Y 1.83E01 3.66E02 779 372.G.I 1.79E01 3.15E02 566 7.I.A 1.77E01 3.37E02 638 481.E.D 1.77E01 3.37E02 593 304.M.W 1.76E01 3.35E02 568 8.N.S 1.76E01 3.34E02 562 5.K.G 1.74E01 3.04E02 564 6..G 1.73E01 3.32E02 757 796.K.Q 1.73E01 2.94E02 654 772.M.S 1.70E01 3.18E02 760 797.T.V 1.70E01 3.12E02 818 698.S.R 1.67E01 3.31E02 646 653..T 1.66E01 3.06E02 784 570.P.I 1.65E01 2.64E02 762 793..P 1.64E01 2.99E02 789 917.G.E 1.61E01 2.91E02 649 655..S 1.58E01 3.13E02 594 329.G.N 1.56E01 3.26E02 604 342..A 1.55E01 2.87E02 612 412.G.P 1.55E01 2.81E02 644 593.Q.V 1.52E01 2.97E02 736 794.P.A 1.52E01 2.85E02 790 951..S 1.51E01 2.87E02 780 389..V 1.49E01 3.02E02 717 390.K.Q 1.43E01 2.84E02 633 473..D 1.41E01 2.71E02 590 289.K.S 1.40E01 2.92E02 657 893..N 1.39E01 2.96E02 643 593.Q.F 1.38E01 2.80E02 544 232.D.G 1.37E01 3.19E02 591 292.V.L 1.37E01 2.76E02 534 224.G.H 1.36E01 2.24E02 791 953..K 1.34E01 2.60E02 781 390.K.E 1.33E01 2.71E02 718 7.I.L 1.32E01 2.85E02 812 329.G.K 1.29E01 2.97E02 609 405.L.N 1.26E01 2.57E02 758 791.E.N 1.24E01 2.33E02 616 414..Y 1.22E01 2.44E02 632 469.L.S 1.22E01 2.79E02 614 414..R 1.18E01 2.32E02 721 156.F.V 1.14E01 2.48E02 611 408.E.Y 1.11E01 2.08E02 622 420.D.G 1.07E01 2.41E02 610 405.L.W 1.06E01 2.21E02 619 417.K.D 1.05E01 2.59E02 580 86.W.D 1.00E01 2.22E02 602 339..Q 9.82E02 2.53E02 537 224.G.A 9.21E02 2.34E02 587 224.G. 8.18E02 2.19E02 538 224.G.V 7.16E02 2.16E02 702 91.K.V 6.31E02 1.93E02 824 611.K.Q 4.07E02 1.23E02 631 469.L.K 3.01E02 1.30E02 573 53.E.P 2.65E02 1.11E02 528 224.G.Y 8.98E03 7.97E03 535 224.G.S 7.92E03 7.31E03 Cas9 n/a 7.17E03 8.11E03 *Positions of mutations are shown relative to a CasX 515 sequence with an N-terminal methionine residue (SEQ ID NO: 9590). Each mutation is indicated by its position, reference sequence, and alt sequence, separated by . Insertions are indicated with a in the reference sequence (first position), and deletions with a in the alt sequence (second position). Multiple individual mutations are separated by &.
[0821] As shown in Table 66, CasX variants 607, 532, 676, 592, 788, 583, and 555 produced higher levels of on-target editing than did CasX variant 515. CasX variants 569, 787, 561, 577, 585, and 572 also produced relatively high levels of on-target editing, with at least 9000 of the activity of CasX variant 515 (i.e., greater than 1.88E-01 on-target editing).
[0822] Table 67 provides the level of off-target editing produced by various CasX variants with mutations relative to CasX variant 515, ranked from lowest to highest activity.
TABLE-US-00071 TABLE 67 Average off-targeting editing activity, ranked from lowest to highest Protein Designation Mutation relative to Average off-target TTC SEM off-target TTC (CasX variant no., CasX 515* PAM editing activity PAM editing activity or Cas9) (Position.Reference.Alternative) (fraction) (fraction) 528 224.G.Y 1.73E03 1.84E03 Cas9 n/a 2.18E03 2.72E03 535 224.G.S 2.33E03 2.63E03 573 53.E.P 5.01E03 3.29E03 824 611.K.Q 5.86E03 2.93E03 631 469.L.K 6.23E03 3.45E03 587 224.G. 1.15E02 4.68E03 538 224.G.V 1.45E02 7.45E03 702 91.K.V 1.52E02 6.87E03 812 329.G.K 1.58E02 7.16E03 580 86.W.D 1.78E02 6.27E03 619 417.K.D 1.94E02 6.80E03 610 405.L.W 2.08E02 6.80E03 758 791.E.N 2.11E02 7.51E03 721 156.F.V 2.12E02 6.94E03 591 292.V.L 2.15E02 7.81E03 537 224.G.A 2.18E02 8.82E03 590 289.K.S 2.28E02 8.23E03 622 420.D.G 2.30E02 7.70E03 632 469.L.S 2.34E02 7.92E03 633 473..D 2.36E02 8.67E03 614 414..R 2.38E02 7.57E03 594 329.G.N 2.41E02 9.14E03 643 593.Q.F 2.46E02 8.93E03 609 405.L.N 2.47E02 8.24E03 781 390.K.E 2.48E02 8.34E03 616 414..Y 2.48E02 7.29E03 602 339..Q 2.55E02 9.70E03 791 953..K 2.71E02 7.83E03 593 304.M.W 2.87E02 1.04E02 644 593.Q.V 2.88E02 9.11E03 657 893..N 2.89E02 1.02E02 717 390.K.Q 2.99E02 1.00E02 611 408.E.Y 3.00E02 8.86E03 572 35.R.P 3.06E02 1.07E02 780 389..V 3.07E02 9.83E03 818 698.S.R 3.15E02 1.02E02 638 481.E.D 3.16E02 1.01E02 584 171.A.Y 3.39E02 1.07E02 790 951..S 3.47E02 1.02E02 718 7.I.L 3.47E02 1.06E02 649 655..S 3.54E02 1.09E02 562 5.K.G 3.56E02 1.09E02 784 570.P.I 3.60E02 9.80E03 736 794.P.A 3.61E02 1.03E02 789 917.G.E 3.63E02 1.11E02 544 232.D.G 3.64E02 1.15E02 612 412.G.P 3.64E02 1.12E02 604 342..A 3.66E02 1.11E02 564 6..G 3.67E02 1.07E02 568 8.N.S 3.91E02 1.15E02 779 372.G.I 3.98E02 1.20E02 760 797.T.V 3.99E02 1.09E02 777 169.L.Q 4.11E02 1.16E02 566 7.I.A 4.20E02 1.15E02 569 9.K.G 4.29E02 1.03E02 577 64.R.Q 4.38E02 1.28E02 536 224.G.T 4.44E02 1.32E02 656 887.T.D 4.54E02 1.22E02 646 653..T 4.56E02 1.21E02 757 796.K.Q 4.60E02 1.25E02 559 4.I.G 4.71E02 1.19E02 585 171.A.S 4.73E02 1.24E02 515 4.85E02 1.33E02 762 793..P 4.91E02 1.25E02 561 5..G 4.92E02 1.37E02 788 891.S.Q 5.50E02 1.45E02 555 171.A.D 5.53E02 1.52E02 787 826.V.M 5.68E02 1.33E02 654 772.M.S 5.84E02 1.61E02 583 169.L.K 5.95E02 1.48E02 592 304.M.T 5.97E02 1.48E02 534 224.G.H 6.37E02 1.52E02 676 27..R + 170.L.K + 7.13E02 1.68E02 224.G.S 607 398.Y.T 8.25E02 1.82E02 532 27..R 8.70E02 1.73E02 *Positions of mutations are shown relative to a CasX 515 sequence with an N-terminal methionine residue (SEQ ID NO: 9590). Each mutation is indicated by its position, reference sequence, and alt sequence, separated by . Insertions are indicated with a in the reference sequence (first position), and deletions with a in the alt sequence (second position). Multiple individual mutations are separated by &.
[0823] As shown in Table 67, many of the tested CasX variants showed lower levels of off-target editing than did CasX variant 515. For example, consistent with previous results, CasX variant 812 produced relatively low levels of off-target editing. Further, some of the tested CasX proteins showed even lower levels of off-target editing than did CasX variant 812 (specifically, CasX variants 528, 535, 573, 824, 631, 587, 538, and 702).
[0824] Based on these results, a set of mutation conferring a high degree of editing activity and/or specificity was chosen for introducing in pairs into CasX variant 515. First, high activity mutations were defined as those that showed a level of on-target editing equal to at least 87.3% of the level of on-target editing by CasX variant 515. CasX variants 607, 532, 676, 592, 788, 583, 555, 569, 787, 561, 577, 585, 572, 536, 656, 559, 777, and 584 met this threshold, and were therefore selected as potential activity-enhancing mutations (see Table 68). Second, high specificity mutations were defined as those producing 80% or lower of the level of off-target editing produced by CasX variant 515, while maintaining at least 79.95% of the on-target editing activity of CasX variant 515. This 80% on-target editing activity requirement was implemented to avoid selecting mutations that were simply loss-of-function mutations and would therefore not be expected to be useful as gene editors. CasX variants 593, 572, 818, 638, 584, 562, and 784 met these criteria, and were therefore selected as potential specificity-enhancing mutations (see Table 68).
[0825] In total, 22 individual mutations were chosen as candidates for introducing in pairs into CasX variant 515 and testing for improved properties, as described in Example 38, below. The positions of the individual mutations relative to full-length CasX variant 515, as well as amino acid sequences of full-length CasX variants with the individual mutations, are provided in Table 68. Table 69, below, shows the amino acid sequences and coordinates of the domains of CasX variant 515, and Table 70 shows the positions of the 22 individual mutations within the domains of CasX variant 515, as well as the amino acid sequences of domains with each individual mutations.
