RECOMBINANT BOTULINUM NEUROTOXIN WITH IMPROVED SAFETY MARGIN AND REDUCED IMMUNOGENICITY

20220333091 · 2022-10-20

    Inventors

    Cpc classification

    International classification

    Abstract

    Described herein are recombinant Clostridium botulinum neurotoxins comprising a light chain of a Clostridium botulinum neurotoxin, wherein the light chain comprises a mutation that causes minimal structural interference to the light chain protease; a heavy chain of a Clostridium botulinum neurotoxin, wherein the light and heavy chains are linked by a disulfide bond. The recombinant Clostridium botulinum neurotoxin has a 2-20 fold reduced toxicity compared to wild type Clostridium botulinum neurotoxin. Also described is a treatment method.

    Claims

    1. A recombinant Clostridium botulinum neurotoxin comprising: a light chain of a Clostridium botulinum neurotoxin, wherein the light chain comprises a mutation corresponding to Y.sub.366>X of BoNT A, wherein X is an amino acid that causes minimal structural interference to the light chain protease; a heavy chain of a Clostridium botulinum neurotoxin, wherein the light and heavy chains are linked by a disulfide bond; wherein the recombinant Clostridium botulinum neurotoxin has a 2-20 fold reduced toxicity compared to wild type Clostridium botulinum neurotoxin.

    2. The recombinant Clostridium botulinum neurotoxin of claim 1, wherein X is phenylalanine.

    3. The recombinant Clostridium botulinum neurotoxin of claim 1, wherein the recombinant Clostridium botulinum neurotoxin has a 5 fold reduced toxicity compared to wild type Clostridium botulinum neurotoxin.

    4. A treatment method comprising: selecting a subject in need of therapeutic treatment involving induction of muscle paralysis and contacting the subject with the recombinant Clostridium botulinum neurotoxin of claim 1 to induce muscle paralysis in the subject to treat the subject, with the proviso that the neurotoxin derivative does not possess a cargo attachment peptide sequence at its N-terminus.

    5. The method according to claim 4, wherein the treatment is for a dermatologic or aesthetic condition selected from the group consisting of Rhytides, hypertrophic masseter muscles, and focal hyperhydrosis.

    6. The method according to claim 4, wherein the treatment is for a gastroenterological condition selected from the group consisting of esophageal motility disorders, pharyngeal-esophageal spasm, and anal fissure.

    7. The method according to claim 4, wherein the treatment is for a genitourinaric condition selected from the group consisting of neurogenic dysfunction of the urinary tract, overactive bladder, and neuromodulation of urinary urge incontinence.

    8. The method according to claim 4, wherein the treatment is for a neurologic condition selected from the group consisting of tourettes syndrome, focal muscle spasticity or dystonias, cervical dystonia, primary blepharospasm, hemifacial spasm, spasmodic dysphonia, facial nerve disorders, Rasmussen syndrome, amputation pain, voice tremor, crocodile tear syndrome, marginal mandibular nerve paralysis, pain, chest pain of esophageal origin, headache, cerebral palsy, hip adductor muscle dysfunction in multiple sclerosis, neurogenic pain and inflammation, arthritis, iatrogenic parotid sialocele, and chronic TMJ pain and displacement.

    9. A recombinant Clostridium botulinum neurotoxin comprising: a light chain of a Clostridium botulinum neurotoxin, wherein the light chain comprises a mutation corresponding to E.sub.224>X of BoNT A, wherein X is an amino acid that causes minimal structural interference to the light chain protease; a heavy chain of a Clostridium botulinum neurotoxin, wherein the light and heavy chains are linked by a disulfide bond; wherein the recombinant Clostridium botulinum neurotoxin has a 2-20 fold reduced toxicity compared to wild type Clostridium botulinum neurotoxin.

    10. The recombinant Clostridium botulinum neurotoxin of claim 9, wherein X is glutamine.

    11. The recombinant Clostridium botulinum neurotoxin of claim 9, wherein the recombinant Clostridium botulinum neurotoxin has a 5 fold reduced toxicity compared to wild type Clostridium botulinum neurotoxin.

    12. A treatment method comprising: selecting a subject in need of therapeutic treatment involving induction of muscle paralysis and contacting the subject with the recombinant Clostridium botulinum neurotoxin of claim 9 to induce muscle paralysis in the subject to treat the subject, with the proviso that the neurotoxin derivative does not possess a cargo attachment peptide sequence at its N-terminus.

    13. The method according to claim 12, wherein the treatment is for a dermatologic or aesthetic condition selected from the group consisting of Rhytides, hypertrophic masseter muscles, and focal hyperhydrosis.

    14. The method according to claim 12, wherein the treatment is for a gastroenterological condition selected from the group consisting of esophageal motility disorders, pharyngeal-esophageal spasm, and anal fissure.

    15. The method according to claim 12, wherein the treatment is for a genitourinaric condition selected from the group consisting of neurogenic dysfunction of the urinary tract, overactive bladder, and neuromodulation of urinary urge incontinence.

    16. The method according to claim 12, wherein the treatment is for a neurologic condition selected from the group consisting of tourettes syndrome, focal muscle spasticity or dystonias, cervical dystonia, primary blepharospasm, hemifacial spasm, spasmodic dysphonia, facial nerve disorders, Rasmussen syndrome, amputation pain, voice tremor, crocodile tear syndrome, marginal mandibular nerve paralysis, pain, chest pain of esophageal origin, headache, cerebral palsy, hip adductor muscle dysfunction in multiple sclerosis, neurogenic pain and inflammation, arthritis, iatrogenic parotid sialocele, and chronic TMJ pain and displacement.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0013] FIGS. 1A-B are a comparative alignment of amino acid sequences of representative subtypes of seven wild type botulinum neurotoxin serotypes, including Clostridium botulinum serotype A1 (wt BoNT A) (SEQ ID NO:1), Clostridium botulinum serotype B1 (wt BoNT B) (SEQ ID NO:2), Clostridium botulinum serotype C1 (wt BoNT C) (SEQ ID NO:3), Clostridium botulinum serotype D (wt BoNT D) (SEQ ID NO:4), Clostridium botulinum serotype E1 (wt BoNT E) (SEQ ID NO:5), Clostridium botulinum serotype F1 (wt BoNT F) (SEQ ID NO:6), and Clostridium botulinum serotype G (wt BoNT G) (SEQ ID NO:7). Gaps have been introduced to maximize homology. Amino acids identical in ≥50% of compared sequences are shown in black boxes. Amino acids constituting the active site of the catalytic domain of metalloprotease are marked by stars. Disulfide bridge between neurotoxin cysteine residues of the light and heavy chain are shown as a long horizontal bracket. The amino acid residues constituting the minimal catalytic domain of the light chain are grey highlighted. The first amino acid of the protein heavy chain, is shown with a white arrow (and labeled Heavy Chain), as is the first amino acid considered to constitute the receptor-binding domain (labeled Receptor Binding Domain). Amino acids absent in the mature dichain BoNT A molecule along with the aligned amino acids of the other BoNT serotypes are boxed. A white arrow is also positioned at the first amino acid of the neurotoxins' light chain.

    [0014] FIG. 2 is a photograph showing the results of in vivo studies performed by intramuscular injection into the lateral gastrocnemius with 0.5 μg/mouse of BoNT A/ad-0 (experimental) in 3 μl of 0.9% NaCl or by injecting 3 μl of 0.9% of NaCl without BoNT A/ad-0 (control). Muscle paralysis and digital abduction was recorded 48 hours after. The two upper panel photographs show control mice, with the arrow in the upper right photograph indicating the site of injection. The three lower panel photographs show experimental mice. Digital abduction muscle paralysis was only observed in mice injected with BoNT A/ad-0.Experimental, n=10. Control, n=5. Representative results are shown in the photographs in the three bottom panels.

    [0015] FIG. 3 depicts Cyto-014 production. Lanes 1-12: SDS-PAGE analysis of Cyto-014 purification by tandem Ni-NTA and StrepTactin affinity chromatography. Lanes 13-16: SDSPAGE (reducing and non-reducing) confirming TEV protease activation of Cyto-014. Lane 2—clarified Cyto-014-containing media (Ni-NTA loading material); 3—Ni-NTA flow through; 4-6—sequential washes with low imidazole; 7-250 mM imidazole eluate; 8-11—StrepTactin flow through and washes; 12-5 mMD-desthiobiotin eluate (purified Cyto-014); 13,14-2.5 μm and 1 μg activated Cyto-014, non-reduced; 15,16-2.5 μg and 1 μg activated Cyto-014, reduced (˜150-kD uncleaned.

    [0016] FIG. 4 demonstrates that Cyto-014 cleaves SNAP-25 as efficiently as wild type BoNT A1 in vitro per Murine Lethality Assay Unit added to neuronal cultures (see Pearce et al., “Measurement of botulinum Toxin Activity: Evaluation of the Lethality Assay,” Toxicol Appl Pharmacol. 128:69-77 (1994), which is hereby incorporated by reference in its entirety). Primary fetal rat neurons were cultured as described previously and treated with Cyto-014 (lanes 1-4) or wt BoNT A1 (lanes 5-8). Each molecule showed similar extent of SNAP25 cleavage when normalized to LD.sub.50 units.

    [0017] FIG. 5 demonstrates that Cyto-014 IP-LD.sub.50 is ˜8-fold less toxic than wt BoNT A1. The dose-response for IP toxicity was determined by injecting Cyto-014 (closed circles) or wt BoNT A1 (open circles), into the intraperitoneal space of CD-1 mice (n=5 per dose group) and assessing their survival over 5 days. The Cyto-014 IP-LD.sub.50 was determined to be 35 pg for a 25-g mouse, 8-fold less toxic than the IP-LD.sub.50 of 4.6 pg for wt BoNT A1.

    [0018] FIG. 6 demonstrates that Cyto-014 IM-LD.sub.50 is ˜7-fold higher than IP-LD.sub.50. The dose-response for IM toxicity was determined by injecting Cyto-014 (closed circles) or wt BoNT A1 (open circles) into the lateral gastrocnemius muscle of CD-1 mice (n=5 to 10 per dose group) and assessing their survival over 5 days. The Cyto-014 IMLD.sub.50 was determined to be 240 pg for a 25-g mouse.

    [0019] FIG. 7 demonstrates that Cyto-014 IM ED.sub.50 is ˜16-fold higher than wt BoNT/1. The dose-response for DAS scores was determined by injecting Cyto-014 (closed circles) or wt BoNT A1 (open circles) into the lateral gastrocnemius muscle of CD-1 mice (n=5 to 10 per dose group) and assessing their ipsilateral DAS over 9 days. The Cyto-014 IM-ED.sub.50 was determined from the peak DAS of each mouse during monitoring, and calculated to be 12 pg for a 25-g mouse.

    [0020] FIGS. 8A-8D depict results of a pooled sera ELISA experiment described in Example 3.

    [0021] FIGS. 9A-9B depict the results of an individual sera ELISA experiment described in Example 3.

    [0022] FIG. 10 depicts a F-140 monoclonal antibody standard curve used in the ELISA experiments described in Example 3.

    [0023] FIGS. 11A-11B depict the results of the mouse protection assay described in Example 3.

    DETAILED DESCRIPTION OF THE INVENTION

    [0024] Described herein is a recombinant Clostridium botulinum neurotoxin comprising a light chain of a Clostridium botulinum neurotoxin, where the light chain comprises a mutation corresponding to Y.sub.366>X of BoNT A, where X is an amino acid that causes minimal structural interference to the light chain protease; a heavy chain of a Clostridium botulinum neurotoxin, where the light and heavy chains are linked by a disulfide bond. The recombinant Clostridium botulinum neurotoxin has a 2-20 fold reduced toxicity compared to wild type Clostridium botulinum neurotoxin.

    [0025] Further described herein is a recombinant Clostridium botulinum neurotoxin comprising a light chain of a Clostridium botulinum neurotoxin, where the light chain comprises a mutation corresponding to E.sub.224>X of BoNT A, where X is a amino acid that causes minimal structural intereference to the light chain protease; a heavy chain of a Clostridium botulinum neurotoxin, where the light and heavy chains are linked by a disulfide bond. The recombinant Clostridium botulinum neurotoxin has a 2-20 fold reduced toxicity compared to wild type Clostridium botulinum neurotoxin.

    [0026] Also described is a treatment method. This method involves selecting a subject in need of therapeutic treatment involving induction of muscle paralysis and contacting the subject with a recombinant Clostridium botulinum neurotoxin disclosed herein to induce muscle paralysis in the subject to treat the subject, with the proviso that the neurotoxin derivative does not possess a cargo attachment peptide sequence at its N-terminus.

    [0027] According to one embodiment, the Clostridium botulinum neurotoxin is a derivative of a Clostridium botulinum neurotoxin. Clostridium botulinum has multiple serotypes, including BoNT A-G (SEQ ID NOs:1-7), BoNT/H (GenBank Accession No. KG015617, which is hereby incorporated by reference in its entirety), and BoNT/X (GenBank Accession No. WP_045538952, and Masuyer et al., “Structural Characterisation of the Catalytic Domain of botulinum Neurotoxin X—High Activity and Unique Substrate Specificity,” Nature 8:4518 (2017), which are each hereby incorporated by reference in their entirety) as well as numerous subtypes. See also Peck et al., “Historical Perspectives and Guidelines for botulinum Neurotoxin Subtype Nomenclature,” Toxins 9:38 (2017); Pirazzini et al., “botulinum Neurotoxins: Biology, Pharmacology, and Toxicology,” Pharmacological Reviews 69:200-235 (2017), which are hereby incorporated by reference in their entirety. Suitable derivatives of a Clostridium botulinum neurotoxin may be derivatives of any of the Clostridium botulinum serotypes and subtypes. In addition, suitable Clostridium botulinum neurotoxin of the present application may be derivatives of more than one Clostridium botulinum serotype and subtype. For example, it may be desirable to have a derivative of a Clostridium botulinum neurotoxin constructed of a light chain (LC) region from one Clostridium botulinum serotype (e.g., serotype A, BoNT A1) and a heavy chain (HC) region from another Clostridium botulinum serotype (e.g., serotype B, BoNT B1). Also, suitable Clostridium botulinum neurotoxins of the present application include chimeras using other receptor ligands, e.g., epidermal growth factor (“EGF”) for LC delivery to cancer cells (see U.S. Patent Application Publication no. 2012/0064059 to Foster et al., which is hereby incorporated by reference in its entirety).