TABLE-US-00072 TABLE 68 Summary of positions of single mutations within the CasX 515 variant Mutation relative Full-length CasX CasX to CasX 515* variant amino variant (Position. Reference. acid sequence no. Phenotype Alternative) (SEQ ID NO) 532 Activity 27.-.R 213 536 Activity 224.G.T 217 555 Activity 171.A.D 235 559 Activity 4.I.G 239 561 Activity 5.-.G 241 562 Specificity 5.K.G 242 564 Specificity 6.-.G 244 569 Activity 9.K.G 249 572 Activity (and 35.R.P 252 specificity) 577 Activity 64.R.Q 257 583 Activity 169.L.K 263 584 Activity (and 171.A.Y 264 specificity) 585 Activity 171.A.S 265 592 Activity 304.M.T 272 593 Specificity 304.M.W 273 607 Activity 398.Y.T 287 638 Specificity 481.E.D 318 656 Activity 887.T.D 336 777 Activity 169.L.Q 450 787 Activity 826.V.M 460 788 Activity 891.S.Q 461 818 Specificity 698.S.R 490 *Positions of mutations are shown relative to a CasX 515 sequence with an N-terminal methionine residue (SEQ ID NO: 9590). Each mutation is indicated by its position, reference sequence, and alt sequence, separated by . Insertions are indicated with a - in the reference sequence (first position), and deletions with a - in the alt sequence (second position). Multiple individual mutations are separated by &
TABLE-US-00073 TABLE69 CasXvariant515domainsequencesandcoordinates SEQ Domain IDNO AminoAcidSequence Coordinates N-terminal M 1 methionine OBD-I 585 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLEN 2-57 LRKKPENIPQ HelicalI-I 586 PISNTSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVA 58-101 NTSB 587 QPASKKIDQNKLKPEMDEKGNLTTAGFACSQCGQPLFVYKLEQVSE 102-192 KGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDEAVTYSLGKFGQ HelicalI-II 588 RALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTI 193-333 ASFLSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPP QPHTKEGVDAYNEVIARVRMWVNLNLWQKLKLSRDDAKPLLRLKGF PSF HelicalII 589 PLVERQANEVDWWDMVCNVKKLINEKKEDGKVFWQNLAGYKRQEAL 334-501 RPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDEAWER IDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKE ADKDEFCRCELKLQKWYGDLRGKPFAIEAE OBD-II 590 NSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGKLRFKKI 502-647 KPEAFEANRFYTVINKKSGEIVPMEVNENFDDPNLIILPLAFGKRQ GREFIWNDLLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALT FERREVLD RuvC-I 591 SSNIKPMNLIGVDRGENIPAVIALTDPEGCPLSRFKDSLGNPTHIL 648-811 RIGESYKEKQRTIQAKKEVEQRRAGGYSRKYASKAKNLADDMVRNT ARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRMEDWLT AKLAYEGLPSKTYLSKTLAQYTSKTC TSL 592 SNCGFTITSADYDRVLEKLKKTATGWMTTINGKELKVEGQITYYNR 812-921 YKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKRES HRPVQEKFVCLNCGFETH RuvC-II 593 ADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVETWQSFY 922-979 RKKLKEVWKPAV
TABLE-US-00074 TABLE70 SummaryofpositionsofsinglemutationswithinCasX515variantdomains Positionof mutationwithin Aminoacid CasX515domain* sequenceof CasX (Position. mutated variant Mutated Reference. Aminoacidsequenceof domain no. domain Alternative) mutateddomain (SEQIDNO) 532 OBD-I 26.-.R QEIKRINKIRRRLVKDSNTKKAGKTRGPMK 9543 TLLVRVMTPDLRERLENLRKKPENIPQ 536 HelicalI-II 32.G.T RALDFYSIHVTKESTHPVKPLAQIAGNRYA 9544 STPVGKALSDACMGTIASFLSKYQDIIIEH QKVVKGNQKRLESLRELAGKENLEYPSVTL PPQPHTKEGVDAYNEVIARVRMWVNLNLWQ KLKLSRDDAKPLLRLKGFPSF 555 NTSB 70.A.D QPASKKIDQNKLKPEMDEKGNLTTAGFACS 9545 QCGQPLFVYKLEQVSEKGKAYTNYFGRCNV AEHEKLILLDQLKPEKDSDEAVTYSLGKFG Q 559 OBD-I 3.I.G QEGKRINKIRRRLVKDSNTKKAGKTGPMKT 9546 LLVRVMTPDLRERLENLRKKPENIPQ 561 OBD-I 4.-.G QEIGKRINKIRRRLVKDSNTKKAGKTGPMK 9547 TLLVRVMTPDLRERLENLRKKPENIPQ 562 OBD-I 4.K.G QEIGRINKIRRRLVKDSNTKKAGKTGPMKT 9548 LLVRVMTPDLRERLENLRKKPENIPQ 564 OBD-I 5.-.G QEIKGRINKIRRRLVKDSNTKKAGKTGPMK 9549 TLLVRVMTPDLRERLENLRKKPENIPQ 569 OBD-I 8.K.G QEIKRINGIRRRLVKDSNTKKAGKTGPMKT 9550 LLVRVMTPDLRERLENLRKKPENIPQ 572 OBD-I 34.R.P QEIKRINKIRRRLVKDSNTKKAGKTGPMKT 9551 LLVPVMTPDLRERLENLRKKPENIPQ 577 HelicalI-I 7.R.Q PISNTSQANLNKLLTDYTEMKKAILHVYWE 9552 EFQKDPVGLMSRVA 583 NTSB 68.L.K QPASKKIDQNKLKPEMDEKGNLTTAGFACS 9553 QCGQPLFVYKLEQVSEKGKAYTNYFGRCNV AEHEKLIKLAQLKPEKDSDEAVTYSLGKFG Q 584 NTSB 70.A.Y QPASKKIDQNKLKPEMDEKGNLTTAGFACS 9554 QCGQPLFVYKLEQVSEKGKAYTNYFGRCNV AEHEKLILLYQLKPEKDSDEAVTYSLGKFG Q 585 NTSB 70.A.S QPASKKIDQNKLKPEMDEKGNLTTAGFACS 9555 QCGQPLFVYKLEQVSEKGKAYTNYFGRCNV AEHEKLILLSQLKPEKDSDEAVTYSLGKFG Q 592 HelicalI-II 112.M.T RALDFYSIHVTKESTHPVKPLAQIAGNRYA 9556 SGPVGKALSDACMGTIASFLSKYQDIIIEH QKVVKGNQKRLESLRELAGKENLEYPSVTL PPQPHTKEGVDAYNEVIARVRTWVNLNLWQ KLKLSRDDAKPLLRLKGFPSF 593 HelicalI-II 112.M.W RALDFYSIHVTKESTHPVKPLAQIAGNRYA 9557 SGPVGKALSDACMGTIASFLSKYQDIIIEH QKVVKGNQKRLESLRELAGKENLEYPSVTL PPQPHTKEGVDAYNEVIARVRWWVNLNLWQ KLKLSRDDAKPLLRLKGFPSF 607 HelicalII 65.Y.T PLVERQANEVDWWDMVCNVKKLINEKKEDG 9558 KVFWQNLAGYKRQEALRPYLSSEEDRKKGK KFARTQLGDLLLHLEKKHGEDWGKVYDEAW ERIDKKVEGLSKHIKLEEERRSEDAQSKAA LTDWLRAKASFVIEGLKEADKDEFCRCELK LQKWYGDLRGKPFAIEAE 638 HelicalII 148.E.D PLVERQANEVDWWDMVCNVKKLINEKKEDG 9559 KVFWQNLAGYKRQEALRPYLSSEEDRKKGK KFARYQLGDLLLHLEKKHGEDWGKVYDEAW ERIDKKVEGLSKHIKLEEERRSEDAQSKAA LTDWLRAKASFVIEGLKEADKDEFCRCDLK LQKWYGDLRGKPFAIEAE 656 TSL 76.T.D SNCGFTITSADYDRVLEKLKKTATGWMTTI 9560 NGKELKVEGQITYYNRYKRQNVVKDLSVEL DRLSEESVNNDISSWDKGRSGEALSLLKKR FSHRPVQEKFVCLNCGFETH 777 NTSB 68.L.Q QPASKKIDQNKLKPEMDEKGNLTTAGFACS 9561 QCGQPLFVYKLEQVSEKGKAYTNYFGRCNV AEHEKLIQLAQLKPEKDSDEAVTYSLGKFG Q 787 TSL 15.V.M SNCGFTITSADYDRMLEKLKKTATGWMTTI 9562 NGKELKVEGQITYYNRYKRQNVVKDLSVEL DRLSEESVNNDISSWTKGRSGEALSLLKKR FSHRPVQEKFVCLNCGFETH 788 TSL 80.S.Q SNCGFTITSADYDRVLEKLKKTATGWMTTI 9563 NGKELKVEGQITYYNRYKRQNVVKDLSVEL DRLSEESVNNDISSWTKGRQGEALSLLKKR FSHRPVQEKFVCLNCGFETH 818 RuvC-I 51.S.R SSNIKPMNLIGVDRGENIPAVIALTDPEGC 9564 PLSRFKDSLGNPTHILRIGERYKEKQRTIQ AKKEVEQRRAGGYSRKYASKAKNLADDMVR NTARDLLYYAVTQDAMLIFENLSRGFGRQG KRTFMAERQYTRMEDWLTAKLAYEGLPSKT YLSKTLAQYTSKTC *Positions of mutations within domains are shown relative to the CasX 515 domain sequences provided in Table 69, above. Each mutation is indicated by its position, reference sequence, and alt sequence, separated by .Insertions are indicated with a in the reference sequence (first position), and deletions with a in the alt sequence (second position). Mutated residues are bolded and underlined.
Example 38: CasX Variants with Two or Three Mutations Relative to CasX Variant 515
[0826] CasX variants were generated with two or three mutations relative to CasX variant 515, and assessed for their on and off-target gene editing activity.
Materials and Methods
[0827] Pairs of mutations listed in Tables 68 and 70, above, were introduced into the CasX variant 515 amino acid sequence to generate 161 amino acid sequences of CasX variants. The pairs of mutations and full-length amino acid sequences of the 161 CasX variants tested are listed in Table 71, and Table 72 provides the amino acid sequences of each of the domains of the 161 CasX variants.
TABLE-US-00075 TABLE 71 Pairs of mutations and amino acid sequences of CasX variants Mutations relative Phenotypes of Full-length to CasX 515* (Position. single mutations CasX amino acid Reference. Alternative) (see Example 37) SEQ ID NO 4.I.G & 64.R.Q Activity + activity 9382 4.I.G & 169.L.K Activity + activity 9383 4.I.G & 169.L.Q Activity + activity 9384 4.I.G & 171.A.D Activity + activity 9385 4.I.G & 171.A.Y Activity + activity 9386 4.I.G & 171.A.S Activity + activity 9387 4.I.G & 224.G.T Activity + activity 9388 4.I.G & 304.M.T Activity + activity 9389 4.I.G & 398.Y.T Activity + activity 9390 4.I.G & 826.V.M Activity + activity 9391 4.I.G & 887.T.D Activity + activity 9392 4.I.G & 891.S.Q Activity + activity 9393 5.-.G & 64.R.Q Activity + activity 9394 5.-.G & 169.L.K Activity + activity 9395 5.-.G & 169.L.Q Activity + activity 9396 5.-.G & 171.A.D Activity + activity 9397 5.-.G & 171.A.Y Activity + activity 9398 5.-.G & 171.A.S Activity + activity 9399 5.-.G & 224.G.T Activity + activity 9400 5.-.G & 304.M.T Activity + activity 9401 5.-.G & 398.Y.T Activity + activity 9402 5.-.G & 826.V.M Activity + activity 9403 5.-.G & 887.T.D Activity + activity 9404 5.-.G & 891.S.Q Activity + activity 9405 9.K.G & 64.R.Q Activity + activity 9406 9.K.G & 169.L.K Activity + activity 9407 9.K.G & 169.L.Q Activity + activity 9408 9.K.G & 171.A.D Activity + activity 9409 9.K.G & 171.A.Y Activity + activity 9410 9.K.G & 171.A.S Activity + activity 9411 9.K.G & 224.G.T Activity + activity 9412 9.K.G & 304.M.T Activity + activity 9413 9.K.G & 398.Y.T Activity + activity 9414 9.K.G & 826.V.M Activity + activity 9415 9.K.G & 887.T.D Activity + activity 9416 9.K.G & 891.S.Q Activity + activity 9417 27.-.R & 64.R.Q Activity + activity 9418 27.-.R & 169.L.K Activity + activity 9419 27.-.R & 169.L.Q Activity + activity 9420 27.-.R & 171.A.D Activity + activity 9421 27.-.R & 171.A.Y Activity + activity 9422 27.-.R & 171.A.S Activity + activity 9423 27.-.R & 224.G.T Activity + activity 9424 27.-.R & 304.M.T Activity + activity 9425 27.-.R & 398.Y.T Activity + activity 9426 27.-.R & 826.V.M Activity + activity 9427 27.-.R & 887.T.D Activity + activity 9428 27.-.R & 891.S.Q Activity + activity 9429 35.R.P & 64.R.Q Activity + activity 9430 35.R.P & 169.L.K Activity + activity 9431 35.R.P & 169.L.Q Activity + activity 9432 35.R.P & 171.A.D Activity + activity 9433 35.R.P & 171.A.Y Activity + activity 9434 35.R.P & 171.A.S Activity + activity 9435 35.R.P & 224.G.T Activity + activity 9436 35.R.P & 304.M.T Activity + activity 9437 35.R.P & 398.Y.T Activity + activity 9438 35.R.P & 826.V.M Activity + activity 9439 35.R.P & 887.T.D Activity + activity 9440 35.R.P & 891.S.Q Activity + activity 9441 887.T.D & 891.S.Q Activity + activity 9442 64.R.Q & 169.L.K Activity + activity 9443 64.R.Q & 169.L.Q Activity + activity 9444 64.R.Q & 171.A.D Activity + activity 9445 64.R.Q & 171.A.Y Activity + activity 9446 64.R.Q & 171.A.S Activity + activity 9447 64.R.Q & 224.G.T Activity + activity 9448 64.R.Q & 304.M.T Activity + activity 9449 64.R.Q & 398.Y.T Activity + activity 9450 64.R.Q & 826.V.M Activity + activity 9451 64.R.Q & 887.T.D Activity + activity 9452 64.R.Q & 891.S.Q Activity + activity 9453 169.L.K & 171.A.D Activity + activity 9454 169.L.K & 171.A.Y Activity + activity 9455 169.L.K & 171.A.S Activity + activity 9456 169.L.K & 224.G.T Activity + activity 9457 169.L.K & 304.M.T Activity + activity 9458 169.L.K & 398.Y.T Activity + activity 9459 169.L.K & 826.V.M Activity + activity 9460 169.L.K & 887.T.D Activity + activity 9461 169.L.K & 891.S.Q Activity + activity 9462 169.L.Q & 171.A.D Activity + activity 9463 169.L.Q & 171.A.Y Activity + activity 9464 169.L.Q & 171.A.S Activity + activity 9465 169.L.Q & 224.G.T Activity + activity 9466 169.L.Q & 304.M.T Activity + activity 9467 169.L.Q & 398.Y.T Activity + activity 9468 169.L.Q & 826.V.M Activity + activity 9469 169.L.Q & 887.T.D Activity + activity 9470 169.L.Q & 891.S.Q Activity + activity 9471 171.A.D & 224.G.T Activity + activity 9472 171.A.D & 304.M.T Activity + activity 9473 171.A.D & 398.Y.T Activity + activity 9474 171.A.D & 826.V.M Activity + activity 9475 171.A.D & 887.T.D Activity + activity 9476 171.A.D & 891.S.Q Activity + activity 9477 171.A.Y & 224.G.T Activity + activity 9478 171.A.Y & 304.M.T Activity + activity 9479 171.A.Y & 398.Y.T Activity + activity 9480 171.A.Y & 826.V.M Activity + activity 9481 171.A.Y & 887.T.D Activity + activity 9482 171.A.Y & 891.S.Q Activity + activity 9483 171.A.S & 224.G.T Activity + activity 9484 171.A.S & 304.M.T Activity + activity 9485 171.A.S & 398.Y.T Activity + activity 9486 171.A.S & 826.V.M Activity + activity 9487 171.A.S & 887.T.D Activity + activity 9488 171.A.S & 891.S.Q Activity + activity 9489 4.I.G & 35.R.P Activity + activity 9490 224.G.T & 304.M.T Activity + activity 9491 224.G.T & 398.Y.T Activity + activity 9492 224.G.T & 826.V.M Activity + activity 9493 224.G.T & 887.T.D Activity + activity 9494 224.G.T & 891.S.Q Activity + activity 9495 5.-.G & 35.R.P Activity + activity 9496 4.I.G & 27.-.R Activity + activity 9497 304.M.T & 398.Y.T Activity + activity 9498 304.M.T & 826.V.M Activity + activity 9499 304.M.T & 887.T.D Activity + activity 9500 304.M.T & 891.S.Q Activity + activity 9501 9.K.G & 35.R.P Activity + activity 9502 5.-.G & 27.-.R Activity + activity 9503 4.I.G & 9.K.G Activity + activity 9504 398.Y.T & 826.V.M Activity + activity 9505 398.Y.T & 887.T.D Activity + activity 9506 398.Y.T & 891.S.Q Activity + activity 9507 27.-.R & 35.R.P Activity + activity 9508 9.K.G & 27.-.R Activity + activity 9509 5.-.G & 9.K.G Activity + activity 9510 4.I.G & 5.-.G Activity + activity 9511 826.V.M & 887.T.D Activity + activity 9512 826.V.M & 891.S.Q Activity + activity 9513 5.K.G & 27.-.R Activity + specificity 9514 5.K.G & 169.L.K Activity + specificity 9515 5.K.G & 171.A.D Activity + specificity 9516 5.K.G & 304.M.T Activity + specificity 9517 5.K.G & 398.Y.T Activity + specificity 9518 5.K.G & 891.S.Q Activity + specificity 9519 6.-.G & 27.-.R Activity + specificity 9520 6.-.G & 169.L.K Activity + specificity 9521 6.-.G & 171.A.D Activity + specificity 9522 6.-.G & 304.M.T Activity + specificity 9523 6.-.G & 398.Y.T Activity + specificity 9524 6.-.G & 891.S.Q Activity + specificity 9525 304.M.W & 27.-.R Activity + specificity 9526 304.M.W & 169.L.K Activity + specificity 9527 304.M.W & 171.A.D Activity + specificity 9528 304.M.W & 398.Y.T Activity + specificity 9529 304.M.W & 891.S.Q Activity + specificity 9530 481.E.D & 27.-.R Activity + specificity 9531 481.E.D & 169.L.K Activity + specificity 9532 481.E.D & 171.A.D Activity + specificity 9533 481.E.D & 304.M.T Activity + specificity 9534 481.E.D & 398.Y.T Activity + specificity 9535 481.E.D & 891.S.Q Activity + specificity 9536 698.S.R & 27.-.R Activity + specificity 9537 698.S.R & 169.L.K Activity + specificity 9538 698.S.R & 171.A.D Activity + specificity 9539 698.S.R & 304.M.T Activity + specificity 9540 698.S.R & 398.Y.T Activity + specificity 9541 698.S.R & 891.S.Q Activity + specificity 9542 *Positions of mutations are shown relative to a CasX 515 sequence with an N-terminal methionine residue (SEQ ID NO: 9590). Each mutation is indicated by its position, reference sequence, and alt sequence, separated by . Insertions are indicated with a - in the reference sequence (first position), and deletions with a - in the alt sequence (second position). Multiple individual mutations are separated by &.
TABLE-US-00076 TABLE 72 Amino acid sequences of domains of CasX variants, N- to C-terminus Mutations relative to CasX 515* Amino acid sequences of domains of CasX variants (SEQ ID NOs) (Position. Reference. OBD- Helical Helical Helical OBD- RuvC- RuvC- Alternative) I I-I NTSB I-II II II I TSL II None (non-mutated 585 586 587 588 589 590 591 592 593 CasX 515) 4.I.G & 64.R.Q 9546 9552 587 588 589 590 591 592 593 4.I.G & 169.L.K 9546 586 9553 588 589 590 591 592 593 4.I.G & 169.L.Q 9546 586 9561 588 589 590 591 592 593 4.I.G & 171.A.D 9546 586 9545 588 589 590 591 592 593 4.I.G & 171.A.Y 9546 586 9554 588 589 590 591 592 593 4.I.G & 171.A.S 9546 586 9555 588 589 590 591 592 593 4.I.G & 224.G.T 9546 586 587 9544 589 590 591 592 593 4.I.G & 304.M.T 9546 586 587 9556 589 590 591 592 593 4.I.G & 398.Y.T 9546 586 587 588 9558 590 591 592 593 4.I.G & 826.V.M 9546 586 587 588 589 590 591 9562 593 4.I.G & 887.T.D 9546 586 587 588 589 590 591 9560 593 4.I.G & 891.S.Q 9546 586 587 588 589 590 591 9563 593 5..G & 64.R.Q 9547 9552 587 588 589 590 591 592 593 5..G & 169.L.K 9547 586 9553 588 589 590 591 592 593 5..G & 169.L.Q 9547 586 9561 588 589 590 591 592 593 5..G & 171.A.D 9547 586 9545 588 589 590 591 592 593 5..G & 171.A.Y 9547 586 9554 588 589 590 591 592 593 5..G & 171.A.S 9547 586 9555 588 589 590 591 592 593 5..G & 224.G.T 9547 586 587 9544 589 590 591 592 593 5..G & 304.M.T 9547 586 587 9556 589 590 591 592 593 5..G & 398.Y.T 9547 586 587 588 9558 590 59 592 593 5..G & 826.V.M 9547 586 587 588 589 590 591 9562 593 5..G & 887.T.D 9547 586 587 588 589 590 591 9560 593 5..G & 891.S.Q 9547 586 587 588 589 590 591 9563 593 9.K.G & 64.R.Q 9550 9552 587 588 589 590 591 592 593 9.K.G & 169.L.K 9550 586 9553 588 589 590 591 592 593 9.K.G & 169.L.Q 9550 586 9561 588 589 590 591 592 593 9.K.G & 171.A.D 9550 586 9545 588 589 590 591 592 593 9.K.G & 171.A.Y 9550 586 9554 588 589 590 591 592 593 9.K.G & 171.A.S 9550 586 9555 588 589 590 591 592 593 9.K.G & 224.G.T 9550 586 587 9544 589 590 591 592 593 9.K.G & 304.M.T 9550 586 587 9556 589 590 59 592 593 9.K.G & 398.Y.T 9550 586 587 588 9558 590 591 592 593 9.K.G & 826.V.M 9550 586 587 588 589 590 59 9562 593 9.K.G & 887.T.D 9550 586 587 588 589 590 591 9560 593 9.K.G & 891.S.Q 9550 586 587 588 589 590 591 9563 593 27..R & 64.R.Q 9543 9552 587 588 589 590 591 592 593 27..R & 169.L.K 9543 586 9553 588 589 590 591 592 593 27..R & 169.L.Q 9543 586 9561 588 589 590 591 592 593 27..R & 171.A.D 9543 586 9545 588 589 590 591 592 593 27..R & 171.A.Y 9543 586 9554 588 589 590 591 592 593 27..R & 171.A.S 9543 586 9555 588 589 590 591 592 593 27..R & 224.G.T 9543 586 587 9544 589 590 591 592 593 27..R & 304.M.T 9543 586 587 9556 589 590 591 592 593 27..R & 398.Y.T 9543 586 587 588 9558 590 591 592 593 27..R & 826.V.M 9543 586 587 588 589 590 591 9562 593 27..R & 887.T.D 9543 586 587 588 589 590 591 9560 593 27..R & 891.S.Q 9543 586 587 588 589 590 591 9563 593 35.R.P & 64.R.Q 9551 9552 587 588 589 590 591 592 593 35.R.P & 169.L.K 9551 586 9553 588 589 590 591 592 593 35.R.P & 169.L.Q 9551 586 9561 588 589 590 