    [0028] An example of Clostridium botulinum serotype A1 (wild type BoNT A1) has an amino acid sequence as set forth in GenBank Accession No. CAL82360, which is hereby incorporated by reference in its entirety (SEQ ID NO:1):

    TABLE-US-00001 MPFVNKQFNY KDPVNGVDIA YIKIPNAGQM QPVKAFKIHN KIWVIPERDT FTNPEEGDLN PPPEAKQVPV SYYDSTYLST DNEKDNYLKG VTKLFERIYS TDLGRMLLTS IVRGIPFWGG STIDTELKVI DTNCINVIQP DGSYRSEELN LVIIGPSADI IQFECKSFGH EVLNLTRNGY GSTQYIRFSP DFTFGFEESL EVDTNPLLGA GKFATDPAVT LAHELIHAGH RLYGIAINPN RVFKVNTNAY YEMSGLEVSF EELRTFGGHD AKFIDSLQEN EFRLYYYNKF KDIASTLNKA KSIVGTTASL QYMKNVFKEK YLLSEDTSGK FSVDKLKFDK LYKMLTEIYT EDNFVKFFKV LNRKTYLNFD KAVFKINIVP KVNYTIYDGF NLRNTNLAAN FNGQNTEINN MNFTKLKNFT GLFEFYKLLC VRGIITSKTK SLDKGYNKAL NDLCIKVNNW DLFFSPSEDN FTNDLNKGEE ITSDTNIEAA EENISLDLIQ QYYLTFNFDN EPENISIENL SSDIIGQLEL MPNIERFPNG KKYELDKYTM FHYLRAQEFE HGKSRIALTN SVNEALLNPS RVYTFFSSDY VKKVNKATEA AMFLGWVEQL VYDFTDETSE VSTTDKIADI TIIIPYIGPA LNIGNMLYKD DFVGALIFSG AVILLEFIPE IAIPVLGTFA LVSYIANKVL TVQTIDNALS KRNEKWDEVY KYIVTNWLAK VNTQIDLIRK KMKEALENQA EATKAIINYQ YNQYTEEEKN NINFNIDDLS SKLNESINKA MININKFLNQ CSVSYLMNSM IPYGVKRLED FDASLKDALL KYIYDNRGTL IGQVDRLKDK VNNTLSTDIP FQLSKYVDNQ RLLSTFTEYI KNIINTSILN LRYESNHLID LSRYASKINI GSKVNFDPID KNQIQLFNLE SSKIEVILKN AIVYNSMYEN FSTSFWIRIP KYFNSISLNN EYTIINCMEN NSGWKVSLNY GEIIWTLQDT QEIKQRVVFK YSQMINISDY INRWIFVTIT NNRLNNSKIY INGRLIDQKP ISNLGNIHAS NNIMFKLDGC RDTHRYIWIK YFNLFDKELN EKEIKDLYDN QSNSGILKDF WGDYLQYDKP YYMLNLYDPN KYVDVNNVGI RGYMYLKGPR GSVMTTNIYL NSSLYRGTKF IIKKYASGNK DNIVRNNDRV YINVVVKNKE YRLATNASQA GVEKILSALE IPDVGNLSQV VVMKSKNDQG ITNKCKMNLQ DNNGNDIGFI GFHQFNNIAK LVASNWYNRQ IERSSRTLGC SWEFIPVDDG WGERPL

    [0029] An example of Clostridium botulinum serotype B1 (wild type BoNT B1) has an amino acid sequence as set forth in GenBank Accession No. ACA46990, which is hereby incorporated by reference in its entirety (SEQ ID NO:2):

    TABLE-US-00002 MPVTINNFNY NDPIDNNNII MMEPPFARGT GRYYKAFKIT DRIWIIPERY TFGYKPEDFN KSSGIFNRDV CEYYDPDYLN TNDKKNIFLQ TMIKLFNRIK SKPLGEKLLE MIINGIPYLG DRRVPLEEFN TNIASVTVNK LISNPGEVER KKGIFANLII FGPGPVLNEN ETIDIGIQNH FASREGFGGI MQMKFCPEYV SVFNNVQENK GASIFNRRGY FSDPALILMH ELIHVLHGLY GIKVDDLPIV PNEKKFFMQS TDAIQAEELY TFGGQDPSII TPSTDKSIYD KVLQNFRGIV DRLNKVLVCI SDPNININIY KNKFKDKYKF VEDSEGKYSI DVESFDKLYK SLMFGFTETN IAENYKIKTR ASYFSDSLPP VKIKNLLDNE IYTIEEGFNI SDKDMEKEYR GQNKAINKQA YEEISKEHLA VYKIQMCKSV KAPGICIDVD NEDLFFIADK NSFSDDLSKN ERIEYNTQSN YIENDFPINE LILDTDLISK IELPSENTES LTDFNVDVPV YEKQPAIKKI FTDENTIFQY LYSQTFPLDI RDISLTSSFD DALLFSNKVY SFFSMDYIKT ANKVVEAGLF AGWVKQIVND FVIEANKSNT MDKIADISLI VPYIGLALNV GNETAKGNFE NAFEIAGASI LLEFIPELLI PVVGAFLLES YIDNKNKIIK TIDNALTKRN EKWSDMYGLI VAQWLSTVNT QFYTIKEGMY KALNYQAQAL EEIIKYRYNI YSEKEKSNIN IDFNDINSKL NEGINQAIDN INNFINGCSV SYLMKKMIPL AVEKLLDFDN TLKKNLLNYI DENKLYLIGS AEYEKSKVNK YLKTIMPFDL SIYTNDTILI EMFNKYNSEI LNNIILNLRY KDNNLIDLSG YGAKVEVYDG VELNDKNQFK LTSSANSKIR VTQNQNIIFN SVFLDFSVSF WIRIPKYKND GIQNYIHNEY TIINCMKNNS GWKISIRGNR IIWTLIDING KTKSVFFEYN IREDISEYIN RWFFVTITNN LNNAKIYING KLESNTDIKD IREVIANGEI IFKLDGDIDR TQFIWMKYFS IFNTELSQSN IEERYKIQSY SEYLKDFWGN PLMYNKEYYM FNAGNKNSYI KLKKDSPVGE ILTRSKYNQN SKYINYRDLY IGEKFIIRRK SNSQSINDDI VRKEDYIYLD FFNLNQEWRV YTYKYFKKEE EKLFLAPISD SDEFYNTIQI KEYDEQPTYS CQLLFKKDEE STDEIGLIGI HRFYESGIVF EEYKDYFCIS KWYLKEVKRK PYNLKLGCNW QFIPKDEGWT E

    [0030] An example of Clostridium botulinum serotype C1 (wild type BoNT C) has an amino acid sequence as set forth in (SEQ ID NO:3):

    TABLE-US-00003 MPITINNFNY SDPVDNKNIL YLDTHLNTLA NEPEKAFRIT GNIWVIPDRF SRNSNPNLNK PPRVTSPKSG YYDPNYLSTD SDKDPFLKEI IKLFKRINSR EIGEELIYRL STDIPFPGNN NTPINTFDFD VDFNSVDVKT RQGNNWVKTG SINPSVIITG PRENIIDPET STFKLTNNTF AAQEGFGALS IISISPRFML TYSNATNDVG EGRFSKSEFC MDPILILMHE LNHAMHNLYG IAIPNDQTIS SVTSNIFYSQ YNVKLEYAEI YAFGGPTIDL IPKSARKYFE EKALDYYRSI AKRLNSITTA NPSSFNKYIG EYKQKLIRKY RFVVESSGEV TVNRNKFVEL YNELTQIFTE FNYAKIYNVQ NRKIYLSNVY TPVTANILDD NVYDIQNGFN IPKSNLNVLF MGQNLSRNPA LRKVNPENML YLFTKFCHKA IDGRSLYNKT LDCRELLVKN TDLPFIGDIS DVKTDIFLRK DINEETEVIY YPDNVSVDQV ILSKNTSEHG QLDLLYPSID SESEILPGEN QVFYDNRTQN VDYLNSYYYL ESQKLSDNVE DFTFTRSIEE ALDNSAKVYT YFPTLANKVN AGVQGGLFLM WANDVVEDFT TNILRKDTLD KISDVSAIIP YIGPALNISN SVRRGNFTEA FAVTGVTILL EAFPEFTIPA LGAFVIYSKV QERNEIIKTI DNCLEQRIKR WKDSYEWMMG TWLSRIITQF NNISYQMYDS LNYQAGAIKA KIDLEYKKYS GSDKENIKSQ VENLKNSLDV KISEAMNNIN KFIRECSVTY LFKNMLPKVI DELNEFDRNT KAKLINLIDS HNIILVGEVD KLKAKVNNSF QNTIPFNIFS YTNNSLLKDI INEYFNNIND SKILSLQNRK NTLVDTSGYN AEVSEEGDVQ LNPIFPFDFK LGSSGEDRGK VIVTQNENIV YNSMYESFSI SFWIRINKWV SNLPGYTIID SVKNNSGWSI GIISNFLVFT LKQNEDSEQS INFSYDISNN APGYNKWFFV TVTNNMMGNM KIYINGKLID TIKVKELTGI NFSKTITFEI NKIPDTGLIT SDSDNINMWI RDFYIFAKEL DGKDINILFN SLQYTNVVKD YWGNDLRYNK EYYMVNIDYL NRYMYANSRQ IVFNTRRNNN DFNEGYKIII KRIRGNTNDT RVRGGDILYF DMTINNKAYN LFMKNETMYA DNHSTEDIYA IGLREQTKDI NDNIIFQIQP MNNTYYYASQ IFKSNFNGENV ISGICSIGTY RFRLGGDWYR HNYLVPTVKQ GNYASLLEST STHWGFVPVS E

    [0031] An example of Clostridium botulinum serotype D (wild type BoNT D) has an amino acid sequence as set forth in (SEQ ID NO:4):

    TABLE-US-00004 MTWPVKDFNY SDPVNDNDIL YLRIPQNKLI TTPVKAFMIT QNIWVIPERF SSDTNPSLSK PPRPTSKYQS YYDPSYLSTD EQKDTFLKGI IKLFKRINER DIGKKLINYL VVGSPFMGDS STPEDTFDFT RHTTNIAVEK FENGSWKVTN IITPSVLIFG PLPNILDYTA SLTLQGQQSN PSFEGFGTLS ILKVAPEFLL TFSDVTSNQS SAVLGKSIFC MDPVIALMHE LTHSLHQLYG INIPSDKRIR PQVSEGFFSQ DGPNVQFEEL YTFGGLDVEI IPQIERSQLR EKALGHYKDI AKRLNNINKT IPSSWISNID KYKKIFSEKY NFDKDNTGNF VVNIDKFNSL YSDLTNVMSE VVYSSQYNVK NRTHYFSRHY LPVFANILDD NIYTIRDGFN LTNKGFNIEN SGQNIERNPA LQKLSSESVV DLFTKVCLRL TKNSRDDSTC IKVKNNRLPY VADKDSISQE IFENKIITDE TNVQNYSDNF SLDESILDGQ VPINPEIVDP LLPNVNMEPL NLPGEEIVFY DDITKYVDYL NSYYYLESQK LSNNVENITL TTSVEEALGY SNKIYTFLPS LAEKVNKGVQ AGLFLNWANE VVEDFTTNIM KKDTLDKISD VSVIIPYIGP ALNIGNSALR GNFKQAFATA GVAFLLEGFP EFTIPALGVF TFYSSIQERE KIIKTIENCL EQRVKRWKDS YQWMVSNWLS RITTQFNHIN YQMYDSLSYQ ADAIKAKIDL EYKKYSGSDK ENIKSQVENL KNSLDVKISE AMNNINKFIR ECSVTYLFKN MLPKVIDELN KFDLRTKTEL INLIDSHNII LVGEVDRLKA KVNESFENTM PFNIFSYTNN SLLKDIINEY FNSINDSKIL SLQNKKNALV DTSGYNAEVR VGDNVQLNTI YTNDFKLSSS GDKIIVNLNN NILYSAIYEN SSVSFWIKIS KDLTNSHNEY TIINSIEQNS GWKLCIRNGN IEWILQDVNR KYKSLIFDYS ESLSHTGYTN KWFFVTITNN IMGYMKLYIN GELKQSQKIE DLDEVKLDKT IVFGIDENID ENQMLWIRDF NIFSKELSNE DINIVYEGQI LRNVIKDYWG NPLKFDTEYY IINDNYIDRY IAPESNVLVL VRYPDRSKLY TGNPITIKSV SDKNPYSRIL NGDNIILHML YNSRKYMIIR DTDTIYATQG GECSQNCVYA LKLQSNLGNY GIGIFSIKNI VSKNKYCSQI FSSFRENTML LADIYKPWRF SFKNAYTPVA VTNYETKLLS TSSFWKFISR DPGWVE

    [0032] An example of Clostridium botulinum serotype E1 (wild type BoNT E) has an amino acid sequence as set forth in (SEQ ID NO:5):

    TABLE-US-00005 MPKINSFNYN DPVNDRTILY IKPGGCQEFY KSFNIMKNIW IIPERNVIGT TPQDFHPPTS LKNGDSSYYD PNYLQSDEEK DRFLKIVTKI FNRINNNLSG GILLEELSKA NPYLGNDNTP DNQFHIGDAS AVEIKFSNGS QDILLPNVII MGAEPDLFET NSSNISLRNN YMPSNHGFGS IAIVTFSPEY SFRFNDNSMN EFIQDPALTL MHELIHSLHG LYGAKGITTK YTITQKQNPL ITNIRGTNIE EFLTFGGTDL NIITSAQSND IYTNLLADYK KIASKLSKVQ VSNPLLNPYK DVFEAKYGLD KDASGIYSVN INKFNDIFKK LYSFTEFDLA TKFQVKCRQT YIGQYKYFKL SNLLNDSIYN ISEGYNINNL KVNFRGQNAN LNPRIITPIT GRGLVKKIIR FCKNIVSVKG IRKSICIEIN NGELFFVASE NSYNDDNINT PKEIDDTVTS NNNYENDLDQ VILNFNSESA PGLSDEKLNL TIQNDAYIPK YDSNGTSDIE QHDVNELNVF FYLDAQKVPE GENNVNLTSS IDTALLEQPK IYTFFSSEFI NNVNKPVQAA LFVSWIQQVL VDFTTEANQK STVDKIADIS IVVPYIGLAL NIGNEAQKGN FKDALELLGA GILLEFEPEL LIPTILVFTI KSFLGSSDNK NKVIKAINNA LKERDEKWKE VYSFIVSNWM TKINTQFNKR KEQMYQALQN QVNAIKTIIE SKYNSYTLEE KNELTNKYDI KQIENELNQK VSIAMNNIDR FLTESSISYL MKLINEVKIN KLREYDENVK TYLLNYIIQH GSILGESQQE LNSMVTDTLN NSIPFKLSSY TDDKILISYF NKFFKRIKSS SVLNMRYKND KYVDTSGYDS NININGDVYK YPTNKNQFGI YNDKLSEVNI SQNDYIIYDN KYKNFSISFW VRIPNYDNKI VNVNNEYTII NCMRDNNSGW KVSLNHNEII WTLEDNAGIN QKLAFNYGNA NGISDYINKW IFVTITNDRL GDSKLYINGN LIDQKSILNL GNIHVSDNIL FKIVNCSYTR YIGIRYFNIF DKELDETEIQ TLYSNEPNTN ILKDFWGNYL LYDKEYYLLN VLKPNNFIDR RKDSTLSINN IRSTILLANR LYSGIKVKIQ RVNNSSTNDN LVRKNDQVYI NFVASKTHLF PLYADTATTN KEKTIKISSS GNRFNQVVVM NSVGNNTMNF KNNNGNNIGL LGFKADTVVA STWYYTHMRD HTNSNGCFWN FISEEHGWQE K 

    [0033] An example of Clostridium botulinum serotype F1 (wild type BoNT F) has an amino acid sequence as set forth in (SEQ ID NO:6):

    TABLE-US-00006 MPVVINSFNY NDPVNDDTIL YMQIPYEEKS KKYYKAFEIM RNVWIIPERN TIGTDPSDFD PPASLENGSS AYYDPNYLTT DAEKDRYLKT TIKLFKRINS NPAGEVLLQE ISYAKPYLGN EHTPINEFHP VTRTTSVNIK SSTNVKSSII LNLLVLGAGP DIFENSSYPV RKLMDSGGVY DPSNDGFGSI NIVTFSPEYE YTFNDISGGY NSSTESFIAD PAISLAHELI HALHGLYGAR GVTYKETIKV KQAPLMIAIK PIRLEEFLTF GGQDLNIITS AMKEKIYNNL LANYEKIATR LSRVNSAPPE YDINEYKDYF QWKYGLDKNA DGSYTVNENK FNEIYKKLYS FTEIDLANKF KVKCRNTYFI KYGFLKVPNL LDDDIYTVSE GFNIGNLAVN NRGQNIKLNP KIIDSIPDKG LVEKIVKFCK SVIPRKGTKA PPRLCIRVNN RELFFVASES SYNENDINTP KEIDDTTNLN NNYRNNLDEV ILDYNSETIP QISNQTLNTL VQDDSYVPRY DSNGTSEIEE HNVVDLNVFF YLHAQKVPEG ETNISLTSSI DTALSEESQV YTFFSSEFIN TINKPVHAAL FISWINQVIR DFTTEATQKS TFDKIADISL VVPYVGLALN IGNEVQKENF KEAFELLGAG ILLEFVPELL IPTILVFTIK SFIGSSENKN KIIKAINNSL MERETKWKEI YSWIVSNWLT RINTQFNKRK EQMYQALQNQ VDAIKTVIEY KYNNYTSDER NRLESEYNIN NIREELNKKV SLAMENIERF ITESSIFYLM KLINEAKVSK LREYDEGVKE YLLDYISEHR SILGNSVQEL NDLVTSTLNN SIPFELSSYT NDKILILYFN KLYKKIKDNS ILDMRYENNK FIDISGYGSN ISINGDVYIY STNRNQFGIY SSKPSEVNIA QNNDIIYNGR YQNFSISFWV RIPKYFNKVN LNNEYTIIDC IRNNNSGWKI SLNYNKIIWT LQDTAGNNQK LVFNYTQMIS ISDYINKWIF VTITNNRLGN SRIYINGNLI DEKSISNLGD IHVSDNILFK IVGCNDTRYV GIRYFKVFDT ELGKTEIETL YSDEPDPSIL KDFWGNYLLY NKRYYLLNLL RTDKSITQNS NFLNINQQRG VYQKPNIFSN TRLYTGVEVI IRKNGSTDIS NTDNFVRKND LAYINVVDRD VEYRLYADIS IAKPEKIIKL IRTSNSNNSL GQIIVMDSIG NNTMNFQNN NGGNIGLLGF HSNNLVASSW YYNNIRKNTS SNGCFWSFIS KEHGWQEN

    [0034] An example of Clostridium botulinum serotype G (wild type BoNT G) has an amino acid sequence as set forth in GenBank Accession No. KIE44899, which is hereby incorporated by reference in its entirety) (SEQ ID NO:7):