591 592 593 35.R.P & 171.A.D 9551 586 9545 588 589 590 591 592 593 35.R.P & 171.A.Y 9551 586 9554 588 589 590 591 592 593 35.R.P & 171.A.S 9551 586 9555 588 589 590 591 592 593 35.R.P & 224.G.T 9551 586 587 9544 589 590 591 592 593 35.R.P & 304.M.T 9551 586 587 9556 589 590 591 592 593 35.R.P & 398.Y.T 9551 586 587 588 9558 590 591 592 593 35.R.P & 826.V.M 9551 586 587 588 589 590 591 9562 593 35.R.P & 887.T.D 9551 586 587 588 589 590 591 9560 593 35.R.P & 891.S.Q 9551 586 587 588 589 590 591 9563 593 887.T.D & 891.S.Q 585 586 587 588 589 590 591 9585 593 64.R.Q & 169.L.K 585 9552 9553 588 589 590 591 592 593 64.R.Q & 169.L.Q 585 9552 9561 588 589 590 591 592 593 64.R.Q & 171.A.D 585 9552 9545 588 589 590 591 592 593 64.R.Q & 171.A.Y 585 9552 9554 588 589 590 591 592 593 64.R.Q & 171.A.S 585 9552 9555 588 589 590 591 592 593 64.R.Q & 224.G.T 585 9552 587 9544 589 590 591 592 593 64.R.Q & 304.M.T 585 9552 587 9556 589 590 591 592 593 64.R.Q & 398.Y.T 585 9552 587 588 9558 590 591 592 593 64.R.Q & 826.V.M 585 9552 587 588 589 590 591 9562 593 64.R.Q & 887.T.D 585 9552 587 588 589 590 591 9560 593 64.R.Q & 891.S.Q 585 9552 587 588 589 590 591 9563 593 169.L.K & 171.A.D 585 586 9577 588 589 590 591 592 593 169.L.K & 171.A.Y 585 586 9578 588 589 590 591 592 593 169.L.K & 171.A.S 585 586 9579 588 589 590 591 592 593 169.L.K & 224.G.T 585 586 9553 9544 589 590 591 592 593 169.L.K & 304.M.T 585 586 9553 9556 589 590 591 592 593 169.L.K & 398.Y.T 585 586 9553 588 9558 590 591 592 593 169.L.K & 826.V.M 585 586 9553 588 589 590 591 9562 593 169.L.K & 887.T.D 585 586 9553 588 589 590 591 9560 593 169.L.K & 891.S.Q 585 586 9553 588 589 590 591 9563 593 169.L.Q & 171.A.D 585 586 9580 588 589 590 591 592 593 169.L.Q & 171.A.Y 585 586 9581 588 589 590 591 592 593 169.L.Q & 171.A.S 585 586 9582 588 589 590 591 592 593 169.L.Q & 224.G.T 585 586 9561 9544 589 590 591 592 593 169.L.Q & 304.M.T 585 586 9561 9556 589 590 591 592 593 169.L.Q & 398.Y.T 585 586 9561 588 9558 590 591 592 593 169.L.Q & 826.V.M 585 586 9561 588 589 590 591 9562 593 169.L.Q & 887.T.D 585 586 9561 588 589 590 591 9560 593 169.L.Q & 891.S.Q 585 586 9561 588 589 590 591 9563 593 171.A.D & 224.G.T 585 586 9545 9544 589 590 591 592 593 171.A.D & 304.M.T 585 586 9545 9556 589 590 591 592 593 171.A.D & 398.Y.T 585 586 9545 588 9558 590 591 592 593 171.A.D & 826.V.M 585 586 9545 588 589 590 591 9562 593 171.A.D & 887.T.D 585 586 9545 588 589 590 591 9560 593 171.A.D & 891.S.Q 585 586 9545 588 589 590 591 9563 593 171.A.Y & 224.G.T 585 586 9554 9544 589 590 591 592 593 171.A.Y & 304.M.T 585 586 9554 9556 589 590 591 592 593 171.A.Y & 398.Y.T 585 586 9554 588 9558 590 591 592 593 171.A.Y & 826.V.M 585 586 9554 588 589 590 591 9562 593 171.A.Y & 887.T.D 585 586 9554 588 589 590 591 9560 593 171.A.Y & 891.S.Q 585 586 9554 588 589 590 591 9563 593 171.A.S & 224.G.T 585 586 9555 9544 589 590 591 592 593 171.A.S & 304.M.T 585 586 9555 9556 589 590 591 592 593 171.A.S & 398.Y.T 585 586 9555 588 9558 590 591 592 593 171.A.S & 826.V.M 585 586 9555 588 589 590 591 9562 593 171.A.S & 887.T.D 585 586 9555 588 589 590 591 9560 593 171.A.S & 891.S.Q 585 586 9555 588 589 590 591 9563 593 4.I.G & 35.R.P 9565 586 587 588 589 590 591 592 593 224.G.T & 304.M.T 585 586 587 9583 589 590 591 592 593 224.G.T & 398.Y.T 585 586 587 9544 9558 590 591 592 593 224.G.T & 826.V.M 585 586 587 9544 589 590 591 9562 593 224.G.T & 887.T.D 585 586 587 9544 589 590 591 9560 593 224.G.T & 891.S.Q 585 586 587 9544 589 590 591 9563 593 5..G & 35.R.P 9566 586 587 588 589 590 591 592 593 4.I.G & 27..R 9567 586 587 588 589 590 591 592 593 304.M.T & 398.Y.T 585 586 587 9556 9558 590 591 592 593 304.M.T & 826.V.M 585 586 587 9556 589 590 591 9562 593 304.M.T & 887.T.D 585 586 587 9556 589 590 591 9560 593 304.M.T & 891.S.Q 585 586 587 9556 589 590 591 9563 593 9.K.G & 35.R.P 9568 586 587 588 589 590 591 592 593 5..G & 27..R 9569 586 587 588 589 590 591 592 593 4.I.G & 9.K.G 9570 586 587 588 589 590 591 592 593 398.Y.T & 826.V.M 585 586 587 588 9558 590 591 9562 593 398.Y.T & 887.T.D 585 586 587 588 9558 590 591 9560 593 398.Y.T & 891.S.Q 585 586 587 588 9558 590 591 9563 593 27..R & 35.R.P 9571 586 587 588 589 590 591 592 593 9.K.G & 27..R 9572 586 587 588 589 590 591 592 593 5..G & 9.K.G 9573 586 587 588 589 590 591 592 593 4.I.G & 5..G 9574 586 587 588 589 590 591 592 593 826.V.M & 887.T.D 585 586 587 588 589 590 591 9586 593 826.V.M & 891.S.Q 585 586 587 588 589 590 591 9587 593 5.K.G & 27..R 9575 586 587 588 589 590 591 592 593 5.K.G & 169.L.K 9548 586 9553 588 589 590 591 592 593 5.K.G & 171.A.D 9548 586 9545 588 589 590 591 592 593 5.K.G & 304.M.T 9548 586 587 9556 589 590 591 592 593 5.K.G & 398.Y.T 9548 586 587 588 9558 590 591 592 593 5.K.G & 891.S.Q 9548 586 587 588 589 590 591 9563 593 6..G & 27..R 9576 586 587 588 589 590 591 592 593 6..G & 169.L.K 9549 586 9553 588 589 590 591 592 593 6..G & 171.A.D 9549 586 9545 588 589 590 591 592 593 6..G & 304.M.T 9549 586 587 9556 589 590 591 592 593 6..G & 398.Y.T 9549 586 587 588 9558 590 591 592 593 6..G & 891.S.Q 9549 586 587 588 589 590 591 9563 593 304.M.W & 27..R 9543 586 587 9557 589 590 591 592 593 304.M.W & 169.L.K 585 586 9553 9557 589 590 591 592 593 304.M.W & 171.A.D 585 586 9545 9557 589 590 591 592 593 304.M.W & 398.Y.T 585 586 587 9557 9558 590 591 592 593 304.M.W & 891.S.Q 585 586 587 9557 589 590 591 9563 593 481.E.D & 27..R 9543 586 587 588 9559 590 591 592 593 481.E.D & 169.L.K 585 586 9553 588 9559 590 591 592 593 481.E.D & 171.A.D 585 586 9545 588 9559 590 591 592 593 481.E.D & 304.M.T 585 586 587 9556 9559 590 591 592 593 481.E.D & 398.Y.T 585 586 587 588 9584 590 591 592 593 481.E.D & 891.S.Q 585 586 587 588 9559 590 591 9563 593 698.S.R & 27..R 9543 586 587 588 589 590 9564 592 593 698.S.R & 169.L.K 585 586 9553 588 589 590 9564 592 593 698.S.R & 171.A.D 585 586 9545 588 589 590 9564 592 593 698.S.R & 304.M.T 585 586 587 9556 589 590 9564 592 593 698.S.R & 398.Y.T 585 586 587 588 9558 590 9564 592 593 698.S.R & 891.S.Q 585 586 587 588 589 590 9564 9563 593 *Positions of mutations are shown relative to a CasX 515 sequence with an N-terminal methionine residue (SEQ ID NO: 9590). Each mutation is indicated by its position, reference sequence, and alt sequence, separated by . Insertions are indicated with a in the reference sequence (first position), and deletions with a in the alt sequence (second position). Multiple individual mutations are separated by &.
[0828] A subset of these 161 CasX variants were cloned using methods standard in the art, and are listed in Tables 74, 76, and 77, below. In addition, a CasX variant termed CasX variant 1001 was generated by combining mutations from CasX variant 812 and CasX variant 676 (27.-.R, 169.L.K, and 329.G.K mutations relative to CasX 515), which have been previously validated as a highly specific and highly active CasX variants, respectively (the PAM-altering 224.G.S mutation also present in CasX 676 was not included). CasX variant 969 was generated by combining 27.-.R, 171.A.D, and 224.G.T mutations relative to CasX variant 515. Finally, CasX variant 973 was generated by combining 35.R.P, 171.A.Y, and 304.M.T mutations relative to CasX variant 515. The amino acid sequences of CasX variants 969, 973, and 1001 are provided in Table 73, below.
TABLE-US-00077 TABLE73 AminoacidsequencesofCasXvariants969,973,and1001 CasX variant SEQ no. Aminoacidsequence IDNO 969 QEIKRINKIRRRLVKDSNTKKAGKTRGPMKTLLVRVMTPDLRERLENLRKKPENIPQPIS 9607 NTSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEK GNLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLDQLKPEKDSD EAVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASTPVGKALSDACMGTIAS FLSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIA RVRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKK EDGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYD EAWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRC ELKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGG KLRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWN DLLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVD RGENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGY SRKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRM EDWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTT INGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKK RFSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFV ETWQSFYRKKLKEVWKPAV 973 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVPVMTPDLRERLENLRKKPENIPQPISN 9608 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLYQLKPEKDSDE AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR VRTWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE TWQSFYRKKLKEVWKPAV 1001 QEIKRINKIRRRLVKDSNTKKAGKTRGPMKTLLVRVMTPDLRERLENLRKKPENIPQPIS 9609 NTSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEK GNLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLIKLAQLKPEKDSD EAVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIAS FLSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIA RVRMWVNLNLWQKLKLSRDDAKPLLRLKKFPSFPLVERQANEVDWWDMVCNVKKLINEKK EDGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYD EAWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRC ELKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGG KLRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWN DLLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVD RGENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGY SRKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRM EDWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTT INGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKK RFSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFV ETWQSFYRKKLKEVWKPAV
[0829] A multiplexed pooled PASS assay was performed and analyzed as described in Example 37. As noted in Example 37, CasX variants were expressed using a relatively weakly-expressing promoter to reduce CasX protein expression and thereby improve the sensitivity of the assay. Samples were tested in duplicate, except for CasX variant 1006, which was tested in quadruplicate. In Tables 74, 76, 77, below, the results for the CasX variant 1006 samples are reported in two separate rows, each the average of two samples. Streptococcus pyogenes Cas9 without a guide RNA served as a negative control. CasX variant 515, CasX variant 676, and CasX variant 812 were also included as controls.
Results
[0830] Table 74 provides the level of on-target editing produced by various CasX variants with mutations relative to CasX variant 515, ranked from highest to lowest activity.
TABLE-US-00078 TABLE 74 Average on-targeting editing activity of CasX variants, ranked from highest to lowest Protein Mutation(s) relative SEM on-target Designation to CasX 515* Amino acid Average on-target TTC PAM (CasX variant (Position.Reference. sequence TTC PAM editing editing activity no., or Cas9) Alternative) SEQ ID NO activity (fraction) (fraction) 1018 9.K.G & 891.S.Q 9417 3.01E01 1.20E01 1007 304.M.T & 826.V.M 9499 2.76E01 7.86E02 1006 826.V.M & 891.S.Q 9513 2.38E01 4.11E02 987 169.L.K & 304.M.T 9458 2.32E01 3.38E02 1014 4.I.G & 891.S.Q 9393 2.29E01 3.45E02 1143 4.I.G & 826.V.M 9391 2.29E01 3.44E02 1019 27.-.R & 171.A.S 9423 2.22E01 2.52E02 1029 5.K.G & 891.S.Q 9519 2.16E01 2.96E02 1006 826.V.M & 891.S.Q 9513 2.16E01 3.44E02 1015 5.-.G & 304.M.T 9401 2.11E01 3.20E02 970 27.-.R & 891.S.Q 9429 2.09E01 2.61E02 1028 5.K.G & 304.M.T 9517 2.07E01 3.10E02 996 171.A.Y & 891.S.Q 9483 2.05E01 3.42E02 969 27.-.R & 171.A.D & 224.G.T 9607 2.04E01 2.64E02 984 64.R.Q & 891.S.Q 9453 2.03E01 9.13E02 1041 698.S.R & 891.S.Q 9542 2.01E01 3.17E02 1016 9.K.G & 171.A.D 9409 1.98E01 3.20E02 1000 224.G.T & 891.S.Q 9495 1.92E01 2.51E02 999 224.G.T & 304.M.T 9491 1.92E01 2.90E02 986 169.L.K & 171.A.S 9456 1.90E01 2.76E02 977 64.R.Q & 169.L.K 9443 1.90E01 3.12E02 792 27.-.R & 169.L.K 9419 1.89E01 2.89E02 993 171.A.D & 224.G.T 9472 1.88E01 2.70E02 997 171.A.S & 304.M.T 9485 1.87E01 2.83E02 1025 169.L.K & 891.S.Q 9462 1.87E01 2.99E02 1001 27.-.R & 169.L.K & 329.G.K 9609 1.85E01 2.57E02 1040 481.E.D & 891.S.Q 9536 1.85E01 3.00E02 1004 304.M.T & 891.S.Q 9501 1.85E01 3.11E02 676 27.-.R & 170.L.K & 224.G.S 355 1.84E01 2.28E02 1031 6.-.G & 169.L.K 9521 1.84E01 3.02E02 980 64.R.Q & 171.A.S 9447 1.80E01 3.06E02 981 64.R.Q & 304.M.T 9449 1.79E01 2.44E02 985 169.L.K & 171.A.Y 9455 1.73E01 3.57E02 989 169.L.Q & 224.G.T 9466 1.73E01 3.20E02 992 169.L.Q & 887.T.D 9470 1.70E01 3.40E02 994 171.A.Y & 224.G.T 9478 1.68E01 3.21E02 1005 826.V.M & 887.T.D 9512 1.68E01 3.17E02 983 64.R.Q & 887.T.D 9452 1.68E01 1.70E02 1026 169.L.Q & 826.V.M 9469 1.65E01 3.09E02 1009 4.I.G & 171.A.D 9385 1.65E01 6.43E02 982 64.R.Q & 398.Y.T 9450 1.64E01 2.73E02 978 64.R.Q & 169.L.Q 9444 1.63E01 2.96E02 515 197 1.63E01 2.38E02 1003 9.K.G & 27.-.R 9509 1.61E01 2.28E02 1017 9.K.G & 224.G.T 9412 1.56E01 2.73E02 1020 35.R.P & 171.A.D 9433 1.55E01 3.01E02 998 171.A.S & 826.V.M 9487 1.54E01 2.92E02 1010 4.I.G & 171.A.Y 9386 1.54E01 2.71E02 1022 35.R.P & 891.S.Q 9441 1.48E01 2.79E02 1038 224.G.T & 826.V.M 9493 1.48E01 3.11E02 1027 5.K.G & 171.A.D 9516 1.42E01 2.32E02 1012 4.I.G & 398.Y.T 9390 1.40E01 2.10E02 971 35.R.P & 169.L.Q 9432 1.39E01 2.75E02 1032 6.-.G & 171.A.D 9522 1.39E01 2.40E02 1024 169.L.K & 398.Y.T 9459 1.38E01 2.87E02 1023 64.R.Q & 224.G.T 9448 1.37E01 2.34E02 1036 171.A.S & 887.T.D 9488 1.37E01 2.38E02 988 169.L.Q & 171.A.Y 9464 1.36E01 3.36E02 1034 171.A.Y & 826.V.M 9481 1.36E01 3.05E02 1030 171.A.D & 398.Y.T 9474 1.35E01 2.55E02 1039 304.M.W & 398.Y.T 9529 1.29E01 3.28E02 1033 171.A.Y & 304.M.T 9479 1.25E01 2.29E02 1021 35.R.P & 304.M.T 9437 1.25E01 1.77E02 1011 4.I.G & 224.G.T 9388 1.24E01 2.13E02 979 64.R.Q & 171.A.Y 9446 1.24E01 2.15E02 1002 5.-.G & 35.R.P 9496 1.20E01 2.31E02 1035 171.A.S & 398.Y.T 9486 1.14E01 2.07E02 851 35.R.P & 171.A.Y 9434 1.13E01 2.31E02 995 171.A.Y & 398.Y.T 9480 1.13E01 1.83E02 973 35.R.P & 171.A.Y & 304.M.T 9608 1.12E01 1.96E02 976 35.R.P & 887.T.D 9440 9.62E02 2.52E02 974 35.R.P & 224.G.T 9436 9.00E02 1.52E02 1037 224.G.T & 398.Y.T 9492 8.30E02 1.35E02 812 329.G.K 484 7.68E02 1.69E02 975 35.R.P & 398.Y.T 9438 7.49E02 1.51E02 991 169.L.Q & 398.Y.T 9468 4.87E02 1.74E02 Cas9 n/a 0.00E+00 0.00E+00 *Positions of mutations are shown relative to a CasX 515 sequence with an N-terminal methionine residue (SEQ ID NO: 9590). Each mutation is indicated by its position, reference sequence, and alt sequence, separated by . Insertions are indicated with a - in the reference sequence (first position), and deletions with a - in the alt sequence (second position). Multiple individual mutations are separated by &.
[0831] As shown in Table 74, 41 of the tested CasX variants produced higher levels of on-target editing than did CasX variant 515; the 41 CasX variants are bolded in Table 74. CasX variants 1018 had 9.K.G and 891.S.Q amino acid substitutions and produced the highest level of on-target editing in the assay. The CasX variant 676 control was more active than CasX 515, and CasX variant 812 was less active than CasX variant 515, which is consistent with previous results.
[0832] A large number of the tested CasX variants produced lower levels of on-target editing than CasX variant 515. This suggests that not all combinations of mutations, including combinations of mutations that were relatively active for on-target editing when introduced into CasX variant 515 as single mutations (see Example 37), are compatible for producing highly active CasX variants.
[0833] To understand the amino acid residues that may be causal for improving CasX activity, the identity of the mutations in the CasX variants with two or three mutations resulting in improved on-target editing activity relative to CasX variant 515 was examined (Table 75).
TABLE-US-00079 TABLE 75 Summary of mutations in CasX variants with greater on-target editing activity than CasX variant 515 Number of Position of mutation occurrences of Identity of mutation(s) relative to CasX 515 mutations at (Number of CasX (SEQ ID NO: 9590) position* variants with mutation) 891 13 891.S.Q 169 12 169.L.K (8); 169.L.Q (4) 171 11 171.A.S (4); 171.A.D (4); 171.A.Y (3) 304 8 304.M.T 64 7 64.R.Q 224 6 224.G.T 27 5 27.-.R 826 4 826.V.M 4 3 4.I.G 5 3 5.-.G (1); 5.K.G (2) 887 3 887.T.D 9 2 9.K.G 6 1 6.-.G 481 1 481.E.D 698 1 698.S.R *Excluding CasX variant 676.
[0834] As shown in Table 75, certain positions were mutated in several members of the set of CasX variants with higher on-target editing activity than CasX variant 515. For example, the serine to glutamine substitution at position 891 (891.S.Q), in the TSL domain, was found in 13 members of the CasX variants with improved on-target editing activity relative to CasX variant 515. The TSL domain is a dynamic domain involved in coordinating the introduction of the target strand to the RuvC active site, and the substitution of serine for the longer glutamine may allow for additional hydrogen bonding interactions with the target strand and more efficient transfer to the nuclease domain.
[0835] One of two substitutions at position 169 (169.L.K or 169.L.Q), in the NTSB domain, were found in 12 members of the CasX variants with higher on-target editing activity than CasX variant 515. This position is proximal to the second and third nucleotides of the unwound non-target strand in structures of the non-target strand loading state, and the introduction of either a charged residue or one capable of multiple hydrogen-bonding interactions likely allows for the stabilization of the unwound state and thus more efficient unwinding. It should be noted that 169.L.K was more enriched than 169.L.Q among the CasX variants with improved on-target editing activity, which suggests that while a polar interaction increases enzymatic activity, a charge-charge interaction is more suitable for this position.
[0836] One of three substitutions at position 171 (171.A.S, 171.A.D, or 171.A.Y), also in the NTSB domain, were found in 11 members of the CasX variants with improved on-target editing activity. Residue 171 is solvent-exposed, so a polar residue is likely more favorable at this position. While the residue is not in a position that interacts with the non-target strand in published structures, the dynamic nature of the NTSB domain may allow these residues to make hydrogen-bonding interactions with the target DNA at some point in the unwinding process. A serine is present at this position in the wild-type CasX 2 (SEQ ID NO: 2) sequence and is an alanine in CasX variants containing the chimeric NTSB from CasX1, meaning that the 171.A.S mutation in particular represents a reversion to a wild-type sequence. Notably, 171.A.Y was also found in several of the variants performing worse than CasX variant 515, which suggests that a tyrosine at position 171 might create too much steric hindrance for proper hydrogen-bonding interactions with the target DNA.
[0837] While the 169.L.K and 27.-.R mutations found in CasX variant 676 were well-represented among the high activity variants, there were a number of orthogonal mutations with distinct mechanisms that may allow for increased activity without the loss of specificity seen in CasX variant 676. 891.S.Q in particular was found in a number of top-performing activity variants that also have a higher specificity ratio than CasX variant 515 (see below).
[0838] Table 76, below, provides the level of off-target editing produced by various CasX variants with two or three mutations relative to CasX variant 515, ranked from lowest to highest activity.