    TABLE-US-00007 MPVNIKNFNY NDPINNDDII MMEPFNDPGP GTYYKAFRII DRIWIVPERF TYGFQPDQFN ASTGVFSKDV YEYYDPTYLK TDAEKDKFLK TMIKLFNRIN SKPSGQRLLD MIVDAIPYLG NASTPPDKFA ANVANVSINK KIIQPGAEDQ IKGLMTNLII FGPGPVLSDN FTDSMIMNGH SPISEGFGAR MMIRFCPSCL NVFNNVQENK DTSIFSRRAY FADPALTLMH ELIHVLHGLY GIKISNLPIT PNTKEFFMQH SDPVQAEELY TFGGHDPSVI SPSTDMNIYN KALQNFQDIA NRLNIVSSAQ GSGIDISLYK QIYKNKYDFV EDPNGKYSVD KDKFDKLYKA LMFGFTETNL AGEYGIKTRY SYFSEYLPPI KTEKLLDNTI YTQNEGFNIA SKNLKTEFNG QNKAVNKEAY EEISLEHLVI YRIAMCKPVM YKNTGKSEQC IIVNNEDLFF IANKDSFSKD LAKAETIAYN TQNNTIENNF SIDQLILDND LSSGIDLPNE NTEPFTNFDD IDIPVYIKQS ALKKIFVDGD SLFEYLHAQT FPSNIENLQL TNSLNDALRN NNKVYTFFST NLVEKANTVV GASLFVNWVK GVIDDFTSES TQKSTIDKVS DVSIIIPYIG PALNVGNETA KENFKNAFEI GGAAILMEFI PELIVPIVGF FTLESYVGNK GHIIMTISNA LKKRDQKWTD MYGLIVSQWL STVNTQFYTI KERMYNALNN QSQAIEKIIE DQYNRYSEED KMNINIDFND IDFKLNQSIN LAINNIDDFI NQCSISYLMN RMIPLAVKKL KDFDDNLKRD LLEYIDTNEL YLLDEVNILK SKVNRHLKDS IPFDLSLYTK DTILIQVFNN YISNISSNAI LSLSYRGGRL IDSSGYGATM NVGSDVIFND IGNGQFKLNN SENSNITAHQ SKFVVYDSMF DNFSINFWVR TPKYNNNDIQ TYLQNEYTII SCIKNDSGWK VSIKGNRIIW TLIDVNAKSK SIFFEYSIKD NISDYINKWF SITITNDRLG NANIYINGSL KKSEKILNLD RINSSNDIDF KLINCTDTTK FVWIKDFNIF GRELNATEVS SLYWIQSSTN TLKDFWGNPL RYDTQYYLFN QGMQNIYIKY FSKASMGETA PRTNFNNAAI NYQNLYLGLR FIIKKASNSR NINNDNIVRE GDYIYLNIDN ISDESYRVYV LVNSKEIQTQ LFLAPINDDP TFYDVLQIKK YYEKTTYNCQ ILCEKDTKTF GLFGIGKFVK DYGYVWDTYD NYFCISQWYL RRISENINKL RLGCNWQFIP VDEGWTE

    [0035] By “derivative” it is meant that the Clostridium botulinum neurotoxin is substantially similar to the wild type toxin, but has been modified slightly as described herein. For example, derivatives include Clostridium botulinum neurotoxins that are at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to a wild type neurotoxin.

    [0036] In some embodiments the derivative is a light chain derivative. In some embodiments, the light chain derivative is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the light chain of a wild type neurotoxin. In some embodiments the derivative is a heavy chain derivative. In some embodiments, the heavy chain derivative is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the heavy chain of a wild type neurotoxin.

    [0037] Isolated derivatives of a Clostridium botulinum neurotoxin are physiologically active. This physiological activity includes, but is not limited to, toxin immunogenicity, trans-and intra-cellular trafficking, cell recognition and targeting, and paralytic activity. In one embodiment, Clostridium botulinum neurotoxin is a derivative of a full-length Clostridial neurotoxin. In one embodiment, Clostridium botulinum neurotoxin is a derivative of a light chain Clostridial neurotoxin. In another embodiment, Clostridium botulinum neurotoxin is a derivative of a heavy chain Clostridial neurotoxin.

    [0038] The Clostridium botulinum neurotoxin described herein does not have an S6 peptide sequence fused to the N-terminus of the neurotoxin, as described in U.S. Patent Application Publication No. 2011/0206616 to Icthtchenko and Band, which is hereby incorporated by reference in its entirety.

    [0039] The mechanism of cellular binding and internalization of Clostridial neurotoxins is still not completely understood. The C-terminal portion of the heavy chain of all Clostridial neurotoxins binds to gangliosides (sialic acid-containing glycolipids), with a preference for gangliosides of the G.sub.1b series (Montecucco et al., “Structure and Function of Tetanus and botulinum Neurotoxins,” Q. Rev. Biophys. 28:423-472 (1995); Montecucco, “How Do Tetanus and botulinum Toxins Bind to Neuronal Membranes?” TIBS 11:314-317 (1986); and Van Heyningen et al., “The Fixation of Tetanus Toxin by Ganglioside,” J. Gen. Microbiol. 24:107-119 (1961), which are hereby incorporated by reference in their entirety). The sequence responsible for ganglioside binding has been identified for the structurally similar TeNT molecule, and is located within the 34 C-terminal amino acid residues of its heavy chain. BoNT A, BoNT B, BoNT C, BoNT E, and BoNT F share a high degree of homology with TeNT in this region (FIGS. 1A-1B) (Shapiro et al., “Identification of a Ganglioside Recognition Domain of Tetanus Toxin Using a Novel Ganglioside Photoaffinity Ligand,” J. Biol. Chem. 272:30380-30386 (1997), which is hereby incorporated by reference in its entirety). Multiple types of evidence suggest the existence of at least one additional component involved in the binding of Clostridial neurotoxins to neuronal membranes (Montecucco et al., “Structure and Function of Tetanus and botulinum Neurotoxins,” Q. Rev. Biophys. 28:423-472 (1995); Montecucco, “How Do Tetanus and botulinum Toxins Bind to Neuronal Membranes?” TIBS 11:314-317 (1986), which are hereby incorporated by reference in their entirety). In two reports (Nishiki et al., “The High-Affinity Binding of Clostridium botulinum Type B Neurotoxin to Synaptotagmin II Associated with Gangliosides G.sub.T1b/G.sub.D1a,” FEBS Len. 378:253-257 (1996); Dong et al., “Synaptotagmins I and II Mediate Entry of botulinum Neurotoxin B into Cells,” J. Cell Biol. 162:1293-1303 (2003), which are hereby incorporated by reference in their entirety), synaptotagmins were identified as possible candidates for the auxiliary BoNT B receptor, and synaptotagmins I and II were implicated as neuronal receptors for BoNT G (Rummel et al., “Synaptotagmins I and II Act as Nerve Cell Receptors for botulinum Neurotoxin G,” J. Biol. Chem. 279:30865-30870 (2004), which is hereby incorporated by reference in its entirety). Dong et al., “SV2 is the Protein Receptor for botulinum Neurotoxin A,” Science 312:592-596 (2006), which is hereby incorporated by reference in its entirety, showed that BoNT A enters neurons by binding to the synaptic vesicle protein SV2 (isoforms A, B, and C). However, despite the structural similarity in the putative receptor-binding domain of Clostridial neurotoxins, other toxin subtypes show no affinity for SV2 and instead may target synaptotagmins or synaptotagmin-related molecules. Lipid rafts (Herreros et al., “Lipid Rafts Act as Specialized Domains for Tetanus Toxin Binding and Internalization into Neurons,” Mol. Biol. Cell 12:2947-2960 (2001), which is hereby incorporated by reference in its entirety) have been implicated as a specialized domain involved in TeNT binding and internalization into neurons, but these domains are widely distributed on multiple cell types, and therefore cannot simply explain the high specificity of the toxins for neurons.

    [0040] Clostridial neurotoxins are internalized through the presynaptic membrane by an energy-dependent mechanism (Montecucco et al., “Structure and Function of Tetanus and botulinum Neurotoxins,” Q. Rev. Biophys. 28:423-472 (1995); Matteoli et al., “Synaptic Vesicle Endocytosis Mediates the Entry of Tetanus Neurotoxin into Hippocampal Neurons,” Proc. Natl. Acad. Sci. USA 93:13310-13315 (1996); and Mukherjee et al., “Endocytosis,” Physiol. Rev. 77:759-803 (1997), which are hereby incorporated by reference in their entirety), and rapidly appear in vesicles where they are at least partially protected from degradation (Dolly et al., “Acceptors for botulinum Neurotoxin Reside on Motor Nerve Terminals and Mediate Its Internalization,” Nature 307:457-460 (1984); Critchley et al., “Fate of Tetanus Toxin Bound to the Surface of Primary Neurons in Culture: Evidence for Rapid Internalization,” J. Cell Biol. 100:1499-1507 (1985), which are hereby incorporated by reference in their entirety). The BoNT complex of light and heavy chains interacts with the endocytic vesicle membrane in a chaperone-like way, preventing aggregation and facilitating translocation of the light chain in a fashion similar to the protein conducting/translocating channels of smooth ER, mitochondria, and chloroplasts (Koriazova et al., “Translocation of botulinum Neurotoxin Light Chain Protease through the Heavy Chain Channel,” Nat. Struct. Biol. 10:13-18 (2003), which is hereby incorporated by reference in its entirety). Acidification of the endosome is believed to induce pore formation, which allows translocation of the light chain to the cytosol upon reduction of the interchain disulfide bond (Hoch et al., “Channels Formed by botulinum, Tetanus, and Diphtheria Toxins in Planar Lipid Bilayers: Relevance to Translocation of Proteins Across Membranes,” Proc. Natl. Acad. Sci. USA 82:1692-1696 (1985), which is hereby incorporated by reference in its entirety). Within the cytosol, the light chain displays a zinc-endopeptidase activity specific for protein components of the synaptic vesicle exocytosis apparatus. TeNT and BoNT B, BoNT D, BoNT F, and BoNT G recognize VAMP/synaptobrevin. This integral protein of the synaptic vesicle membrane is cleaved at a single peptide bond, which differs for each neurotoxin. BoNT A, BoNT C, and BoNT E recognize and cleave SNAP-25, a protein of the presynaptic membrane, at different sites within the carboxyl terminus segment. BoNT C also cleaves syntaxin, another protein of the nerve terminal plasmalemma (Montecucco et al., “Structure and Function of Tetanus and botulinum Neurotoxins,” Q. Rev. Biophys. 28:423-472 (1995); Sutton et al., “Crystal Structure of a SNARE Complex Involved in Synaptic Exocytosis at 2.4 {acute over (Å)} Resolution,” Nature 395:347-353 (1998), which are hereby incorporated by reference in their entirety). The cleavage of such components of the synaptic release machinery results in inhibition of acetylcholine release in motor neurons, ultimately leading to neuromuscular paralysis.

    [0041] The isolated Clostridium botulinum neurotoxins employed in the methods of the present application are physiologically active. The endopeptidase activity responsible for Clostridial neurotoxin toxicity is believed to be associated with the presence of a HExxHxxH (SEQ ID NO:8) motif in the light chain, characteristic of metalloproteases (FIGS. 1A-1B). Mutagenesis of BoNT A light chain, followed by microinjection of the corresponding mRNA into presynaptic cholinergic neurons of Aplysia californica, allowed the minimal essential domain responsible for toxicity to be identified (Kurazono et al., “Minimal Essential Domains Specifying Toxicity of the Light Chains of Tetanus Toxin and botulinum Neurotoxin Type A,” J. Biol. Chem. 267:14721-14729 (1992), which is hereby incorporated by reference in its entirety). Site-directed mutagenesis of BoNT A light chain pinpointed the amino acid residues involved in Zn.sup.2+ coordination, and formation of the active metalloendoprotease core which cleaves SNAP-25 (Rigoni et al., “Site-Directed Mutagenesis Identifies Active-Site Residues of the Light Chain of botulinum Neurotoxin Type A,” Biochem. Biophys. Res. Commun. 288:1231-1237 (2001), which is hereby incorporated by reference in its entirety). The three-dimensional structures of Clostridial neurotoxins and their derivatives confirmed the mutagenesis results, and detailed the spatial organization of the protein domains. For the BoNT A holotoxin, crystal structure was obtained to a resolution of 3.3 {acute over (Å)} (Lacy et al., “Crystal Structure of botulinum Neurotoxin Type A and Implications for Toxicity,” Nat. Struct. Biol. 5:898-902 (1998), which is hereby incorporated by reference in its entirety). The BoNT B holotoxin crystal structure was determined at 1.8 and 2.6 A resolution (Swaminathan et al., “Structural Analysis of the Catalytic and Binding Sites of Clostridium botulinum Neurotoxin B,” Nat. Struct. Biol. 7:693-699 (2000), which is hereby incorporated by reference in its entirety). Recently, a crystal structure for BoNT E catalytic domain was determined to 2.1 {acute over (Å)} resolution (Agarwal et al., “Structural Analysis of botulinum Neurotoxin Type E Catalytic Domain and Its Mutant Glu212>Gln Reveals the Pivotal Role of the Glu212 Carboxylate in the Catalytic Pathway,” Biochemistry 43:6637-6644 (2004), which is hereby incorporated by reference in its entirety). The later study provided multiple interesting structural details, and helps explain the complete loss of metalloendoproteolytic activity in the BoNT E LC E.sub.212>Q mutant. The availability of this detailed information on the relationship between the amino acid sequence and biological activities of Clostridial toxins enables the design of modified toxin genes with properties specifically altered for therapeutic goals.

    [0042] Thus, in one embodiment, the Clostridium botulinum neurotoxin has a metalloprotease disabling mutation. Specific metalloprotease disabling mutations are described in U.S. Pat. No. 7,785,606 to Ichthchenko and Band, which is hereby incorporated by reference in its entirety. Additional point mutations can be introduced to further modify the characteristics of the neurotoxin, some of which are also described in U.S. Pat. No. 7,785,606 to Ichthchenko and Band, which is hereby incorporated by reference in its entirety. As used herein, “minimal structural interference” refers to substitutions that minimally alter the structure of the light chain protease active site in order to mantain hydrophobic interactions in the active center.

    [0043] In one embodiment, the metalloprotease disabling mutation corresponds to Y.sub.366>X of BoNT A, where X is an amino acid that causes minimal structural interference to the light chain protease. That is, the Clostridium botulinum neurotoxin comprises a mutation in a wild type BoNT molecule in which tyrosine is substituted for, e.g., phenylalanine at a position corresponding to amino acid 366 of BoNT A1 (SEQ ID NO:1), or corresponding to the starred Y position on the fifth row in the sequence alignment shown in FIG. 1A, which corresponds to Y.sub.366 in BoNT A. The tyrosine at this position is highly conserved across all BoNT serotypes and subtypes. In other embodiments, the Clostridium botulinum neurotoxin comprises a mutation at the starred Y position on the fifth row of FIG. 1A of any Clostridium botulinum neurotoxin serotype or subtype. In some embodiments, the Clostridium botulinum neurotoxin is selected from BoNT serotype B1 (BoNT B) with a mutation of Y.sub.373>X, BoNT serotype C1 (BoNT C) with a mutation of Y.sub.375>X, BoNT serotype D (BoNT D) with a mutation of Y.sub.375>X, BoNT serotype E1 (BoNT E) with a mutation of Y.sub.351>X, BoNT serotype F1 (BoNT F) with a mutation of Y.sub.368>X, BoNT serotype G (BoNT G) with a mutation of Y.sub.372>X, BoNT serotype H (BoNT H) with a mutation of Y.sub.366>X, and BoNT serotype X (BoNT X) with a mutation of Y.sub.363>X. In some embodiments, there is only one metalloprotease disabling mutation in the Clostridium botulinum neurotoxin. In some embodiments, an amino acid change that causes minimal structural interference of the light chain protease (e.g., for Y.sub.366>X in BoNT A or a corresponding mutation in another serotype) is a hydrophobic amino acid. In some embodiments, the only one metalloprotease disabling mutation that causes minimal structural interference of the light chain protease is a mutation corresponding to Y.sub.366>F in BoNT A1. In some embodiments, the only one metalloprotease disabling mutation that causes minimal structural interference of the light chain protease is a mutation corresponding to Y.sub.373>F in BoNT B1, Y.sub.375>F in BoNT C1, Y.sub.375>F in BoNT D, Y.sub.351>F in BoNT E1, Y.sub.368>F in BoNT F1, Y.sub.372>F in BoNT G, Y.sub.366>F in BoNT H, or Y.sub.363>F in BoNT X.

    [0044] In another embodiment, the metalloprotease disabling mutation corresponds to E.sub.224>X of BoNT A, where X is an amino acid that causes minimal structural interference to the light chain protease. That is, the Clostridium botulinum neurotoxin comprises a mutation in a wild type BoNT molecule in which glutamate is substituted for, e.g., glutamine at a position corresponding to amino acid 224 of BoNT A1 (SEQ ID NO:1), or corresponding to the starred E position on the third row in the sequence alignment shown in FIG. 1A. The glutamate at this position is highly conserved across all BoNT serotypes and subtypes. In other embodiments, the Clostridium botulinum neurotoxin comprises a mutation at the starred E position in the third row of FIG. 1A of any Clostridium botulinum neurotoxin serotype or subtype. In some embodiments, the Clostridium botulinum neurotoxin is selected from BoNT serotype B1 (BoNT B) with a mutation of E.sub.231>X, BoNT serotype C1 (BoNT C) with a mutation of E.sub.230>X, BoNT serotype D (BoNT D) with a mutation of E.sub.230>X, BoNT serotype E1 (BoNT E) with a mutation of E.sub.213>X, BoNT serotype F1 (BoNT F) with a mutation of E.sub.228>X, BoNT serotype G (BoNT G) with a mutation of E.sub.231>X, BoNT serotype H (BoNT H) with a mutation of E.sub.227>X, and BoNT serotype X (BoNT X) with a mutation of E.sub.228>X. In some embodiments, there is only one metalloprotease disabiling mutation in the Clostridium botulinum neurotoxin. In some embodiments, an amino acid change that causes minimal structural interference of the light chain protease (e.g., for E.sub.224>X in BoNT A or a corresponding mutation in another serotype) is a negatively charged amino acid or a structurally similar amino acid with an uncharged side chain where the E.sub.224 (or corresponding position in another BoNT serotype) carboxyl-group is substituted with an amide (as in glutamine), but retains the same length aliphatic side chain as in glutamic acid. In some embodiments, the only one metalloprotease disabling mutation that causes minimal structural interference of the light chain protease is a mutation corresponding to E.sub.224>Q in BoNT A1. In some embodiments, the only one metalloprotease disabling mutation that causes minimal structural interference of the light chain protease is a mutation corresponding to E.sub.231>Q in BoNT B1, E.sub.230>Q in BoNT C1, E.sub.230>Q in BoNT D, E.sub.213>Q in BoNT E1, E.sub.228>Q in BoNT F1, E.sub.231>Q in BoNT G, E.sub.227>Q in BoNT H, or E.sub.228>Q in BoNT X.

    [0045] In another embodiment, metalloprotease disabling mutations corresponding to positions Y.sub.366>X or E.sub.224.sup.>X of BoNT A can be made in other BoNT serotypes and sequences such as representative BoNT sequences shown in GenBank Accession Nos: CAL82360, CAA51824, ACA57525, ACQ51417, ACG50065, ACW83608, AFV13854, AJA05787, ACA46990, BAC22064, ABM73977, ABM73987, ACQ51206, BAF91946, AFD33678, AFN61309, BAA14235, BAA08418, EES90380, ABP48747, CAA43999, EF028404, ABM73980, BAC05434, AB037704, CAM91125, AER11391, AER11392, AFV91339, KF861920, KF861879, KF929215, ABS41202, CAA73972, ADA79575, GU213221, GU213212, AAA23263, ADK48765, AUCZ00000000, KIE44899, CFSAN024410, KG015617, and WP 045538952, each of which is hereby incorporated by reference in its entirety.

    [0046] In one embodiment, the Clostridium botulinum neurotoxin has an LD.sub.50 that is at least 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20; 30; 40; 50; 60; 70; 80; 90; 100; 200; 300; 400; 500; 600; 700; 800; or 900-fold higher than the LD.sub.50 of wild type Clostridium botulinum neurotoxin. In some embodiments, the Clostridium botulinum neurotoxin has an LD.sub.50 that is at least 5-fold, 10-fold, or 15-fold higher than the LD.sub.50 of a wild type Clostridial neurotoxin. The particular mode of administration may affect the LD.sub.50 of the derivative of a Clostridial neurotoxin.

    [0047] In one embodiment, the Clostridium botulinum neurotoxin of the present application is produced by cleaving a propeptide. The propeptide is cleaved at the highly specific protease cleavage site to form a light and heavy chain, with molecular weights of approximately 50 kD and 100 kD, respectively. The light and heavy chain regions are linked by a disulfide bond.

    [0048] In one embodiment, the propeptide is contacted with a highly specific protease (e.g., enterokinase or TEV protease) under conditions effective to enable cleavage at the intermediate region of the propeptide of the present application. The intermediate region is indicated by a box in FIG. 1A. Preferably, the expressed propeptide has one or more disulfide bridges. Disulfide bridges are indicated by a long horizontal bracket in FIG. 1A.

    [0049] As discussed infra, Clostridial neurotoxins and their derivatives described herein are synthesized as single chain propeptides which are later activated by a specific proteolysis cleavage event, generating a dimer joined by a disulfide bond. These structural features can be illustrated using BoNT A as an example (numbered according to SEQ ID NO:1), and are generally applicable to all Clostridium botulinum serotypes. The mature BoNT A is composed of three functional domains of Mr ˜50,000, where the catalytic function responsible for toxicity is confined to the light chain (residues 1-437), the translocation activity is associated with the N-terminal half of the heavy chain (residues 448-872), and cell binding is associated with its C-terminal half (residues 873-1,296) (Johnson, “Clostridial Toxins as Therapeutic Agents: Benefits of Nature's Most Toxic Proteins,” Annu. Rev. Microbiol. 53:551-575 (1999); Montecucco et al., “Structure and Function of Tetanus and botulinum Neurotoxins,” Q. Rev. Biophys. 28:423-472 (1995), which are hereby incorporated by reference in their entirety).

    [0050] Optimized expression and recovery of recombinant neurotoxins for BoNT serotypes in a native and physiologically active state is achieved by the introduction of one or more alterations to the nucleotide sequences encoding the BoNT propeptides, as discussed infra. This codon optimization is designed to maximize yield of recombinant derivatives of a Clostridial neurotoxin in the expression host, while retaining the native toxins' structure and biological activity.

    [0051] Common structural features of the wild-type Clostridium botulinum neurotoxin propeptides are shown in FIGS. 1A-B. These structural features are illustrated using wt BoNT A propeptide (SEQ ID NO:1) as an example, and are generalized among all Clostridium botulinum serotypes. wt BoNT A propeptide has two chains, a light chain (“LC”) of Mr ˜50,000 and a heavy chain (“HC”) of Mr ˜100,000, linked by a disulfide bond between Cys.sub.430 and Cys.sub.454. As illustrated in FIGS. 1A-B, all seven BoNT serotype propeptides have a light chain region and a heavy chain region linked by a disulfide bond. Two essential Cys residues, one adjacent to the C-terminus of the light chain, and a second adjacent to the N-terminus of the heavy chain are present in all seven BoNT serotypes. These two Cys residues form the single disulfide bond holding the HC and LC polypeptides together in the mature neurotoxin. This disulfide bond enables the mature neurotoxin to accomplish its native physiological activities by permitting the HC and LC to carry out their respective biological roles in concert. The disulfide bond between HC and LC polypeptides in all seven serotypes is illustrated in FIG. 1A by the long horizontal bracket joining the involved Cys residues. The outlined box in FIG. 1A on row 6 illustrates the intermediate region defined by amino acid residues Lys.sub.438-Lys.sub.448 of wt BoNT A (SEQ ID NO:1). This intermediate region identifies the amino acids eliminated during maturation of wt BoNT A, and believed to be excised by a protease endogenous to the host microorganism. This cleavage event, described infra, generates the biologically active BoNT HC-LC dimer. The outlined amino acid residues in FIG. 1A, representing amino acid residues approximately in the 420 to 450 range for all seven BoNT serotypes, can be considered as a region “non-essential” to the toxins' physiological activity and, therefore, represent targets for directed mutagenesis in all seven BoNT serotypes.

    [0052] All seven wt BoNT serotypes referred to herein contain Lys or Arg residues in the intermediate region defined by the box on row 6 of FIG. 1A, which make the propeptides susceptible to activation by trypsin. Native BoNT A propeptide recovered from young bacterial cultures can be activated by trypsinolysis, with production of intact, S-S bound light and heavy chain. Though multiple additional trypsin-susceptible sites are present in the native propeptides, they are resistant to proteolysis due to their spatial positions within the native toxin molecule (Dekleva et al., “Nicking of Single Chain Clostridium botulinum Type A Neurotoxin by an Endogenous Protease,” Biochem. Biophys. Res. Commun. 162:767-772 (1989); Lacy et al., “Crystal Structure of botulinum Neurotoxin Type A and Implications for Toxicity,” Nat. Struct. Biol. 5:898-902 (1998), which are hereby incorporated by reference in their entirety). A second site in the native propeptide of several BoNT serotypes can be susceptible to trypsin cleavage when subjected to higher enzyme concentrations or incubation times (Chaddock et al., “Expression and Purification of Catalytically Active, Non-Toxic Endopeptidase Derivatives of Clostridium botulinum Toxin Type A,” Protein Expr. Purif. 25:219-228 (2002), which is hereby incorporated by reference in its entirety). This native propeptide trypsin-susceptible site is located in the region adjacent to the toxin receptor binding domain. This region of the HC peptide is found to be exposed to solvent in BoNT serotypes for which information is available on their 3-D crystal structure (Lacy et al., “Crystal Structure of botulinum Neurotoxin Type A and Implications for Toxicity,” Nat. Struct. Biol. 5:898-902 (1998); Swaminathan et al., “Structural Analysis of the Catalytic and Binding Sites of Clostridium botulinum Neurotoxin B,” Nat. Struct. Biol. 7:693-699 (2000), which are hereby incorporated by reference in their entirety).

    [0053] In one embodiment, the propeptide has an intermediate region connecting the light and heavy chain regions which has a highly specific protease cleavage site and no low-specificity protease cleavage sites. For purposes of the present application, a highly specific protease cleavage site has three or more specific adjacent amino acid residues that are recognized by the highly specific protease in order to permit cleavage (e.g., an enterokinase cleavage site or a TEV recognition sequence). In contrast, a low-specificity protease cleavage site has two or less adjacent amino acid residues that are recognized by a protease in order to enable cleavage (e.g., a trypsin cleavage site).

    [0054] In all seven BoNT serotypes, the amino acid preceding the N-terminus of the heavy chain is a Lys or Arg residue which is susceptible to proteolysis with trypsin. This trypsin-susceptible site can be replaced with a five amino acid enterokinase cleavage site (i.e., DDDDK (SEQ ID NO:9)) upstream of the heavy chain's N-terminus. Alternatively, the trypsin-susceptible site can be replaced with a tobacco etch virus protease recognition (“TEV”) (i.e. ENLYFQ (SEQ ID NO:10), which cleaves with best efficiency if the next amino acid is G or S. Use of a TEV sequence enables a one-step heterodimer-forming cleavage event. See U.S. Patent Application Publication No. 2011/0206616 to Ichtchenko et al., which is hereby incorporated by reference in its entirety. Either of these modifications enables standardization activation with specific enzymes. Other highly specific proteases can be used. In serotypes A and C, additional Lys residues within this region may be mutated to either Gln or His, thereby eliminating additional trypsin-susceptible sites (i.e., changing amino acids 438-444 of SEQ ID NO:1 to HTQSLDQG (SEQ ID NO:11) and K.sub.448>G). As one example, without limitation, the addition of a TEV recognition sequence and the removal of the low specificity protease sites, changes the intermediate region sequence to HTQSLDQGGENLYFQG (SEQ ID NO:12).

    [0055] Trypsin-susceptible recognition sequences also occur upstream of the heavy chain's receptor-binding domain in serotypes A, E, and F. This region's susceptibility to proteolysis is consistent with its exposure to solvent in the toxin's 3-D structure, as shown by X-ray crystallography analysis. Therefore, in serotypes A, E, and F, the susceptible residues are modified to Asn (i.e., changing amino acid K.sub.871>N). These modifications enable standardization of activation with either enterokinase or TEV.

    [0056] Signal peptides and N-terminal affinity tags can also be introduced, as required, to enable secretion and recovery and to eliminate truncated variants. The affinity tags can be separated from the N-terminus and C-terminus of the neurotoxin by cleavage using the same specific proteases used to cleave the heavy and light chain (e.g., enterokinase or TEV cleavage sites).

    [0057] In one embodiment, the Clostridium botulinum neurotoxin is from a propeptide that has a metalloprotease disabling mutation. The amino acid residues constituting the minimal catalytic domain of the light chain of the propeptide are illustrated in FIG. 1A with a grey background. Specific amino acid residues constituting the active site of the catalytic domain of the metalloprotease are marked by stars in FIG. 1A.

    [0058] A variety of Clostridial neurotoxin propeptides with light chain regions containing non-native motifs (e.g., SNARE motif peptides) in place of surface alpha-helix domains can be created. These non-native motif bearing propeptides are generated by altering the nucleotide sequences of nucleic acids encoding the propeptides. The sequences of nine non-native motifs that may be substituted for alpha-helix domains are described in U.S. Pat. No. 7,785,606 to Ichtchenko and Band, which is hereby incorporated by reference in its entirety. Neurotoxin derivatives that incorporate sequences to target other cellular receptors are also possible (e.g., EGF or cancer cells) (see U.S. Patent Application Publication No. 2012/0064059 to Foster et al., which is hereby incorporated by reference in its entirety).

    [0059] In one embodiment, the light and heavy chains of the propeptide are not truncated.

    [0060] In one embodiment, the propeptide further comprises a signal peptide coupled to the light chain region, where the signal peptide is suitable to permit secretion of the propeptide from a eukaryotic cell to a medium. Suitable signal peptides are described in U.S. Pat. No. 7,785,606 to Ichtchenko and Band, which is hereby incorporated by reference in its entirety. A suitable signal peptide is a gp64 signal peptide. Another suitable signal peptide is MMKFLVNVALVFMVVYISYIYAAG . . . (SEQ ID NO:13). Other signal peptides may also be used. Signal peptides are chosen based on suitability to the expression system being used.

    [0061] The propeptide may also have an affinity tag located between the signal peptide and the light chain region and/or at the C-terminus of the propeptide after the heavy chain region. A signal peptide with suitable affinity tag such as the hexahistidine affinity tag is MPMLSAIVLYVLLAAAAHSAFAAMVHHHHHHSAS . . . (SEQ ID NO:14). An example of a suitable signal peptide with a longer histidine affinity tag, a TEV cleavage site, and a linker sequence (ATRGAGAG, SEQ ID NO:15) is MKFLVNVALVFMVVYISYIYAAGHTIFITIHHHEITITIHDVENLYFQGATRGAGAG (SEQ ID NO:16). A linker sequence can make the affinity tag accessible. Another example of a suitable affinity tag is a Strep tag II: WSHPQFEK (SEQ ID NO:17). In some embodiments, multiple Strep tag II sequences are used connected by linker sequences (GAG). Any suitable affinity tag may be used. In some embodiments, no affinity tag is used. In some embodiments, the affinity tag and signal peptide are cleaved away from the Clostridial neurotoxin derivative by a high affinity protease site. In some embodiments, the signal peptide is placed between the high affinity protease site and the Clostridial neurotoxin light chain derivative. In some embodiments, affinity tags in multiple locations are cleaved away from the Clostridial neurotoxin derivative molecule by high affinity protease sites. In some embodiments no affinity tag or high affinity protease site is used. In some embodiments a linker is used. In some embodiments, no linker is used. Any suitable linker sequence to connect various elements may be used such as those described in the present application.

    [0062] Structural variations of suitable Clostridial neurotoxin propeptides that possess a cargo attachment peptide sequence are described in U.S. Patent Application Publication No. 2011/0206616 to Ichtchenko and Band, which is hereby incorporated by reference in its entirety. Propeptides that encode derivatives of a Clostridial neurotoxin suitable for use in the method of the present application may have many of the structural features of the propeptides described in U.S. Patent Application Publication No. 2011/0206616 to Ichtchenko and Band, which is hereby incorporated by reference in its entirety, other than the cargo attachment peptide sequence at the N-terminus. As described in U.S. Patent Application Publication No. 2011/0206616 to Ichtchenko and Band, which is hereby incorporated by reference in its entirety, a single protease cleavage step can be used for activation by simultaneous cleavage between the light chain and heavy chain and removal of affinity tags.