TABLE-US-00080 TABLE 76 Average off-targeting editing activity of CasX variants, ranked from lowest to highest Protein Mutation relative to SEM off-target Designation CasX 515* Amino acid Average off-target TTC PAM (CasX variant (Position.Reference. sequence TTC PAM editing editing activity no., or Cas9) Alternative) SEQ ID NO activity (fraction) (fraction) Cas9 n/a 0.00E+00 0.00E+00 812 329.G.K 484 4.46E03 3.30E03 991 169.L.Q & 398.Y.T 9468 4.71E03 3.59E03 975 35.R.P & 398.Y.T 9438 6.63E03 5.75E03 976 35.R.P & 887.T.D 9440 8.76E03 6.93E03 851 35.R.P & 171.A.Y 9434 9.95E03 6.91E03 974 35.R.P & 224.G.T 9436 9.95E03 6.79E03 971 35.R.P & 169.L.Q 9432 1.15E02 8.07E03 1037 224.G.T & 398.Y.T 9492 1.22E02 8.00E03 1039 304.M.W & 398.Y.T 9529 1.24E02 1.01E02 988 169.L.Q & 171.A.Y 9464 1.30E02 8.38E03 973 35.R.P & 171.A.Y & 304.M.T 9608 1.37E02 9.35E03 995 171.A.Y & 398.Y.T 9480 1.53E02 9.56E03 1002 5.-.G & 35.R.P 9496 1.69E02 1.03E02 1009 4.I.G & 171.A.D 9385 1.76E02 1.08E02 1011 4.I.G & 224.G.T 9388 1.80E02 1.12E02 1035 171.A.S & 398.Y.T 9486 1.86E02 9.86E03 989 169.L.Q & 224.G.T 9466 1.91E02 1.19E02 1018 9.K.G & 891.S.Q 9417 1.91E02 1.43E02 1033 171.A.Y & 304.M.T 9479 1.93E02 1.09E02 994 171.A.Y & 224.G.T 9478 1.95E02 1.21E02 1020 35.R.P & 171.A.D 9433 1.98E02 1.24E02 1022 35.R.P & 891.S.Q 9441 2.04E02 1.10E02 979 64.R.Q & 171.A.Y 9446 2.09E02 1.24E02 1032 6.-.G & 171.A.D 9522 2.20E02 1.15E02 1027 5.K.G & 171.A.D 9516 2.28E02 1.29E02 1041 698.S.R & 891.S.Q 9542 2.41E02 1.32E02 1012 4.I.G & 398.Y.T 9390 2.50E02 1.30E02 1030 171.A.D & 398.Y.T 9474 2.53E02 1.31E02 1024 169.L.K & 398.Y.T 9459 2.54E02 1.39E02 982 64.R.Q & 398.Y.T 9450 2.58E02 1.58E02 983 64.R.Q & 887.T.D 9452 2.59E02 1.06E02 1040 481.E.D & 891.S.Q 9536 2.63E02 1.30E02 1017 9.K.G & 224.G.T 9412 2.67E02 1.64E02 1001 27.-.R & 169.L.K & 329.G.K 9609 2.74E02 1.31E02 992 169.L.Q & 887.T.D 9470 2.78E02 1.47E02 1036 171.A.S & 887.T.D 9488 2.80E02 1.47E02 1003 9.K.G & 27.-.R 9509 2.80E02 1.40E02 1005 826.V.M & 887.T.D 9512 2.81E02 1.41E02 978 64.R.Q & 169.L.Q 9444 2.83E02 1.48E02 1021 35.R.P & 304.M.T 9437 2.84E02 1.62E02 985 169.L.K & 171.A.Y 9455 3.00E02 1.62E02 977 64.R.Q & 169.L.K 9443 3.03E02 1.46E02 1023 64.R.Q & 224.G.T 9448 3.05E02 1.81E02 1034 171.A.Y & 826.V.M 9481 3.07E02 1.24E02 1010 4.I.G & 171.A.Y 9386 3.17E02 1.59E02 1026 169.L.Q & 826.V.M 9469 3.18E02 1.44E02 1016 9.K.G & 171.A.D 9409 3.30E02 1.43E02 1038 224.G.T & 826.V.M 9493 3.30E02 1.58E02 1029 5.K.G & 891.S.Q 9519 3.31E02 1.77E02 1031 6.-.G & 169.L.K 9521 3.38E02 1.65E02 980 64.R.Q & 171.A.S 9447 3.41E02 1.59E02 993 171.A.D & 224.G.T 9472 3.43E02 1.68E02 1028 5.K.G & 304.M.T 9517 3.65E02 1.85E02 998 171.A.S & 826.V.M 9487 3.68E02 1.63E02 515 197 3.83E02 1.46E02 999 224.G.T & 304.M.T 9491 3.91E02 1.93E02 1000 224.G.T & 891.S.Q 9495 4.14E02 2.07E02 996 171.A.Y & 891.S.Q 9483 4.25E02 2.02E02 981 64.R.Q & 304.M.T 9449 4.30E02 2.20E02 1014 4.I.G & 891.S.Q 9393 4.63E02 2.06E02 986 169.L.K & 171.A.S 9456 4.63E02 2.46E02 1006 826.V.M & 891.S.Q 9513 4.66E02 2.16E02 1025 169.L.K & 891.S.Q 9462 4.73E02 2.04E02 997 171.A.S & 304.M.T 9485 4.82E02 2.22E02 1015 5.-.G & 304.M.T 9401 5.10E02 2.19E02 987 169.L.K & 304.M.T 9458 5.72E02 2.55E02 1006 826.V.M & 891.S.Q 9513 5.87E02 2.71E02 969 27.-.R & 171.A.D & 224.G.T 9607 5.88E02 2.17E02 1004 304.M.T & 891.S.Q 9501 6.11E02 2.26E02 1143 4.I.G & 826.V.M 9391 6.15E02 2.79E02 676 27.-.R & 170.L.K & 224.G.S 355 6.19E02 2.14E02 1019 27.-.R & 171.A.S 9423 6.78E02 1.45E02 970 27.-.R & 891.S.Q 9429 6.87E02 2.22E02 1007 304.M.T & 826.V.M 9499 6.99E02 8.52E02 984 64.R.Q & 891.S.Q 9453 7.16E02 1.01E01 792 27.-.R & 169.L.K 9419 7.26E02 2.39E02
[0839] As shown in Table 76, the majority of the tested CasX variants with pairs of mutations relative to CasX variant 515 produced lower levels of off-target editing than did CasX variant 515; these samples are bolded in Table 76.
[0840] Table 77, below, provides the specificity ratio (i.e., the average level of on-targeting editing divided by the average level of off-target editing) of the tested CasX variants with two or three mutations relative to CasX 515, ranked from the highest to lowest ratio. CasX variants with higher specificity ratios than CasX 515 are bolded in Table 77.
TABLE-US-00081 TABLE 77 Specificity ratios of CasX variants, ranked from highest to lowest* SEM off- Protein Mutation relative to Amino acid Specificity ratio target TTC Designation CasX 515* sequence (average on-target PAM editing (CasX variant (Position.Reference. (SEQ ID activity/average activity no., or Cas9) Alternative) NO) off-target activity) (fraction) 812 329.G.K 484 17.22 0.52 1018 9.K.G & 891.S.Q 9417 15.76 0.35 971 35.R.P & 169.L.Q 9432 12.09 0.5 851 35.R.P & 171.A.Y 9434 11.36 0.49 975 35.R.P & 398.Y.T 9438 11.3 0.67 976 35.R.P & 887.T.D 9440 10.98 0.53 988 169.L.Q & 171.A.Y 9464 10.46 0.4 1039 304.M.W & 398.Y.T 9529 10.4 0.56 991 169.L.Q & 398.Y.T 9468 10.34 0.41 1009 4.I.G & 171.A.D 9385 9.38 0.23 989 169.L.Q & 224.G.T 9466 9.06 0.44 974 35.R.P & 224.G.T 9436 9.05 0.51 994 171.A.Y & 224.G.T 9478 8.62 0.43 1041 698.S.R & 891.S.Q 9542 8.34 0.39 973 35.R.P & 171.A.Y & 304.M.T 9608 8.18 0.51 1020 35.R.P & 171.A.D 9433 7.83 0.43 995 171.A.Y & 398.Y.T 9480 7.39 0.46 1022 35.R.P & 891.S.Q 9441 7.25 0.35 1002 5.-.G & 35.R.P 9496 7.1 0.41 1040 481.E.D & 891.S.Q 9536 7.03 0.33 1011 4.I.G & 224.G.T 9388 6.89 0.45 1037 224.G.T & 398.Y.T 9492 6.8 0.49 1001 27.-.R & 169.L.K & 329.G.K 9609 6.75 0.34 1029 5.K.G & 891.S.Q 9519 6.53 0.4 983 64.R.Q & 887.T.D 9452 6.49 0.38 1033 171.A.Y & 304.M.T 9479 6.48 0.31 982 64.R.Q & 398.Y.T 9450 6.36 0.45 1032 6.-.G & 171.A.D 9522 6.32 0.35 977 64.R.Q & 169.L.K 9443 6.27 0.32 1027 5.K.G & 171.A.D 9516 6.23 0.4 1035 171.A.S & 398.Y.T 9486 6.13 0.35 992 169.L.Q & 887.T.D 9470 6.12 0.33 1016 9.K.G & 171.A.D 9409 6 0.27 1005 826.V.M & 887.T.D 9512 5.98 0.31 979 64.R.Q & 171.A.Y 9446 5.93 0.42 1017 9.K.G & 224.G.T 9412 5.84 0.44 985 169.L.K & 171.A.Y 9455 5.77 0.34 978 64.R.Q & 169.L.Q 9444 5.76 0.33 1003 9.K.G & 27.-.R 9509 5.75 0.36 1028 5.K.G & 304.M.T 9517 5.67 0.36 1012 4.I.G & 398.Y.T 9390 5.6 0.37 993 171.A.D & 224.G.T 9472 5.48 0.34 1031 6.-.G & 169.L.K 9521 5.44 0.34 1024 169.L.K & 398.Y.T 9459 5.43 0.32 1030 171.A.D & 398.Y.T 9474 5.34 0.33 980 64.R.Q & 171.A.S 9447 5.28 0.3 1026 169.L.Q & 826.V.M 9469 5.19 0.27 1006 826.V.M & 891.S.Q 9513 5.11 0.29 1014 4.I.G & 891.S.Q 9393 4.95 0.29 999 224.G.T & 304.M.T 9491 4.91 0.34 1036 171.A.S & 887.T.D 9488 4.89 0.35 1010 4.I.G & 171.A.Y 9386 4.86 0.33 996 171.A.Y & 891.S.Q 9483 4.82 0.31 1000 224.G.T & 891.S.Q 9495 4.64 0.37 1023 64.R.Q & 224.G.T 9448 4.49 0.42 1038 224.G.T & 826.V.M 9493 4.48 0.27 1034 171.A.Y & 826.V.M 9481 4.43 0.43 1021 35.R.P & 304.M.T 9437 4.4 0.18 515 197 4.26 0.24 998 171.A.S & 826.V.M 9487 4.18 0.25 981 64.R.Q & 304.M.T 9449 4.16 0.37 1015 5.-.G & 304.M.T 9401 4.14 0.28 986 169.L.K & 171.A.S 9456 4.1 0.39 987 169.L.K & 304.M.T 9458 4.06 0.3 1025 169.L.K & 891.S.Q 9462 3.95 0.27 1007 304.M.T & 826.V.M 9499 3.95 0.93 997 171.A.S & 304.M.T 9485 3.88 0.31 1143 4.I.G & 826.V.M 9391 3.72 0.3 1006 826.V.M & 891.S.Q 9513 3.68 0.3 969 27.-.R & 171.A.D & 224.G.T 9607 3.47 0.24 1019 27.-.R & 171.A.S 9423 3.27 0.1 970 27.-.R & 891.S.Q 9429 3.04 0.2 1004 304.M.T & 891.S.Q 9501 3.03 0.2 676 27.-.R & 170.L.K & 224.G.S 355 2.97 0.22 984 64.R.Q & 891.S.Q 9453 2.84 0.95 792 27.-.R & 169.L.K 9419 2.6 0.18 *Specificity ratio and SEM values are shown rounded to the nearest hundredth.
[0841] As shown in Table 77, the majority of the tested CasX variants had higher on-target to off-target editing ratios than CasX 515. While the previously validated high-specificity variant CasX\812 had the highest specificity ratio, many CasX variants demonstrated high specificity ratios without as significant a loss in on-target activity as was observed for CasX variant 812.
[0842] The 35.R.P mutation was commonly observed in variants with very high specificity ratios. This residue is in the OBD and believed to be involved in binding the guide RNA. Mutation to a proline at this position may have complex effects on allosteric regulation. Notably, these variants also tended to have low activity, suggesting that apparent specificity may be in part the result of less efficient RNP formation due to the disruption of this guide-binding interaction. Overall, an inverse correlation was observed between specificity ratio and activity. This suggests that it is difficult to fully avoid trade-offs between activity and specificity. However, it is also evident that the strategy of combining activity and specificity mutants can compensate for this trade-off and result in variants with both characteristics improved.