    [0063] Isolated nucleic acid molecules that encode Clostridium botulinum neurotoxin suitable for use in treatment methods are described in U.S. Pat. No. 7,785,606 to Ichtchenko and Band, and U.S. Pat. No. 9,315,459 to Vasquez-Cintron, Ichtchenko, and Band, which are each hereby incorporated by reference in their entirety. In one embodiment, the nucleic acid molecule has a metalloprotease disabling mutation, as described supra. A nucleotide sequence encoding a BoNT A molecule with a signal peptide, affinity tag, highly specific protease sites, a metalloprotease disabling mutation (Y.sub.366>F), and C-terminal affinity tags is shown in SEQ ID NO:18, as follows:

    TABLE-US-00008 GGATCCCGGT CCGCCAGAAC TCTGGAACTC CTAAAAAACC GCCACCATGA AATTCTTAGT CAACGTTGCC CTTGTTTTTA TGGTCGTATA CATTTCTTAC ATCTATGCGG CCGGACACCA TCATCACCAC CACCATCATC ATCACCACGA CGTCGAAAAC CTGTACTTCC AAGGTGCCAC GCGTGGAGCG GGAGCAGGTC CATTCGTCAA CAAGCAATTC AACTACAAAG ATCCTGTTAA CGGTGTGGAC ATCGCCTACA TCAAGATTCC GAACGCAGGC CAGATGCAAC CTGTGAAGGC TTTCAAAATC CACAACAAGA TCTGGGTCAT TCCCGAGAGA GACACATTCA CGAACCCAGA GGAAGGTGAT CTGAACCCTC CCCCAGAAGC CAAGCAGGTG CCGGTCTCTT ACTACGATTC AACCTACCTC AGTACTGACA ACGAGAAGGA TAACTACCTG AAGGGCGTTA CTAAACTCTT CGAGCGCATC TACTCGACAG ACTTGGGCCG TATGCTGCTC ACGTCCATCG TCAGGGGTAT TCCTTTCTGG GGTGGCTCAA CCATCGACAC TGAGCTGAAG GTCATTGATA CAAACTGCAT CAACGTTATT CAACCCGACG GCTCCTACCG CAGCGAGGAA TTGAACCTGG TGATCATTGG ACCAAGCGCC GACATCATTC AGTTCGAGTG TAAGTCTTTC GGCCATGAAG TCCTCAACTT GACCAGAAAC GGCTACGGCT CCACTCAATA CATCCGCTTC AGCCCCGACT TCACATTCGG ATTCGAGGAA TCACTGGAGG TCGATACGAA CCCGTTGCTG GGTGCTGGCA AGTTCGCCAC CGACCCTGCA GTTACTCTGG CACACGAGCT CATCCACGCG GGACATCGTC TGTACGGTAT CGCTATTAAC CCAAACAGGG TCTTCAAGGT TAACACCAAC GCCTACTACG AGATGAGTGG TCTGGAAGTG TCGTTCGAGG AACTCCGTAC GTTCGGAGGT CACGACGCAA AGTTCATCGA TAGTTTGCAG GAGAACGAAT TCCGCCTGTA CTACTACAAC AAGTTCAAAG ACATCGCGTC TACACTCAAC AAGGCTAAAA GCATTGTTGG AACCACTGCT AGTTTGCAAT ACATGAAGAA CGTGTTCAAG GAGAAATACC TCTTGTCGGA AGACACCTCC GGTAAATTCA GCGTGGACAA GCTGAAATTC GATAAGTTGT ACAAAATGCT GACAGAAATC TACACGGAAG ACAACTTCGT TAAGTTCTTC AAAGTGTTGA ACCGTAAGAC CTTCCTGAAC TTCGATAAGG CTGTCTTCAA AATCAACATT GTGCCTAAAG TCAACTACAC CATCTACGAC GGTTTCAACC TCCGCAACAC TAACTTGGCT GCCAACTTCA ACGGCCAGAA CACTGAGATC AACAACATGA ACTTCACAAA GCTCAAAAAC TTCACCGGTT TGTTCGAGTT CTACAAGCTG CTCTGCGTGC GTGGTATCAT TACATCTCAC ACGCAATCTC TAGACCAGGG TGGCGAGAAC CTGTACTTCC AGGGTGCTCT GAACGATCTG TGTATCAAGG TGAATAACTG GGATCTGTTC TTTAGCCCAA GCGAGGATAA CTTCACGAAC GATCTCAACA AAGGTGAAGA GATCACGTCT GATACCAATA TCGAAGCGGC TGAAGAGAAT ATCTCCTTGG ATCTCATCCA GCAATATTAC CTGACCTTTA ACTTCGATAA CGAGCCCGAA AACATCTCCA TCGAGAACCT CAGCTCAGAC ATCATTGGTC AGTTGGAGCT GATGCCAAAC ATTGAACGCT TCCCCAACGG CAAGAAATAC GAACTCGACA AGTATACGAT GTTTCATTAC TTAAGAGCGC AGGAGTTTGA ACACGGCAAG AGCCGCATTG CTCTCACTAA CTCCGTGAAT GAAGCCCTGC TCAATCCGTC AAGGGTGTAC ACATTCTTTA GCTCCGACTA TGTCAAGAAA GTGAACAAAG CCACCGAAGC GGCAATGTTC CTGGGATGGG TTGAACAACT GGTCTACGAC TTCACCGACG AGACCTCTGA GGTGAGCACA ACGGACAAGA TTGCTGACAT CACTATCATT ATCCCGTATA TTGGACCTGC CTTGAATATT GGCAACATGC TCTACAAAGA CGATTTCGTT GGTGCCCTGA TCTTCAGCGG TGCCGTGATC CTGTTGGAGT TCATTCCTGA AATCGCCATC CCTGTGCTGG GCACGTTCGC TCTGGTCTCA TACATTGCGA ATAAGGTCTT GACCGTGCAG ACAATCGATA ATGCCCTCTC CAAACGTAAC GAAAAATGGG ACGAGGTCTA CAAATACATC GTGACCAACT GGCTGGCAAA GGTTAACACC CAAATTGATC TGATCCGTAA GAAAATGAAG GAGGCTTTGG AGAACCAGGC TGAAGCTACT AAAGCCATTA TCAACTACCA GTATAATCAG TATACAGAAG AGGAAAAGAA TAACATCAAT TTCAACATCG ATGACTTGTC CTCAAAGCTG AACGAGTCCA TCAACAAAGC TATGATCAAC ATCAACAAAT TCCTGAATCA GTGCTCCGTG TCTTACCTGA TGAACTCTAT GATCCCATAC GGTGTGAAGC GCCTGGAGGA CTTCGATGCC AGCCTGAAAG ACGCACTGCT CAAATACATT TACGATAATC GCGGCACTTT GATTGGCCAA GTTGACCGTC TGAAGGACAA GGTTAACAAT ACCTTGTCAA CCGATATCCC CTTCCAACTC TCTAAGTACG TCGATAACCA GCGCTTGCTG AGCACCTTCA CAGAATACAT CAACAACATC ATCAACACCT CCATCCTGAA CCTCCGTTAC GAGTCTAACC ACCTCATCGA CTTGAGCAGA TACGCTAGCA AGATCAACAT CGGTTCCAAG GTGAACTTCG ACCCAATCGA TAAGAACCAG ATCCAACTGT TCAACCTCGA ATCCTCTAAG ATCGAAGTGA TCCTGAAGAA CGCTATCGTC TACAACTCCA TGTACGAAAA CTTCTCTACC AGCTTCTGGA TCAGGATTCC GAAATACTTC AACTCAATCT CGCTCAACAA CGAGTACACT ATCATCAACT GCATGGAAAA CAACTCGGGA TGGAAGGTGT CCCTCAACTA CGGCGAGATC ATCTGGACTT TGCAGGACAC ACAAGAAATC AAGCAGAGGG TCGTGTTCAA GTACAGCCAA ATGATCAACA TCAGCGATTA CATCAACCGT TGGATCTTCG TCACAATCAC CAACAACCGC CTGAACAACT CCAAGATTTA CATCAACGGT AGACTGATCG ACCAGAAGCC AATCAGCAAC CTCGGCAACA TCCACGCCTC AAACAACATC ATGTTCAAGT TGGACGGCTG TAGGGATACA CACAGATACA TCTGGATCAA ATACTTCAAC CTGTTCGACA AGGAGCTCAA CGAGAAGGAA ATCAAGGACC TCTACGATAA CCAGTCCAAC TCTGGTATCT TGAAGGACTT CTGGGGCGAT TACCTGCAAT ACGACAAGCC CTACTACATG TTGAACCTGT ACGACCCTAA CAAGTACGTT GATGTGAACA ACGTCGGTAT CAGGGGCTAC ATGTACCTGA AGGGACCACG TGGTTCTGTT ATGACCACTA ACATCTACCT CAACAGCTCA TTGTACCGTG GCACAAAGTT CATCATCAAG AAGTACGCCT CCGGAAACAA GGACAACATC GTCCGTAACA ACGATCGCGT TTACATCAAC GTTGTGGTCA AGAACAAGGA GTACAGACTG GCTACCAACG CTTCGCAGGC TGGAGTTGAG AAGATCCTGT CTGCTCTGGA AATCCCTGAC GTGGGCAACC TCTCACAGGT TGTGGTCATG AAGTCGAAGA ACGATCAAGG CATCACTAAC AAGTGCAAGA TGAACTTGCA GGACAACAAC GGAAACGACA TCGGCTTCAT CGGATTCCAC CAATTCAACA ACATCGCCAA GTTGGTGGCC AGCAACTGGT ACAACCGTCA GATCGAGCGT TCGTCCCGCA CCTTAGGATG CTCGTGGGAG TTCATTCCAG TCGATGACGG ATGGGGAGAG AGACCTTTGG GCGCAGGAGA GAACCTGTAC TTCCAGGGTG CAGGATGGTC CCACCCACAA TTCGAGAAGG GTGCAGGATG GAGTCACCCA CAGTTCGAGA AGGGCGCTGG ATGGTCCCAC CCACAGTTCG AGAAATAATT AGTTGATGCA TAGTTAATTA GATAGCTCGA G

    [0064] A nucleotide sequence encoding a BoNT A molecule with a signal peptide, affinity tag, highly specific protease sites, a metalloprotease disabling mutation (E.sub.224>Q), and C-terminal affinity tags is shown in SEQ ID NO:19:

    TABLE-US-00009 GGATCCCGGT CCGCCAGAAC TCTGGAACTC CTAAAAAACC GCCACCATGA AATTCTTAGT CAACGTTGCC CTTGTTTTTA TGGTCGTATA CATTTCTTAC ATCTATGCGG CCGGACACCA TCATCACCAC CACCATCATC ATCACCACGA CGTCGAAAAC CTGTACTTCC AAGGTGCCAC GCGTGGAGCG GGAGCAGGTC CATTCGTCAA CAAGCAATTC AACTACAAAG ATCCTGTTAA CGGTGTGGAC ATCGCCTACA TCAAGATTCC GAACGCAGGC CAGATGCAAC CTGTGAAGGC TTTCAAAATC CACAACAAGA TCTGGGTCAT TCCCGAGAGA GACACATTCA CGAACCCAGA GGAAGGTGAT CTGAACCCTC CCCCAGAAGC CAAGCAGGTG CCGGTCTCTT ACTACGATTC AACCTACCTC AGTACTGACA ACGAGAAGGA TAACTACCTG AAGGGCGTTA CTAAACTCTT CGAGCGCATC TACTCGACAG ACTTGGGCCG TATGCTGCTC ACGTCCATCG TCAGGGGTAT TCCTTTCTGG GGTGGCTCAA CCATCGACAC TGAGCTGAAG GTCATTGATA CAAACTGCAT CAACGTTATT CAACCCGACG GCTCCTACCG CAGCGAGGAA TTGAACCTGG TGATCATTGG ACCAAGCGCC GACATCATTC AGTTCGAGTG TAAGTCTTTC GGCCATGAAG TCCTCAACTT GACCAGAAAC GGCTACGGCT CCACTCAATA CATCCGCTTC AGCCCCGACT TCACATTCGG ATTCGAGGAA TCACTGGAGG TCGATACGAA CCCGTTGCTG GGTGCTGGCA AGTTCGCCAC CGACCCTGCA GTTACTCTGG CACACCAGCT CATCCACGCG GGACATCGTC TGTACGGTAT CGCTATTAAC CCAAACAGGG TCTTCAAGGT TAACACCAAC GCCTACTACG AGATGAGTGG TCTGGAAGTG TCGTTCGAGG AACTCCGTAC GTTCGGAGGT CACGACGCAA AGTTCATCGA TAGTTTGCAG GAGAACGAAT TCCGCCTGTA CTACTACAAC AAGTTCAAAG ACATCGCGTC TACACTCAAC AAGGCTAAAA GCATTGTTGG AACCACTGCT AGTTTGCAAT ACATGAAGAA CGTGTTCAAG GAGAAATACC TCTTGTCGGA AGACACCTCC GGTAAATTCA GCGTGGACAA GCTGAAATTC GATAAGTTGT ACAAAATGCT GACAGAAATC TACACGGAAG ACAACTTCGT TAAGTTCTTC AAAGTGTTGA ACCGTAAGAC CTACCTGAAC TTCGATAAGG CTGTCTTCAA AATCAACATT GTGCCTAAAG TCAACTACAC CATCTACGAC GGTTTCAACC TCCGCAACAC TAACTTGGCT GCCAACTTCA ACGGCCAGAA CACTGAGATC AACAACATGA ACTTCACAAA GCTCAAAAAC TTCACCGGTT TGTTCGAGTT CTACAAGCTG CTCTGCGTGC GTGGTATCAT TACATCTCAC ACGCAATCTC TAGACCAGGG TGGCGAGAAC CTGTACTTCC AGGGTGCTCT GAACGATCTG TGTATCAAGG TGAATAACTG GGATCTGTTC TTTAGCCCAA GCGAGGATAA CTTCACGAAC GATCTCAACA AAGGTGAAGA GATCACGTCT GATACCAATA TCGAAGCGGC TGAAGAGAAT ATCTCCTTGG ATCTCATCCA GCAATATTAC CTGACCTTTA ACTTCGATAA CGAGCCCGAA AACATCTCCA TCGAGAACCT CAGCTCAGAC ATCATTGGTC AGTTGGAGCT GATGCCAAAC ATTGAACGCT TCCCCAACGG CAAGAAATAC GAACTCGACA AGTATACGAT GTTTCATTAC TTAAGAGCGC AGGAGTTTGA ACACGGCAAG AGCCGCATTG CTCTCACTAA CTCCGTGAAT GAAGCCCTGC TCAATCCGTC AAGGGTGTAC ACATTCTTTA GCTCCGACTA TGTCAAGAAA GTGAACAAAG CCACCGAAGC GGCAATGTTC CTGGGATGGG TTGAACAACT GGTCTACGAC TTCACCGACG AGACCTCTGA GGTGAGCACA ACGGACAAGA TTGCTGACAT CACTATCATT ATCCCGTATA TTGGACCTGC CTTGAATATT GGCAACATGC TCTACAAAGA CGATTTCGTT GGTGCCCTGA TCTTCAGCGG TGCCGTGATC CTGTTGGAGT TCATTCCTGA AATCGCCATC CCTGTGCTGG GCACGTTCGC TCTGGTCTCA TACATTGCGA ATAAGGTCTT GACCGTGCAG ACAATCGATA ATGCCCTCTC CAAACGTAAC GAAAAATGGG ACGAGGTCTA CAAATACATC GTGACCAACT GGCTGGCAAA GGTTAACACC CAAATTGATC TGATCCGTAA GAAAATGAAG GAGGCTTTGG AGAACCAGGC TGAAGCTACT AAAGCCATTA TCAACTACCA GTATAATCAG TATACAGAAG AGGAAAAGAA TAACATCAAT TTCAACATCG ATGACTTGTC CTCAAAGCTG AACGAGTCCA TCAACAAAGC TATGATCAAC ATCAACAAAT TCCTGAATCA GTGCTCCGTG TCTTACCTGA TGAACTCTAT GATCCCATAC GGTGTGAAGC GCCTGGAGGA CTTCGATGCC AGCCTGAAAG ACGCACTGCT CAAATACATT TACGATAATC GCGGCACTTT GATTGGCCAA GTTGACCGTC TGAAGGACAA GGTTAACAAT ACCTTGTCAA CCGATATCCC CTTCCAACTC TCTAAGTACG TCGATAACCA GCGCTTGCTG AGCACCTTCA CAGAATACAT CAACAACATC ATCAACACCT CCATCCTGAA CCTCCGTTAC GAGTCTAACC ACCTCATCGA CTTGAGCAGA TACGCTAGCA AGATCAACAT CGGTTCCAAG GTGAACTTCG ACCCAATCGA TAAGAACCAG ATCCAACTGT TCAACCTCGA ATCCTCTAAG ATCGAAGTGA TCCTGAAGAA CGCTATCGTC TACAACTCCA TGTACGAAAA CTTCTCTACC AGCTTCTGGA TCAGGATTCC GAAATACTTC AACTCAATCT CGCTCAACAA CGAGTACACT ATCATCAACT GCATGGAAAA CAACTCGGGA TGGAAGGTGT CCCTCAACTA CGGCGAGATC ATCTGGACTT TGCAGGACAC ACAAGAAATC AAGCAGAGGG TCGTGTTCAA GTACAGCCAA ATGATCAACA TCAGCGATTA CATCAACCGT TGGATCTTCG TCACAATCAC CAACAACCGC CTGAACAACT CCAAGATTTA CATCAACGGT AGACTGATCG ACCAGAAGCC AATCAGCAAC CTCGGCAACA TCCACGCCTC AAACAACATC ATGTTCAAGT TGGACGGCTG TAGGGATACA CACAGATACA TCTGGATCAA ATACTTCAAC CTGTTCGACA AGGAGCTCAA CGAGAAGGAA ATCAAGGACC TCTACGATAA CCAGTCCAAC TCTGGTATCT TGAAGGACTT CTGGGGCGAT TACCTGCAAT ACGACAAGCC CTACTACATG TTGAACCTGT ACGACCCTAA CAAGTACGTT GATGTGAACA ACGTCGGTAT CAGGGGCTAC ATGTACCTGA AGGGACCACG TGGTTCTGTT ATGACCACTA ACATCTACCT CAACAGCTCA TTGTACCGTG GCACAAAGTT CATCATCAAG AAGTACGCCT CCGGAAACAA GGACAACATC GTCCGTAACA ACGATCGCGT TTACATCAAC GTTGTGGTCA AGAACAAGGA GTACAGACTG GCTACCAACG CTTCGCAGGC TGGAGTTGAG AAGATCCTGT CTGCTCTGGA AATCCCTGAC GTGGGCAACC TCTCACAGGT TGTGGTCATG AAGTCGAAGA ACGATCAAGG CATCACTAAC AAGTGCAAGA TGAACTTGCA GGACAACAAC GGAAACGACA TCGGCTTCAT CGGATTCCAC CAATTCAACA ACATCGCCAA GTTGGTGGCC AGCAACTGGT ACAACCGTCA GATCGAGCGT TCGTCCCGCA CCTTAGGATG CTCGTGGGAG TTCATTCCAG TCGATGACGG ATGGGGAGAG AGACCTTTGG GCGCAGGAGA GAACCTGTAC TTCCAGGGTG CAGGATGGTC CCACCCACAA TTCGAGAAGG GTGCAGGATG GAGTCACCCA CAGTTCGAGA AGGGCGCTGG ATGGTCCCAC CCACAGTTCG AGAAATAATT AGTTGATGCA TAGTTAATTA GATAGCTCGA G