[0843] Notably, some CasX variants produced both higher levels of on-target editing and lower levels of off-target editing than did CasX 515, namely CasX variants 977, 978, 980, 982, 983, 985, 989, 992, 993, 994, 1001, 1005, 1009, 1016, 1018, 1026, 1028, 1029, 1031, 1040, and 1041. An even greater number had higher on-target activity and a higher specificity ratio, specifically, CasX variants 977, 978, 980, 982, 983, 985, 989, 992, 993, 994, 996, 999, 1000, 1001, 1005, 1006, 1009, 1014, 1016, 1018, 1026, 1028, 1029, 1031, 1040, and 1041. Such CasX variants are therefore interpreted to be highly active and highly specific.
[0844] Taken together, the results described herein demonstrate that mutations to CasX 515 can be introduced into the sequence that result in CasX variants with improved gene editing activity and/or specificity.
Example 39: Generation and Assessment of Guide RNA Scaffolds with Mutations in the Pseudoknot Stem
[0845] As described in Example 18, guide RNA scaffold 320 was designed with mutations to deplete the CpG content of the DNA encoding the pseudoknot stem and the extended stem regions of the scaffold. In the experiment described in Example 18, scaffold 320 produced a significant increase in editing potency relative to scaffold 235. This suggested that mutations to the pseudoknot stem have the potential to improve scaffold function. In the following example, a selection of scaffolds with mutations in the pseudoknot stem were designed and tested for their ability to promote genome editing.
Materials and Methods
Design of Guide RNA Scaffolds with Mutations in the Pseudoknot Stem:
[0846] Guide RNA scaffolds with mutations in the pseudoknot stem were designed based on scaffold 316 (SEQ ID NO: 9588). The positions of the mutations, as well as full-length DNA and RNA sequences of the scaffolds are provided in Table 78, below. Scaffold 392 recapitulates the CG->GC mutation in the pseudoknot stem that was used to generate scaffold 320, as described in Example 18. Scaffolds 174, 235, and 316 were included in this experiment as controls.
TABLE-US-00082 TABLE78 MutationsandDNAandRNAsequencesofguideRNAscaffolds DNA RNA Scaffold Positionof SEQ SEQ no. mutation* DNAsequence IDNO RNAsequence IDNO 174 n/a ACTGGCGCTTTTATCTGA 3631 ACUGGCGCUUUUAUCUGAUUA 2238 TTACTTTGAGAGCCATCA CUUUGAGAGCCAUCACCAGCG CCAGCGACTATGTCGTAG ACUAUGUCGUAGUGGGUAAAG TGGGTAAAGCTCCCTCTT CUCCCUCUUCGGAGGGAGCAU CGGAGGGAGCATCAAAG CAAAG 235 n/a ACTGGCGCTTCTATCTGA 3638 ACUGGCGCUUCUAUCUGAUUA 2292 TTACTCTGAGCGCCATCA CUCUGAGCGCCAUCACCAGCG CCAGCGACTATGTCGTAG ACUAUGUCGUAGUGGGUAAAG TGGGTAAAGCCGCTTACG CCGCUUACGGACUUCGGUCCG GACTTCGGTCCGTAAGAG UAAGAGGCAUCAGAG GCATCAGAG 316 n/a ACTGGCGCTTCTATCTGA 9335 ACUGGCGCUUCUAUCUGAUUA 9588 TTACTCTGAGCGCCATCA CUCUGAGCGCCAUCACCAGCG CCAGCGACTATGTCGTAG ACUAUGUCGUAGUGGGUAAAG TGGGTAAAGCTCCCTCTT CUCCCUCUUCGGAGGGAGCAU CGGAGGGAGCATCAGAG CAGAG 320 5.CG.GC; ACTGGGCCTTCTATCTGA 3751 ACUGGGCCUUCUAUCUGAUUA 2376 28.CG.GC;64. TTACTCTGAGGCCCATCA CUCUGAGGCCCAUCACCAGCG TCCCTCTTC CCAGCGACTATGTCGTAG ACUAUGUCGUAGUGGGUAAAG GGAGGGA. TGGGTAAAGCCGCTTAGG CCGCUUAGGGACUUCGGUCCC CGCTTAGGG GACTTCGGTCCCTAAGAG UAAGAGGCAUCAGAG ACTTCGGTC GCATCAGAG CCTAAGAG 332 5.CG.GC; ACTGGGCCTTCTATCTGA 3763 ACUGGGCCUUCUAUCUGAUUA 2391 28.CG.GC; TTACTCTGAGGCCCATCA CUCUGAGGCCCAUCACCAGCG 74.-.A CCAGCGACTATGTCGTAG ACUAUGUCGUAGUGGGUAAAG TGGGTAAAGCTCCCTCTT CUCCCUCUUCAGGAGGGAGCA CAGGAGGGAGCATCAGAG UCAGAG 376 6.-.T ACTGGCTGCTTCTATCTG 9610 ACUGGCUGCUUCUAUCUGAUU 9627 ATTACTCTGAGCGCCATC ACUCUGAGCGCCAUCACCAGC ACCAGCGACTATGTCGTA GACUAUGUCGUAGUGGGUAAA GTGGGTAAAGCTCCCTCT GCUCCCUCUUCGGAGGGAGCA TCGGAGGGAGCATCAGAG UCAGAG 377 6.-.G ACTGGCGGCTTCTATCTG 9611 ACUGGCGGCUUCUAUCUGAUU 9628 ATTACTCTGAGCGCCATC ACUCUGAGCGCCAUCACCAGC ACCAGCGACTATGTCGTA GACUAUGUCGUAGUGGGUAAA GTGGGTAAAGCTCCCTCT GCUCCCUCUUCGGAGGGAGCA TCGGAGGGAGCATCAGAG UCAGAG 378 6.-.G;26.A.T ACTGGCGGCTTCTATCTG 9612 ACUGGCGGCUUCUAUCUGAUU 9629 ATTACTCTGTGCGCCATC ACUCUGUGCGCCAUCACCAGC ACCAGCGACTATGTCGTA GACUAUGUCGUAGUGGGUAAA GTGGGTAAAGCTCCCTCT GCUCCCUCUUCGGAGGGAGCA TCGGAGGGAGCATCAGAG UCAGAG 379 6.-.G;27.-.G ACTGGCGGCTTCTATCTG 9613 ACUGGCGGCUUCUAUCUGAUU 9630 ATTACTCTGAGGCGCCAT ACUCUGAGGCGCCAUCACCAG CACCAGCGACTATGTCGT CGACUAUGUCGUAGUGGGUAA AGTGGGTAAAGCTCCCTC AGCUCCCUCUUCGGAGGGAGC TTCGGAGGGAGCATCAGA AUCAGAG G 380 6.-.T;28.-.C ACTGGCTGCTTCTATCTG 9614 ACUGGCUGCUUCUAUCUGAUU 9631 ATTACTCTGAGCCGCCAT ACUCUGAGCCGCCAUCACCAG CACCAGCGACTATGTCGT CGACUAUGUCGUAGUGGGUAA AGTGGGTAAAGCTCCCTC AGCUCCCUCUUCGGAGGGAGC TTCGGAGGGAGCATCAGA AUCAGAG G 381 6.-.C;27.-.G ACTGGCCGCTTCTATCTG 9615 ACUGGCCGCUUCUAUCUGAUU 9632 ATTACTCTGAGGCGCCAT ACUCUGAGGCGCCAUCACCAG CACCAGCGACTATGTCGT CGACUAUGUCGUAGUGGGUAA AGTGGGTAAAGCTCCCTC AGCUCCCUCUUCGGAGGGAGC TTCGGAGGGAGCATCAGA AUCAGAG G 382 28.-.C ACTGGCGCTTCTATCTGA 9616 ACUGGCGCUUCUAUCUGAUUA 9633 TTACTCTGAGCCGCCATC CUCUGAGCCGCCAUCACCAGC ACCAGCGACTATGTCGTA GACUAUGUCGUAGUGGGUAAA GTGGGTAAAGCTCCCTCT GCUCCCUCUUCGGAGGGAGCA TCGGAGGGAGCATCAGAG UCAGAG 383 28.-T ACTGGCGCTTCTATCTGA 9617 ACUGGCGCUUCUAUCUGAUUA 9634 TTACTCTGAGTCGCCATC CUCUGAGUCGCCAUCACCAGC ACCAGCGACTATGTCGTA GACUAUGUCGUAGUGGGUAAA GTGGGTAAAGCTCCCTCT GCUCCCUCUUCGGAGGGAGCA TCGGAGGGAGCATCAGAG UCAGAG 384 6.-.G;28.-.C ACTGGCGGGTTCTATCTG 9618 ACUGGCGGGUUCUAUCUGAUU 9635 ATTACTCTGAGCCGCCAT ACUCUGAGCCGCCAUCACCAG CACCAGCGACTATGTCGT CGACUAUGUCGUAGUGGGUAA AGTGGGTAAAGCTCCCTC AGCUCCCUCUUCGGAGGGAGC TTCGGAGGGAGCATCAGA AUCAGAG G 385 6.-.C ACTGGCCGCTTCTATCTG 9619 ACUGGCCGCUUCUAUCUGAUU 9636 ATTACTCTGAGCGCCATC ACUCUGAGCGCCAUCACCAGC ACCAGCGACTATGTCGTA GACUAUGUCGUAGUGGGUAAA GTGGGTAAAGCTCCCTCT GCUCCCUCUUCGGAGGGAGCA TCGGAGGGAGCATCAGAG UCAGAG 386 5.C.T;6.-.G ACTGGTGGCTTCTATCTG 9620 ACUGGUGGCUUCUAUCUGAUU 9637 ATTACTCTGAGCGCCATC ACUCUGAGCGCCAUCACCAGC ACCAGCGACTATGTCGTA GACUAUGUCGUAGUGGGUAAA GTGGGTAAAGCTCCCTCT GCUCCCUCUUCGGAGGGAGCA TCGGAGGGAGCATCAGAG UCAGAG 387 6.-.G ACTGGCGGGTTCTATCTG 9621 ACUGGCGGGUUCUAUCUGAUU 9638 ATTACTCTGAGCGCCATC ACUCUGAGCGCCAUCACCAGC ACCAGCGACTATGTCGTA GACUAUGUCGUAGUGGGUAAA GTGGGTAAAGCTCCCTCT GCUCCCUCUUCGGAGGGAGCA TCGGAGGGAGCATCAGAG UCAGAG 388 6.-.G;28.-.C ACTGGCGGCTTCTATCTG 9622 ACUGGCGGCUUCUAUCUGAUU 9639 ATTACTCTGGGCCGCCAT ACUCUGGGCCGCCAUCACCAG CACCAGCGACTATGTCGT CGACUAUGUCGUAGUGGGUAA AGTGGGTAAAGCTCCCTC AGCUCCCUCUUCGGAGGGAGC TTCGGAGGGAGCATCAGA AUCAGAG G 389 2.TGGC.CTG ACCTGTAGGCTTCTATCT 9623 ACCUGUAGGCUUCUAUCUGAU 9640 TAG;26.- GATTACTCTGCTACAGCG UACUCUGCUACAGCGCCAUCA CTAC CCATCACCAGCGACTATG CCAGCGACUAUGUCGUAGUGG TCGTAGTGGGTAAAGCTC GUAAAGCUCCCUCUUCGGAGG CCTCTTCGGAGGGAGCAT GAGCAUCAGAG CAGAG 390 2.TGGC.CAG ACCAGCAAGCTTCTATCT 9624 ACCAGCAAGCUUCUAUCUGAU 9641 CAA;26.- GATTACTCTGTTGCTGCG UACUCUGUUGCUGCGCCAUCA .TTGC CCATCACCAGCGACTATG CCAGCGACUAUGUCGUAGUGG TCGTAGTGGGTAAAGCTC GUAAAGCUCCCUCUUCGGAGG CCTCTTCGGAGGGAGCAT GAGCAUCAGAG CAGAG 391 2.TGGC.CGA ACCGAGACGCTTCTATCT 9625 ACCGAGACGCUUCUAUCUGAU 9642 GAC;26.A.GG GATTACTCTGGGCTCGCG UACUCUGGGCUCGCGCCAUCA CTC CCATCACCAGCGACTATG CCAGCGACUAUGUCGUAGUGG TCGTAGTGGGTAAAGCTC GUAAAGCUCCCUCUUCGGAGG CCTCTTCGGAGGGAGCAT GAGCAUCAGAG CAGAG 392 5.CG.GC;28.C ACTGGGCCTTCTATCTGA 9626 ACUGGGCCUUCUAUCUGAUUA 9643 G.GC TTACTCTGAGGCCCATCA CUCUGAGGCCCAUCACCAGCG CCAGCGACTATGTCGTAG ACUAUGUCGUAGUGGGUAAAG TGGGTAAAGCCGCTTACG CCGCUUACGGACUUCGGUCCG GACTTCGGTCCGTAAGAG UAAGAGGCAUCAGAG GCATCAGAG *positions are numbered relative to the 5end of scaffold 316, with 0being the 5terminus. Each mutation is indicated by its position, reference sequence, and alt sequence, separated by .(e.g., 1.C.A is nucleotide position 1, reference sequence nucleotide C, alternate sequence nucleotide A). Position indexing starts at 0 such that the first base in scaffold 316 is 0.A. Insertions are indicated with a in the reference sequence, and deletions with a in the alt sequence. Multiple individual mutations are semi-colon separated.
Transfection and Assessment of B2M Editing:
[0847] HEK293T cells were lipofected with 100 ng of plasmid encoding CasX variant 515 and a gRNA made up of a scaffold listed in Table 78. The gRNAs had either a non-targeting spacer or a spacer targeting the B2M locus, as listed in Table 79. 24 hours post-transfection, cells were selected with 1 g/mL puromycin for 48 hours, and then allowed to recover for 24 hours. Then, cells were harvested for B2M protein expression analysis via immunostaining of the B2M-dependent HLA protein, followed by flow cytometry using the Attune NxT flow cytometer. Each construct was tested in duplicate, and the transfection and subsequent experiment was performed on two separate occasions.
TABLE-US-00083 TABLE79 SequencesofB2Mandnon-targetingspacersusedinthisexample SpacerID DNAsequence SEQIDNO 7.9 GTGTAGTACAAGAGATAGAA 9644 7.19 CCCCCACTGAAAAAGATGAG 9645 7.43 AGGCCAGAAAGAGAGAGTAG 9646 7.119 CGCTGGATAGCCTCCAGGCC 9647 7.14 TGAAGCTGACAGCATTCGGG 9648 Non-targeting CGAGACGTAATTACGTCTCG 9318
Lentiviral Transduction and Assessment of B2M Editing:
[0848] In a separate experiment, HEK293T cells were transduced with lentiviral particles encoding CasX variant 515 and a gRNA made up of either scaffold 174, 235, 316, 382, or 392. The gRNAs had either a non-targeting spacer or spacer 7.9, 7.19, or 7.119 targeting the B2M locus, as provided in Table 79. Lentiviral particles were generated by transfecting Lenti-X HEK293T cells, seeded 24 hours prior, at a confluency of 70-90%. Plasmids containing the CasX and guide RNA expression cassettes are introduced to a second-generation lentiviral system containing the packaging and VSV-G envelope plasmids with polyethylenimine, in serum-free media. For particle production, media is changed 12 hours post-transfection, and viruses are harvested at 36-48 hours post-transfection. Viral supernatants were filtered using 0.45 m membrane filters, diluted in media, and added to HEK293T target cells cultured at a relatively low multiplicity of infection (MOI) of either 0.1 or 0.05. Transduced cells were grown for three days in a 37PC incubator with 50 C02. Cells were harvested for B2M protein expression analysis via immunostaining of the B2M-dependent LA protein, followed by flow cytometry using the Attune NxT flow cytometer. The lentiviruses also expressed mScarlet, and the mean fluorescence intensity (MFI) of mScarlet was quantified to confirm that the cells contained similar amounts of transduced lentivirus.
Results
[0849] Editing of the B2M locus was measured in HEK293T cells transfected with plasmids expressing CasX variant 515 and gRNAs made up of the scaffolds listed in Table 78. The results are provided in Table 80, below.
TABLE-US-00084 TABLE 80 Percentage of HEK293T cells with edited B2M locus following transfection with plasmids expressing CasX 515 and gRNAs with mutations to the scaffold pseudoknot stem Percentage of HLA- HEK293T Scaffold cells with edited B2M locus* no. First transfection Second transfection Non-targeting spacer 174 24.3 22.5 4.2 5.2 235 1.7 1.4 3.5 4.3 316 4.1 3.1 3.9 316 1 3.8 3.6 4.5 320 1.4 1.4 2.5 3.1 332 1.6 1.6 2.5 3.6 376 3.2 4.9 4.3 5.4 377 0.6 5.6 5 6.3 378 0.8 4.8 4.3 6 379 1.3 5.6 5 6.7 380 1.3 4.8 4.7 5.1 381 1.3 5.1 4.6 7.3 381 6.9 5.9 4.3 7 382 1.2 4.5 3.8 6.4 383 1.2 3.7 3.1 5.1 384 1.6 5.3 2.4 5.3 385 1.4 1.2 3.3 3.5 386 1.5 1.2 2.3 2.7 387 1.5 1.1 3 3.7 388 2.7 1.7 5.5 6.3 389 1.6 1.2 2.4 3.1 390 1.3 1.3 2.4 3.1 391 1.4 1.3 2.6 3.4 392 1.6 1.4 3 4.2 Spacer 7.9 174 68.5 62.1 85.4 80.6 235 73.1 68.3 91.8 88.9 316 85.5 82.7 84.7 316 72.6 92.2 91.4 92.2 320 75.4 70.4 92.6 91.2 332 70.5 63.5 85.2 84.4 376 67.8 90.6 89.9 90 377 71.3 90.9 90.4 90.3 378 75.5 90.8 91.2 92.2 379 68 87.9 87.6 87.4 380 65.2 90.5 90.6 90.8 381 67 88.7 88.7 89 381 61.6 86.9 88 88 382 71.9 89.1 90.5 90.6 383 64.7 91.6 91.1 91 384 62.5 79.7 82 83.1 385 68.4 62.5 83.2 81.1 386 72.5 63.1 90.7 91.1 387 74.5 69.4 94 92.9 388 67.8 65.1 89.9 90.1 389 32.2 28.9 54.1 53.8 390 34.5 30.9 57.8 57.7 391 25.9 25.7 55.2 55.4 392 77.1 71.5 93.5 91.6 Spacer 7.19 174 58.6 47.5 81.4 81.7 235 62.5 54.2 90.3 89.8 316 82.6 78.8 83.5 316 63.3 82.9 86.4 86.9 320 67.4 60.3 91.7 92.1 332 1.8 1.5 4.8 7.1 376 52.5 80 78.8 80.2 377 56.6 83.4 84 83.4 378 57.1 83.8 82.9 84.2 379 49.2 72.4 75.8 76 380 45.6 73.6 74.4 76.1 381 49.2 70.7 74.7 76.2 381 43.5 73.5 75.5 78.3 382 59.7 81.9 84.7 86.6 383 50.4 78.7 78.9 80.6 384 45.7 78.9 76.6 77.5 385 54.3 48.9 72.7 71.6 386 56.3 47.6 76.5 77.7 387 64.5 59.1 86.9 89.7 388 48 45.3 75.5 77.6 389 3.1 2.6 8.9 12.9 390 18 15.4 36.4 38.9 391 14.7 12.8 38.5 40.3 392 64.3 58.4 87.6 87.8 Spacer 7.43 174 50.6 43.9 76.2 75.4 235 58.7 52.5 80.4 80.2 316 68 67.1 70.5 316 52.2 78.2 77.7 78.4 320 59.6 53.2 83.9 82.1 332 49.3 40.5 69.9 67.6 376 56.6 80.2 81.6 81.3 377 64.7 81.2 84.1 83.2 378 56.5 76.8 79.6 78.8 379 59.5 77.1 79.2 78.9 380 58.3 77.1 78.9 78.1 381 50.9 71.4 74.2 70.1 381 47.5 66.6 70.7 65.5 382 57.1 75.3 80.7 79.8 383 52.9 72.5 75.3 73.4 384 46.6 71.6 74.6 70.7 385 56.7 46.9 70.9 73.4 386 62.5 48.2 80.5 82.2 387 56.8 49.3 81.8 82.6 388 53.5 48.9 75.1 77.2 389 4.5 4 13.6 18 390 15.1 11.7 29.5 34.5 391 16.2 13.4 33.6 38.7 392 53.8 51.8 82 82.1 Spacer 7.119 174 36.2 32.2 64.6 63.6 235 60.9 55.5 89 87.3 316 66.5 68.5 70.6 316 56.4 73.7 79.5 83.3 320 54.6 46.8 85.3 83.9 332 51.7 46.1 74.8 78.2 376 45.8 66.9 71.8 75.1 377 49 69.4 76.3 79.2 378 45.7 67 75.1 78.1 379 35.2 49.9 59.3 61.8 380 37.9 56.2 66.2 67.3 381 31.9 50.2 52.4 56.8 381 28.9 46.2 50.2 52.5 382 49.8 67.8 71.3 76.3 383 44.2 60.9 65.5 69.6 384 36.8 59.3 64.9 66 385 39.1 32.8 62.8 62.7 386 40.9 33.8 72.7 74.5 387 7.8 6.2 24.1 31.4 388 35.8 30.6 62.2 64.4 389 4.9 3.9 15.3 20 390 4.3 3.9 11.9 17.1 391 3.8 3 9.3 12.9 392 58 50.2 85 83.3 Spacer 7.14 174 47.5 43.7 74.1 76.4 235 31.4 29.6 58 57.2 316 44.8 41.6 40.3 316 31.8 52.7 53.2 55.6 320 36.4 34 59.9 62.3 332 14.8 12.4 25 25.4 376 34.1 55.5 56.1 56.9 377 24.6 45.1 42.7 378 26.9 45.1 43.5 47.5 379 36.1 54.8 56.2 59.3 380 46.6 67.4 70.2 72.3 381 50.8 72.1 73.4 74 381 39.3 35.2 39.4 382 42.2 65.6 66.4 67 383 37 64 64.9 64.9 384 18 38.4 35.1 38.1 385 18.1 16.1 29.6 24 386 36.2 31.6 53.1 53.8 387 33.3 28.2 48.1 51 388 31 25.5 49.3 55.4 389 20.6 17.6 45 45.8 390 8.4 7.9 19.3 22.6 391 52.8 52.9 80.9 78.9 392 42.3 42.6 66.7 67.2 *Data are shown rounded to the nearest tenth.
[0850] Many of the tested scaffolds produced levels of editing that were similar to scaffold 316 and higher than scaffold 174 (Table 80). Surprisingly, some scaffolds produced higher levels of editing than scaffold 316, but only with certain spacers. Specifically, scaffold 391 showed a relatively high level of editing with spacer 7.14, but not other spacers. Scaffold 392 produced overall high levels of editing with multiple spacers, and edited with spacer 7.14 to a greater extent than scaffold 316.
[0851] Scaffolds 174, 235, 316, 382, and 392 were also tested via lentiviral transduction in HEK293T cells at MOIs of 0.1 (
[0852] Overall, the results described herein demonstrate that guide RNA scaffolds with mutations in the pseudoknot stem region can produce gene editing.