    [0065] Expression systems having a nucleic acid molecule encoding an isolated, Clostridium botulinum neurotoxin in a heterologous vector, and host cells having a heterologous nucleic acid molecule encoding Clostridium botulinum neurotoxins are described in U.S. Patent No. 7,785,606 to Ichtchenko and Band, and U.S. Pat. No. 9,315,459 to Vasquez-Cintron, Ichtchenko, and Band, which are each hereby incorporated by reference in their entirety.

    [0066] Expressing a recombinant, physiologically active, Clostridium botulinum neurotoxins is carried out by providing a nucleic acid construct having a nucleic acid molecule encoding a propeptide as described herein. The nucleic acid construct has a heterologous promoter operably linked to the nucleic acid molecule and a 3′ regulatory region operably linked to the nucleic acid molecule. The nucleic acid construct is then introduced into a host cell under conditions effective to express the Clostridium botulinum neurotoxin.

    [0067] Expression of a Clostridium botulinum neurotoxin can be carried out by introducing a nucleic acid molecule encoding a propeptide (e.g., SEQ ID NO:18 or 19) into an expression system of choice using conventional recombinant technology. Generally, this involves inserting the nucleic acid molecule into an expression system to which the molecule is heterologous (i.e., not normally present). The introduction of a particular foreign or native gene into a mammalian host is facilitated by first introducing the gene sequence into a suitable nucleic acid vector. “Vector” is used herein to mean any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which is capable of transferring gene sequences between cells. Thus, the term includes cloning and expression vectors, as well as viral vectors. The heterologous nucleic acid molecule is inserted into the expression system or vector in proper sense (5′.fwdarw.3′) orientation and correct reading frame. The vector contains the necessary elements for the transcription and translation of the inserted Clostridial neurotoxin propeptide-coding sequences.

    [0068] U.S. Pat. No. 4,237,224 to Cohen and Boyer, which is hereby incorporated by reference in its entirety, describes the production of expression systems in the form of recombinant plasmids using restriction enzyme cleavage and ligation with DNA ligase. These recombinant plasmids are then introduced by means of transformation and replicated in unicellular cultures including prokaryotic organisms and eukaryotic cells grown in culture.

    [0069] Recombinant genes may also be introduced into viruses, including vaccinia virus, adenovirus, and retroviruses, including lentivirus. Recombinant viruses can be generated by transfection of plasmids into cells infected with virus.

    [0070] Suitable vectors include, but are not limited to, the following viral vectors such as lambda vector system gt11, gt WES.tB, Charon 4, and plasmid vectors such as pBR322, pBR325, pACYC177, pACYC184, pUC8, pUC9, pUC18, pUC19, pLG339, pR290, pKC37, pKC101, SV 40, pBluescript II SK +/− or KS +/− (see “Stratagene Cloning Systems” Catalog (1993) from Stratagene, La Jolla, Calif., which is hereby incorporated by reference in its entirety), pQE, pIH821, pGEX, pFastBac series (Invitrogen), pET series (see F. W. Studier et. al., “Use of T7 RNA Polymerase to Direct Expression of Cloned Genes,” Gene Expression Technology Vol. 185 (1990), which is hereby incorporated by reference in its entirety), and any derivatives thereof. Recombinant molecules can be introduced into cells via transformation, particularly transduction, conjugation, mobilization, or electroporation. The DNA sequences are cloned into the vector using standard cloning procedures in the art, as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Springs Laboratory, Cold Springs Harbor, New York (1989), which is hereby incorporated by reference in its entirety.

    [0071] A variety of host-vector systems may be utilized to express the propeptide-encoding sequence in a cell. Primarily, the vector system must be compatible with the host cell used. Host-vector systems include but are not limited to the following: bacteria transformed with bacteriophage DNA, plasmid DNA, or cosmid DNA; microorganisms such as yeast containing yeast vectors; mammalian cell systems infected with virus (e.g., vaccinia virus, adenovirus, etc.); insect cell systems infected with virus (e.g., baculovirus); and plant cells infected by bacteria. The expression elements of these vectors vary in their strength and specificities. Depending upon the host-vector system utilized, any one of a number of suitable transcription and translation elements can be used.

    [0072] Different genetic signals and processing events control many levels of gene expression (e.g., DNA transcription and messenger RNA (“mRNA”) translation).

    [0073] Transcription of DNA is dependent upon the presence of a promoter which is a DNA sequence that directs the binding of RNA polymerase and thereby promotes mRNA synthesis. The DNA sequences of eukaryotic promoters differ from those of prokaryotic promoters. Furthermore, eukaryotic promoters and accompanying genetic signals may not be recognized in or may not function in a prokaryotic system, and, further, prokaryotic promoters are not recognized and do not function in eukaryotic cells.

    [0074] Similarly, translation of mRNA in prokaryotes depends upon the presence of the proper prokaryotic signals which differ from those of eukaryotes. Efficient translation of mRNA in prokaryotes requires a ribosome binding site called the Shine-Dalgarno (“SD”) sequence on the mRNA. This sequence is a short nucleotide sequence of mRNA that is located before the start codon, usually AUG, which encodes the amino-terminal methionine of the protein. The SD sequences are complementary to the 3′-end of the 16S rRNA (ribosomal RNA) and probably promote binding of mRNA to ribosomes by duplexing with the rRNA to allow correct positioning of the ribosome. For a review on maximizing gene expression see Roberts and Lauer, Methods in Enzymology 68:473 (1979), which is hereby incorporated by reference in its entirety.

    [0075] Promoters vary in their “strength” (i.e., their ability to promote transcription). For the purposes of expressing a cloned gene, it is desirable to use strong promoters in order to obtain a high level of transcription and, hence, expression of the gene. Depending upon the host cell system utilized, any one of a number of suitable promoters may be used. For instance, when cloning in E. coli, its bacteriophages, or plasmids, promoters such as the PH promoter, T7 phage promoter, lac promoter, trp promoter, recA promoter, ribosomal RNA promoter, the P.sub.R and P.sub.L promoters of coliphage lambda and others, including but not limited, to lacUV5, ompF, bla, 1pp, and the like, may be used to direct high levels of transcription of adjacent DNA segments. Additionally, a hybrid trp-lacUV5 (tac) promoter or other E. coli promoters produced by recombinant DNA or other synthetic DNA techniques may be used to provide for transcription of the inserted gene.

    [0076] Bacterial host cell strains and expression vectors may be chosen which inhibit the action of the promoter unless specifically induced. In certain operons, the addition of specific inducers is necessary for efficient transcription of the inserted DNA. For example, the lac operon is induced by the addition of lactose or IPTG (isopropylthio-beta-D-galactoside). A variety of other operons, such as trp, pro, etc., are under different controls.

    [0077] Specific initiation signals are also required for efficient gene transcription and translation in prokaryotic cells. These transcription and translation initiation signals may vary in “strength” as measured by the quantity of gene specific messenger RNA and protein synthesized, respectively. The DNA expression vector, which contains a promoter, may also contain any combination of various “strong” transcription and/or translation initiation signals. For instance, efficient translation in E. coli requires a Shine-Dalgarno (“SD”) sequence about 7-9 bases 5′ to the initiation codon (ATG) to provide a ribosome binding site. Thus, any SD-ATG combination that can be utilized by host cell ribosomes may be employed. Such combinations include but are not limited to the SD-ATG combination from the cro gene or the N gene of coliphage lambda, or from the E. coli tryptophan E, D, C, B or A genes. Additionally, any SD-ATG combination produced by recombinant DNA or other techniques involving incorporation of synthetic nucleotides may be used.

    [0078] Depending on the vector system and host utilized, any number of suitable transcription and/or translation elements, including constitutive, inducible, and repressible promoters, as well as minimal 5′ promoter elements may be used.

    [0079] The nucleic acid, a promoter molecule of choice, a suitable 3′ regulatory region, and if desired, a reporter gene, are incorporated into a vector-expression system of choice to prepare a nucleic acid construct using standard cloning procedures known in the art, such as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, Third Edition, Cold Spring Harbor: Cold Spring Harbor Laboratory Press, New York (2001), which is hereby incorporated by reference in its entirety.

    [0080] The nucleic acid molecule encoding a derivative of a Clostridial neurotoxin is inserted into a vector in the sense (i.e., 5′.fwdarw.3′) direction, such that the open reading frame is properly oriented for the expression of the encoded propeptide under the control of a promoter of choice. Single or multiple nucleic acids may be ligated into an appropriate vector in this way, under the control of a suitable promoter, to prepare a nucleic acid construct. For example, the nucleotide sequence of SEQ ID NOs: 18 or 19 can be cloned into insect vector pFASTBacI using restriction enzymes and standard methods. See, e.g., standard procedures in the art as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., Cold Spring Harbor Press (1989), and Ausubel et al., Current Protocols in Molecular Biology, New York, N.Y., John Wiley & Sons (1989), which are hereby incorporated by reference in their entirety.

    [0081] Once the isolated nucleic acid molecule encoding the propeptide has been inserted into an expression vector, it is ready to be incorporated into a host cell. Recombinant molecules can be introduced into cells via transformation, particularly transduction, conjugation, lipofection, protoplast fusion, mobilization, particle bombardment, or electroporation. The DNA sequences are incorporated into the host cell using standard cloning procedures known in the art, as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Springs Laboratory, Cold Springs Harbor, New York (1989), which is hereby incorporated by reference in its entirety. Suitable hosts include, but are not limited to, bacteria, virus, yeast, fungi, mammalian cells, insect cells, plant cells, and the like. Preferable host cells of the present application include, but are not limited to, Escherichia coli, insect cells, and Pichia pastoris cells.

    [0082] Typically, an antibiotic or other compound useful for selective growth of the transformed cells only is added as a supplement to the media. The compound to be used will be dictated by the selectable marker element present in the plasmid with which the host cell was transformed. Suitable genes are those which confer resistance to gentamycin, G418, hygromycin, puromycin, streptomycin, spectinomycin, tetracycline, chloramphenicol, and the like. Similarly, “reporter genes” which encode enzymes providing for production of an identifiable compound, or other markers which indicate relevant information regarding the outcome of gene delivery, are suitable. For example, various luminescent or phosphorescent reporter genes are also appropriate, such that the presence of the heterologous gene may be ascertained visually.

    [0083] In some embodiments, the expressed neurotoxin derivative is secreted via the signal peptide. In some embodiments, the neurotoxin derivative is purified using one or more affinity tags. In some embodiments, the expressed neurotoxin derivative is contacted with a highly specific protease under conditions effective to effect cleavage at the intermediate region. In some embodiments, the intermediate region of the propeptide is not cleaved by proteases endogenous to the expression system or the host cell. In some embodiments, the expressed neurotoxin derivative is contacted with a highly specific protease under conditions effective to effect cleavage at the intermediate region, prior to the light chain and after the heavy chain of the Costridial neurotoxin derivative. Exemplary neurotoxin derivatives after TEV cleavage are as follows:

    [0084] A Clostridial neurotoxin derivative propeptide amino acid sequence derived from SEQ ID NO:18 having a metalloprotease in the light chain with a mutation corresponding to Y.sub.366>F in BoNT A is SEQ ID NO:20, as follows:

    TABLE-US-00010 MKFLVNVALV FMVVYISYIY AAGHHHHHHH HHHHDVENLY FQGATRGAGA GPFVNKQFNY KDPVNGVDIA YIKIPNAGQM QPVKAFKIHN KIWVIPERDT FTNPEEGDLN PPPEAKQVPV SYYDSTYLST DNEKDNYLKG VTKLFERIYS TDLGRMLLTS IVRGIPFWGG STIDTELKVI DTNCINVIQP DGSYRSEELN LVIIGPSADI IQFECKSFGH EVLNLTRNGY GSTQYIRFSP DFTFGFEESL EVDTNPLLGA GKFATDPAVT LAHELIHAGH RLYGIAINPN RVFKVNTNAY YEMSGLEVSF EELRTFGGHD AKFIDSLQEN EFRLYYYNKF KDIASTLNKA KSIVGTTASL QYMKNVFKEK YLLSEDTSGK FSVDKLKFDK LYKMLTEIYT EDNFVKFFKV LNRKTFLNFD KAVFKINIVP KVNYTIYDGF NLRNTNLAAN FNGQNTEINN MNFTKLKNFT GLFEFYKLLC VRGIITSHTQ SLDQGGENLY FQGALNDLCI KVNNWDLFFS PSEDNFTNDL NKGEEITSDT NIEAAEENIS LDLIQQYYLT FNFDNEPENI SIENLSSDII GQLELMPNIE RFPNGKKYEL DKYTMFHYLR AQEFEHGKSR IALTNSVNEA LLNPSRVYTF FSSDYVKKVN KATEAAMFLG WVEQLVYDFT DETSEVSTTD KIADITIIIP YIGPALNIGN MLYKDDFVGA LIFSGAVILL EFIPEIAIPV LGTFALVSYI ANKVLTVQTI DNALSKRNEK WDEVYKYIVT NWLAKVNTQI DLIRKKMKEA LENQAEATKA IINYQYNQYT EEEKNNINFN IDDLSSKLNE SINKAMININ KFLNQCSVSY LMNSMIPYGV KRLEDFDASL KDALLKYIYD NRGTLIGQVD RLKDKVNNTL STDIPFQLSK YVDNQRLLST FTEYINNIIN TSILNLRYES NHLIDLSRYA SKINIGSKVN FDPIDKNQIQ LFNLESSKIE VILKNAIVYN SMYENFSTSF WIRIPKYFNS ISLNNEYTII NCMENNSGWK VSLNYGEIIW TLQDTQEIKQ RVVFKYSQMI NISDYINRWI FVTITNNRLN NSKIYINGRL IDQKPISNLG NIHASNNIMF KLDGCRDTHR YIWIKYFNLF DKELNEKEIK DLYDNQSNSG ILKDFWGDYL QYDKPYYMLN LYDPNKYVDV NNVGIRGYMY LKGPRGSVMT TNIYLNSSLY RGTKFIIKKY ASGNKDNIVR NNDRVYINVV VKNKEYRLAT NASQAGVEKI LSALEIPDVG NLSQVVVMKS KNDQGITNKC KMNLQDNNGN DIGFIGFHQF NNIAKLVASN WYNRQIERSS RTLGCSWEFI PVDDGWGERP LGAGENLYFQ GAGWSHPQFE KGAGWSHPQF EKGAGWSHPQ FEK

    [0085] After cleavage of SEQ ID NO:20 with a highly specific protease such as TEV, the active Clostridial neurotoxin derivative may, according to one embodiment, have a light chain sequence as shown in SEQ ID NO:21, as follows:

    TABLE-US-00011 GATRGAGAGP FVNKQFNYKD PVNGVDIAYI KIPNAGQMQP VKAFKIHNKI WVIPERDTFT NPEEGDLNPP PEAKQVPVSY YDSTYLSTDN EKDNYLKGVT KLFERIYSTD LGRMLLTSIV RGIPFWGGST IDTELKVIDT NCINVIQPDG SYRSEELNLV IIGPSADIIQ FECKSFGHEV LNLTRNGYGS TQYIRFSPDF TFGFEESLEV DTNPLLGAGK FATDPAVTLA HELIHAGHRL YGIAINPNRV FKVNTNAYYE MSGLEVSFEE LRTFGGHDAK FIDSLQENEF RLYYYNKFKD IASTLNKAKS IVGTTASLQY MKNVFKEKYL LSEDTSGKFS VDKLKFDKLY KMLTEIYTED NFVKFFKVLN RKTFLNFDKA VFKINIVPKV NYTIYDGFNL RNTNLAANFN GQNTEINNMN FTKLKNFTGL FEFYKLLCVR GIITSHTQSL DQGGENLYFQ

    [0086] After cleavage of SEQ ID NO:20 with a highly specific protease such as TEV, the active Clostridial neurotoxin derivative may, according to one embodiment, have a heavy chain sequence as shown in SEQ ID NO:22, as follows:

    TABLE-US-00012 GALNDLCIKV NNWDLFFSPS EDNFTNDLNK GEEITSDTNI EAAEENISLD LIQQYYLTFN FDNEPENISI ENLSSDIIGQ LELMPNIERF PNGKKYELDK YTMFHYLRAQ EFEHGKSRIA LTNSVNEALL NPSRVYTFFS SDYVKKVNKA TEAAMFLGWV EQLVYDFTDE TSEVSTTDKI ADITIIIPYI GPALNIGNML YKDDFVGALI FSGAVILLEF IPEIAIPVLG TFALVSYIAN KVLTVQTIDN ALSKRNEKWD EVYKYIVTNW LAKVNTQIDL IRKKMKEALE NQAEATKAII NYQYNQYTEE EKNNINFNID DLSSKLNESI NKAMININKF LNQCSVSYLM NSMIPYGVKR LEDFDASLKD ALLKYIYDNR GTLIGQVDRL KDKVNNTLST DIPFQLSKYV DNQRLLSTFT EYINNIINTS ILNLRYESNH LIDLSRYASK INIGSKVNFD PIDKNQIQLF NLESSKIEVI LKNAIVYNSM YENFSTSFWI RIPKYFNSIS LNNEYTIINC MENNSGWKVS LNYGEIIWTL QDTQEIKQRV VFKYSQMINI SDYINRWIFV TITNNRLNNS KIYINGRLID QKPISNLGNI HASNNIMFKL DGCRDTHRYI WIKYFNLFDK ELNEKEIKDL YDNQSNSGIL KDFWGDYLQY DKPYYMLNLY DPNKYVDVNN VGIRGYMYLK GPRGSVMTTN IYLNSSLYRG TKFIIKKYAS GNKDNIVRNN DRVYINVVVK NKEYRLATNA SQAGVEKILS ALEIPDVGNL SQVVVMKSKN DQGITNKCKM NLQDNNGNDI GFIGFHQFNN IAKLVASNWY NRQIERSSRT LGCSWEFIPV DDGWGERPLG AGENLYFQ

    [0087] The light chain and heavy chain derivatives of SEQ ID NO:21 and SEQ ID NO:22 are linked through disulfide bonds at C.sub.438 of SEQ ID NO:21 and C.sub.7 of SEQ ID NO:22 to form an active Clostridial neurotoxin derivative. In some embodiments, the light chain derivative is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to a SEQ ID NO:21. In some embodiments, the heavy chain derivative is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:22.

    [0088] Since different types of signal peptides, tags, protease sites, and the orientation of these elements may vary in different embodiments, an exemplary sequence for a light chain derivative, according to the methods disclosed in the present application, is as follows in SEQ ID NO:23:

    TABLE-US-00013 PFVNKQFNYK DPVNGVDIAY IKIPNAGQMQ PVKAFKIHNK IWVIPERDTF TNPEEGDLNP PPEAKQVPVS YYDSTYLSTD NEKDNYLKGV TKLFERIYST DLGRMLLTSI VRGIPFWGGS TIDTELKVID TNCINVIQPD GSYRSEELNL VIIGPSADII QFECKSFGHE VLNLTRNGYG STQYIRFSPD FTFGFEESLE VDTNPLLGAG KFATDPAVTL AHELIHAGHR LYGIAINPNR VFKVNTNAYY EMSGLEVSFE ELRTFGGHDA KFIDSLQENE FRLYYYNKFK DIASTLNKAK SIVGTTASLQ YMKNVFKEKY LLSEDTSGKF SVDKLKFDKL YKMLTEIYTE DNFVKFFKVL NRKTFLNFDK AVFKINIVPK VNYTIYDGFN LRNTNLAANF NGQNTEINNM NFTKLKNFTG LFEFYKLLCV RGIITSHTQS LDQGG

    [0089] Since different types of signal peptides, tags, protease sites, and the orientation of these elements may vary in different embodiments, an exemplary minimal sequence for a heavy chain derivative, according to the methods disclosed in the present application, is as follows in

    [0090] SEQ ID NO:24:

    TABLE-US-00014 ALNDLCIKVN NWDLFFSPSE DNFTNDLNKG EEITSDTNIE AAEENISLDL IQQYYLTFNF DNEPENISIE NLSSDIIGQL ELMPNIERFP NGKKYELDKY TMFHYLRAQE FEHGKSRIAL TNSVNEALLN PSRVYTFFSS DYVKKVNKAT EAAMFLGWVE QLVYDFTDET SEVSTTDKIA DITIIIPYIG PALNIGNMLY KDDFVGALIF SGAVILLEFI PEIAIPVLGT FALVSYIANK VLTVQTIDNA LSKRNEKWDE VYKYIVTNWL AKVNTQIDLI RKKMKEALEN QAEATKAIIN YQYNQYTEEE KNNINFNIDD LSSKLNESIN KAMININKFL NQCSVSYLMN SMIPYGVKRL EDFDASLKDA LLKYIYDNRG TLIGQVDRLK DKVNNTLSTD IPFQLSKYVD NQRLLSTFTE YINNIINTSI LNLRYESNHL IDLSRYASKI NIGSKVNFDP IDKNQIQLFN LESSKIEVIL KNAIVYNSMY ENFSTSFWIR IPKYFNSISL NNEYTIINCM ENNSGWKVSL NYGEIIWTLQ DTQEIKQRVV FKYSQMINIS DYINRWIFVT ITNNRLNNSK IYINGRLIDQ KPISNLGNIH ASNNIMFKLD GCRDTHRYIW IKYFNLFDKE LNEKEIKDLY DNQSNSGILK DFWGDYLQYD KPYYMLNLYD PNKYVDVNNV GIRGYMYLKG PRGSVMTTNI YLNSSLYRGT KFIIKKYASG NKDNIVRNND RVYINVVVKN KEYRLATNAS QAGVEKILSA LEIPDVGNLS QVVVMKSKND QGITNKCKMN LQDNNGNDIG FIGFHQFNNI AKLVASNWYN RQIERSSRTL GCSWEFIPVD DGWGERPL

    [0091] The light chain and heavy chain derivatives of SEQ ID NO:23 and SEQ ID NO:24 are linked through disulfide bonds at C.sub.429 of SEQ ID NO:23 and C.sub.6 of SEQ ID NO:24 to form an active Clostridial neurotoxin derivative. In some embodiments, the light chain derivative is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to a SEQ ID NO:23. In some embodiments, the heavy chain derivative is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:24.

    [0092] A Clostridial neurotoxin derivative propeptide amino acid sequence derived from SEQ ID NO: 19 having a metalloprotease in the light chain with a mutation corresponding to an E.sub.224>Q in BoNT A is SEQ ID NO:25, as follows:

    TABLE-US-00015 MKFLVNVALV FMVVYISYIY AAGHHHHHHH HHHHDVENLY FQGATRGAGA GPFVNKQFNY KDPVNGVDIA YIKIPNAGQM QPVKAFKIHN KIWVIPERDT FTNPEEGDLN PPPEAKQVPV SYYDSTYLST DNEKDNYLKG VTKLFERIYS TDLGRMLLTS IVRGIPFWGG STIDTELKVI DTNCINVIQP DGSYRSEELN LVIIGPSADI IQFECKSFGH EVLNLTRNGY GSTQYIRFSP DFTFGFEESL EVDTNPLLGA GKFATDPAVT LAHQLIHAGH RLYGIAINPN RVFKVNTNAY YEMSGLEVSF EELRTFGGHD AKFIDSLQEN EFRLYYYNKF KDIASTLNKA KSIVGTTASL QYMKNVFKEK YLLSEDTSGK FSVDKLKFDK LYKMLTEIYT EDNFVKFFKV LNRKTYLNFD KAVFKINIVP KVNYTIYDGF NLRNTNLAAN FNGQNTEINN MNFTKLKNFT GLFEFYKLLC VRGIITSHTQ SLDQGGENLY FQGALNDLCI KVNNWDLFFS PSEDNFTNDL NKGEEITSDT NIEAAEENIS LDLIQQYYLT FNFDNEPENI SIENLSSDII GQLELMPNIE RFPNGKKYEL DKYTMFHYLR AQEFEHGKSR IALTNSVNEA LLNPSRVYTF FSSDYVKKVN KATEAAMFLG WVEQLVYDFT DETSEVSTTD KIADITIIIP YIGPALNIGN MLYKDDFVGA LIFSGAVILL EFIPEIAIPV LGTFALVSYI ANKVLTVQTI DNALSKRNEK WDEVYKYIVT NWLAKVNTQI DLIRKKMKEA LENQAEATKA IINYQYNQYT EEEKNNINFN IDDLSSKLNE SINKAMININ KFLNQCSVSY LMNSMIPYGV KRLEDFDASL KDALLKYIYD NRGTLIGQVD RLKDKVNNTL STDIPFQLSK YVDNQRLLST FTEYINNIIN TSILNLRYES NHLIDLSRYA SKINIGSKVN FDPIDKNQIQ LFNLESSKIE VILKNAIVYN SMYENFSTSF WIRIPKYFNS ISLNNEYTII NCMENNSGWK VSLNYGEIIW TLQDTQEIKQ RVVFKYSQMI NISDYINRWI FVTITNNRLN NSKIYINGRL IDQKPISNLG NIHASNNIMF KLDGCRDTHR YIWIKYFNLF DKELNEKEIK DLYDNQSNSG ILKDFWGDYL QYDKPYYMLN LYDPNKYVDV NNVGIRGYMY LKGPRGSVMT TNIYLNSSLY RGTKFIIKKY ASGNKDNIVR NNDRVYINVV VKNKEYRLAT NASQAGVEKI LSALEIPDVG NLSQVVVMKS KNDQGITNKC KMNLQDNNGN DIGFIGFHQF NNIAKLVASN WYNRQIERSS RTLGCSWEFI PVDDGWGERP LGAGENLYFQ GAGWSHPQFE KGAGWSHPQF EKGAGWSHPQ FEK

    [0093] After cleavage of SEQ ID NO:25 with a highly specific protease such as TEV, the active Clostridial neurotoxin derivative may, according to one embodiment, have a light chain sequence as shown in SEQ ID NO:26, as follows:

    TABLE-US-00016 GATRGAGAGP FVNKQFNYKD PVNGVDIAYI KIPNAGQMQP VKAFKIHNKI WVIPERDTFT NPEEGDLNPP PEAKQVPVSY YDSTYLSTDN EKDNYLKGVT KLFERIYSTD LGRMLLTSIV RGIPFWGGST IDTELKVIDT NCINVIQPDG SYRSEELNLV IIGPSADIIQ FECKSFGHEV LNLTRNGYGS TQYIRFSPDF TFGFEESLEV DTNPLLGAGK FATDPAVTLA HQLIHAGHRL YGIAINPNRV FKVNTNAYYE MSGLEVSFEE LRTFGGHDAK FIDSLQENEF RLYYYNKFKD IASTLNKAKS IVGTTASLQY MKNVFKEKYL LSEDTSGKFS VDKLKFDKLY KMLTEIYTED NFVKFFKVLN RKTYLNFDKA VFKINIVPKV NYTIYDGFNL RNTNLAANFN GQNTEINNMN FTKLKNFTGL FEFYKLLCVR GIITSHTQSL DQGGENLYFQ

    [0094] After cleavage of SEQ ID NO:25 with a highly specific protease such as TEV, the active Clostridial neurotoxin derivative may, according to one embodiment, have a heavy chain sequence as shown in SEQ ID NO:27, as follows:

    TABLE-US-00017 GALNDLCIKV NNWDLFFSPS EDNFTNDLNK GEEITSDTNI EAAEENISLD LIQQYYLTFN FDNEPENISI ENLSSDIIGQ LELMPNIERF PNGKKYELDK YTMFHYLRAQ EFEHGKSRIA LTNSVNEALL NPSRVYTFFS SDYVKKVNKA TEAAMFLGWV EQLVYDFTDE TSEVSTTDKI ADITIIIPYI GPALNIGNML YKDDFVGALI FSGAVILLEF IPEIAIPVLG TFALVSYIAN KVLTVQTIDN ALSKRNEKWD EVYKYIVTNW LAKVNTQIDL IRKKMKEALE NQAEATKAII NYQYNQYTEE EKNNINFNID DLSSKLNESI NKAMININKF LNQCSVSYLM NSMIPYGVKR LEDFDASLKD ALLKYIYDNR GTLIGQVDRL KDKVNNTLST DIPFQLSKYV DNQRLLSTFT EYINNIINTS ILNLRYESNH LIDLSRYASK INIGSKVNFD PIDKNQIQLF NLESSKIEVI LKNAIVYNSM YENFSTSFWI RIPKYFNSIS LNNEYTIINC MENNSGWKVS LNYGEIIWTL QDTQEIKQRV VFKYSQMINI SDYINRWIFV TITNNRLNNS KIYINGRLID QKPISNLGNI HASNNIMFKL DGCRDTHRYI WIKYFNLFDK ELNEKEIKDL YDNQSNSGIL KDFWGDYLQY DKPYYMLNLY DPNKYVDVNN VGIRGYMYLK GPRGSVMTTN IYLNSSLYRG TKFIIKKYAS GNKDNIVRNN DRVYINVVVK NKEYRLATNA SQAGVEKILS ALEIPDVGNL SQVVVMKSKN DQGITNKCKM NLQDNNGNDI GFIGFHQFNN IAKLVASNWY NRQIERSSRT LGCSWEFIPV DDGWGERPLG AGENLYFQ

    [0095] The light chain and heavy chain derivatives of SEQ ID NO:26 and SEQ ID NO:27 are linked through disulfide bonds at C.sub.438 of SEQ ID NO:26 and C.sub.7 of SEQ ID NO:27 to form an active Clostridial neurotoxin derivative. In some embodiments, the light chain derivative is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to a SEQ ID NO:26. In some embodiments, the heavy chain derivative is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:27.

    [0096] Since different types of signal peptides, tags, protease sites, and the orientation of these elements may vary in different embodiments, an exemplary sequence for a light chain derivative, according to the methods disclosed in the present application, is as follows in SEQ ID NO:28:

    TABLE-US-00018 PFVNKQFNYK DPVNGVDIAY IKIPNAGQMQ PVKAFKIHNK IWVIPERDTF TNPEEGDLNP PPEAKQVPVS YYDSTYLSTD NEKDNYLKGV TKLFERIYST DLGRMLLTSI VRGIPFWGGS TIDTELKVID TNCINVIQPD GSYRSEELNL VIIGPSADII QFECKSFGHE VLNLTRNGYG STQYIRFSPD FTFGFEESLE VDTNPLLGAG KFATDPAVTL AHQLIHAGHR LYGIAINPNR VFKVNTNAYY EMSGLEVSFE ELRTFGGHDA KFIDSLQENE FRLYYYNKFK DIASTLNKAK SIVGTTASLQ YMKNVFKEKY LLSEDTSGKF SVDKLKFDKL YKMLTEIYTE DNFVKFFKVL NRKTYLNFDK AVFKINIVPK VNYTIYDGFN LRNTNLAANF NGQNTEINNM NFTKLKNFTG LFEFYKLLCV RGIITSHTQS LDQGG

    [0097] Since different types of signal peptides, tags, protease sites, and the orientation of these elements may vary in different embodiments, an exemplary minimal sequence for a heavy chain derivative, according to the methods disclosed in the present application, is as follows in SEQ ID NO:29:

    TABLE-US-00019 ALNDLCIKVN NWDLFFSPSE DNFTNDLNKG EEITSDTNIE AAEENISLDL IQQYYLTFNF DNEPENISIE NLSSDIIGQL ELMPNIERFP NGKKYELDKY TMFHYLRAQE FEHGKSRIAL TNSVNEALLN PSRVYTFFSS DYVKKVNKAT EAAMFLGWVE QLVYDFTDET SEVSTTDKIA DITIIIPYIG PALNIGNMLY KDDFVGALIF SGAVILLEFI PEIAIPVLGT FALVSYIANK VLTVQTIDNA LSKRNEKWDE VYKYIVTNWL AKVNTQIDLI RKKMKEALEN QAEATKAIIN YQYNQYTEEE KNNINFNIDD LSSKLNESIN KAMININKFL NQCSVSYLMN SMIPYGVKRL EDFDASLKDA LLKYIYDNRG TLIGQVDRLK DKVNNTLSTD IPFQLSKYVD NQRLLSTFTE YINNIINTSI LNLRYESNHL IDLSRYASKI NIGSKVNFDP IDKNQIQLFN LESSKIEVIL KNAIVYNSMY ENFSTSFWIR IPKYFNSISL NNEYTIINCM ENNSGWKVSL NYGEIIWTLQ DTQEIKQRVV FKYSQMINIS DYINRWIFVT ITNNRLNNSK IYINGRLIDQ KPISNLGNIH ASNNIMFKLD GCRDTHRYIW IKYFNLFDKE LNEKEIKDLY DNQSNSGILK DFWGDYLQYD KPYYMLNLYD PNKYVDVNNV GIRGYMYLKG PRGSVMTTNI YLNSSLYRGT KFIIKKYASG NKDNIVRNND RVYINVVVKN KEYRLATNAS QAGVEKILSA LEIPDVGNLS QVVVMKSKND QGITNKCKMN LQDNNGNDIG FIGFHQFNNI AKLVASNWYN RQIERSSRTL GCSWEFIPVD DGWGERPLGA G

    [0098] The light chain and heavy chain derivatives of SEQ ID NO:28 and SEQ ID NO:29 are linked through disulfide bonds at C.sub.429 of SEQ ID NO:28 and C.sub.6 of SEQ ID NO:29 to form an active Clostridial neurotoxin derivative. In some embodiments, the light chain derivative is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to a SEQ ID NO:28. In some embodiments, the heavy chain derivative is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:29.

    [0099] In carrying out the methods described herein, contacting a subject with the Clostridium botulinum neurotoxins can be carried out by administering the isolated Clostridium botulinum neurotoxins to a subject inhalationally, parenterally, for example, subcutaneously, intravenously, intramuscularly, intraperitoneally, by intranasal instillation, or by application to mucous membranes, such as, that of the nose, throat, and bronchial tubes. The Clostridium botulinum neurotoxins may be administered alone or with suitable pharmaceutical carriers, and can be in solid or liquid form such as, tablets, capsules, powders, solutions, suspensions, or emulsions.

    [0100] The neurotoxin derivative may also be administered parenterally. Solutions or suspensions can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof in oils. Illustrative oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, or mineral oil. In general, water, saline, aqueous dextrose and related sugar solution, and glycols such as, propylene glycol or polyethylene glycol, are preferred liquid carriers, particularly for injectable solutions. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.

    [0101] The pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases, the form must be sterile and must be fluid to the extent that syringability is possible. It must be stable under the conditions of manufacture and storage and can be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol), vegetable oils, hyaluronic acid, and suitable mixtures thereof.

    [0102] Targeting the CNS may require intra-thecal or intra-ventricular administration. Administration may occur directly to the CNS. Alternatively, administration to the CNS may involve retrograde and transynaptic transport from peripheral neurons (motor neurons, nociceptors) to spinal ganglia (see Caleo et al., “A Reappraisal of the Central Effects of botulinum Neurotoxin Type A: By What Mechanism?” Journal of Neurochemistry 109:15-24 (2009), which is hereby incorporated by reference in its entirety).

    [0103] Derivatives of a Clostridial neurotoxin of the present application can be used to augment the endogenous pharmaceutical activity of wild type Clostridial neurotoxins (e.g., BOTOX®), e.g., as a combination therapy.

    [0104] Derivatives of a Clostridial neurotoxin can be administered as a conjugate with a pharmaceutically acceptable water-soluble polymer moiety. By way of example, a polyethylene glycol conjugate is useful to increase the half-life of the treatment compound, and to reduce the immunogenicity of the molecule. Specific PEG conjugates are described in U.S. Patent Application Publ. No. 2006/0074200 to Daugs et al., which is hereby incorporated by reference in its entirety. Other polymers used to form conjugates or mixtures include HA, which are described in U.S. Pat. No. 7,879,341 to Taylor and U.S. Patent Application Publication No. 2012/0141532 to Blanda et al., each of which is hereby incorporated by reference in its entirety. Liquid forms, including liposome-encapsulated formulations, are illustrated by injectable solutions and suspensions. Exemplary solid forms include controlled-release forms, such as a gel formulation, miniosmotic pump, or an implant. Other dosage forms can be devised by those skilled in the art, as shown, for example, by Ansel and Popovich, Pharmaceutical Dosage Forms and Drug Delivery Systems, 5.sup.th Edition (Lea & Febiger 1990), Gennaro (ed.), Remington's Pharmaceutical Sciences, 19.sup.th Edition (Mack Publishing Company 1995), and by Ranade and Hollinger, Drug Delivery Systems (CRC Press 1996), each of which is hereby incorporated by reference in its entirety.

    [0105] According to one embodiment, by treatment it is meant dermatologic or aesthetic treatment (see e.g., Carruthers et al., “botulinum Toxin A in the Mid and Lower Face and Neck,” Dermatol. Clin. 22:151-158 (2004); Lang, “History and Uses of BOTOX® (botulinum Toxin Type A),” Lippincotts Case Manag. 9:109-112 (2004); Naumann et al., “Safety of botulinum Toxin Type A: A Systematic Review and Meta-Analysis,” Curr. Med. Res. Opin. 20:981-990 (2004); Vartanian et al., “Facial Rejuvenation Using botulinum Toxin A: Review and Updates,” Facial Plast. Surg. 20:11-19 (2004), which are hereby incorporated by reference in their entirety) as well as therapeutic treatment (see e.g., Bentsianov et al., “Noncosmetic Uses of botulinum Toxin,” Clin. Dermatol. 22:82-88 (2004); Carruthers et al., “Botox [BOTOX®]: Beyond Wrinkles,” Clin. Dermatol. 22:89-93 (2004); Jankovic, “botulinum Toxin In Clinical Practice,” J. Neurol. Neurosurg. Psychiatry 75:951-957 (2004); Klein, “The Therapeutic Potential of botulinum Toxin,” Dermatol. Surg. 30:452-455 (2004); Schurch, “The Role of botulinum Toxin in Neurology,” Drugs Today (Banc) 40:205-212 (2004), which are hereby incorporated by reference in their entirety).

    [0106] Subjects to be treated pursuant to the methods of the present application include, without limitation, human and non-human primates, or other animals such as dog, cat, horse, cow, goat, sheep, rabbit, or rodent (e.g., mouse or rat).

    [0107] Preferred treatment methods of the present application include, but are not limited to, dermatologic or aesthetic treatment, gastroenterologic treatment, genitourinaric treatment, neurologic treatment, oncological treatment, and/or the treatment of any condition characterized by synaptopathology (see, e.g., Brose et al., “Synaptopathies: Dysfunction of Synaptic Function,” Biochem. Soc. Trans. 38:443-444 (2010); Yu & Lu, “Synapses and Dendritic Spines as Pathogenic Targets in Alzherimer's Disease,” Neural Plasticity 2012:1-8 (2012); Siskova et al., “Reactive Hypertrophy of Synaptic Varicosities Within the Hippocampus of Prion-Infected Mice,” Biochem Soc. Trans. 38:471-475 (2010); Warner et al., “TorsinA and DYT1 Dystonia: A Synaptopathy?” Biochem. Soc. Trans. 38:452-456 (2010); Rozas et al., “Presynaptic Dysfunction in Huntington's Disease,” Biochem Soc. Trans. 38:488-492 (2010); and Jones, “Errant Ensembles: Dysfunctional Neuronal Network Dynamics in Schizophrenia,” Biochem. Soc. Trans. 38:516-521 (2010), which are hereby incorporated by reference in their entirety). Treatment of a condition characterized by synaptopathology may involve the neuromodulation of the synapse by the neurotoxin derivative.

    [0108] Dermatologic or aesthetic treatment includes, but is not limited to, treatment for Rhtyiddess (wrinkles) (Sadick et al., “Comparison of botulinum Toxins A and B in the Treatment of Facial Rhytides,” Dermatol. Clin. 22:221-226 (2004), which is hereby incorporated by reference in its entirety), including glabellar (Carruthers et al., “botulinum Toxin type A for the Treatment of Glabellar Rhytides,” Dermatol. Clin. 22:137-144 (2004); Ozsoy et al., “Two-Plane Injection of botulinum Exotoxin A in Glabellar Frown Lines,” Aesthetic Plast. Surg. 28:114-115 (2004); which are hereby incorporated by reference in their entirety), neck lines (Brandt et al., “botulinum Toxin for the Treatment of Neck Lines and Neck Bands,” Dermatol. Clin. 22:159-166 (2004), which is hereby incorporated by reference in its entirety), crow's feet (Levy et al., “botulinum Toxin A: A 9-Month Clinical and 3D In Vivo Profilometric Crow's Feet Wrinkle Formation Study,” J. Cosmet. Laser Ther. 6:16-20 (2004), which is hereby incorporated by reference in its entirety), and brow contour (Chen et al., “Altering Brow Contour with botulinum Toxin,” Facial Plast. Surg. Clin. North Am. 11:457-464 (2003), which is hereby incorporated by reference in its entirety). Other dermatologic treatment includes treatment for hypertrophic masseter muscles (Ahn et al., “botulinum Toxin for Masseter Reduction in Asian Patients,” Arch. Facial Plast. Surg. 6:188-191 (2004), which is hereby incorporated by reference in its entirety) and focal hyperhydrosis (Glogau, “Treatment of Hyperhidrosis with botulinum Toxin,” Dermatol. Clin. 22:177-185, vii (2004), which is hereby incorporated by reference in its entirety), including axillary (“botulinum Toxin (Botox [BOTOX®]) for Axillary Hyperhidrosis,” Med. Lett. Drugs Ther. 46:76 (2004), which is hereby incorporated by reference in its entirety) and genital (Lee et al., “A Case of Foul Genital Odor Treated with botulinum Toxin A,” Dermatol. Surg. 30:1233-1235 (2004), which is hereby incorporated by reference in its entirety).

    [0109] Gastroentologic treatment includes, but is not limited to, treatment for esophageal motility disorders (Achem, “Treatment of Spastic Esophageal Motility Disorders,” Gastroenterol. Clin. North Am. 33:107-124 (2004), which is hereby incorporated by reference in its entirety), pharyngeal-esophageal spasm (Bayles et al., “Operative Prevention and Management of Voice-Limiting Pharyngoesophageal Spasm,” Otolaryngol. Clin. North Am. 37:547-558 (2004); Chao et al., “Management of Pharyngoesophageal Spasm with Botox [BOTOX®],” Otolaryngol. Clin. North Am. 37:559-566 (2004), which are hereby incorporated by reference in their entirety), and anal fissure (Brisinda et al., “botulinum Neurotoxin to Treat Chronic Anal Fissure: Results of a Randomized ‘Botox [BOTOX ] vs. Dysport [DYSPORT®]’ Controlled Trial,” Ailment Pharmacol. Ther. 19:695-701 (2004); Jost et al., “botulinum Toxin A in Anal Fissure: Why Does it Work?” Dis. Colon Rectum 47:257-258 (2004), which are hereby incorporated by reference in their entirety).

    [0110] Genitourinaric treatment includes, but is not limited to, treatment for neurogenic dysfunction of the urinary tract (“Botulinic Toxin in Patients with Neurogenic Dysfunction of the Lower Urinary Tracts,” Urologia July-August:44-48 (2004); Giannantoni et al., “Intravesical Resiniferatoxin Versus botulinum-A Toxin Injections for Neurogenic Detrusor Overactivity: A Prospective Randomized Study,” J. Urol. 172:240-243 (2004); Reitz et al., “Intravesical Therapy Options for Neurogenic Detrusor Overactivity,” Spinal Cord 42:267-272 (2004), which are hereby incorporated by reference in their entirety), overactive bladder (Cruz, “Mechanisms Involved in New Therapies for Overactive Bladder,” Urology 63:65-73 (2004), which is hereby incorporated by reference in its entirety), and neuromodulation of urinary urge incontinence (Abrams, “The Role of Neuromodulation in the Management of Urinary Urge Incontinence,” BJU Int. 93:1116 (2004), which is hereby incorporated by reference in its entirety).

    [0111] Neurologic treatment includes, but is not limited to, treatment for tourettes syndrome (Porta et al., “Treatment of Phonic Tics in Patients with Tourette's Syndrome Using botulinum Toxin Type A,” Neurol. Sci. 24:420-423 (2004), which is hereby incorporated by reference in its entirety) and focal muscle spasticity or dystonias (MacKinnon et al., “Corticospinal Excitability Accompanying Ballistic Wrist Movements in Primary Dystonia,” Mov. Disord. 19:273-284 (2004), which is hereby incorporated by reference in its entirety), including, but not limited to, treatment for cervical dystonia (Haussermann et al., “Long-Term Follow-Up of Cervical Dystonia Patients Treated with botulinum Toxin A,” Mov. Disord. 19:303-308 (2004), which is hereby incorporated by reference in its entirety), primary blepharospasm (Defazio et al., “Primary Blepharospasm: Diagnosis and Management,” Drugs 64:237-244 (2004), which is hereby incorporated by reference in its entirety), hemifacial spasm, post-stroke (Bakheit, “Optimising the Methods of Evaluation of the Effectiveness of botulinum Toxin Treatment of Post-Stroke Muscle Spasticity,” J. Neurol. Neurosurg. Psychiatry 75:665-666 (2004), which is hereby incorporated by reference in its entirety), spasmodic dysphonia (Bender et al., “Speech Intelligibility in Severe Adductor Spasmodic Dysphonia,” J. Speech Lang. Hear Res. 47:21-32 (2004), which is hereby incorporated by reference in its entirety), facial nerve disorders (Finn, “botulinum Toxin Type A: Fine-Tuning Treatment of Facial Nerve Injury,” J. Drugs Dermatol. 3:133-137 (2004), which is hereby incorporated by reference in its entirety), and Rasmussen syndrome (Lozsadi et al., “botulinum Toxin A Improves Involuntary Limb Movements in Rasmussen Syndrome,” Neurology 62:1233-1234 (2004), which is hereby incorporated by reference in its entirety). Other neurologic treatments include treatment for amputation pain (Kern et al., “Effects of botulinum Toxin Type B on Stump Pain and Involuntary Movements of the Stump,” Am. J. Phys. Med. Rehabil. 83:396-399 (2004), which is hereby incorporated by reference in its entirety), voice tremor (Adler et al., “botulinum Toxin Type A for Treating Voice Tremor,” Arch. Neurol. 61:1416-1420 (2004), which is hereby incorporated by reference in its entirety), crocodile tear syndrome (Kyrmizakis et al., “The Use of botulinum Toxin Type A in the Treatment of Frey and Crocodile Tears Syndrome,” J. Oral Maxillofac. Surg. 62:840-844 (2004), which is hereby incorporated by reference in its entirety), marginal mandibular nerve paralysis, pain control, and anti-nociceptive effects (Cui et al., “Subcutaneous Administration of botulinum Toxin A Reduces Formalin-Induced Pain,” Pain 107:125-133 (2004) and U.S. Patent Application Publication No. 2012/0064059 to Foster et al., which are hereby incorporated by reference in its entirety), including but not limited to pain after mastectomy (Layeeque et al., “botulinum Toxin Infiltration for Pain Control After Mastectomy and Expander Reconstruction,” Ann. Surg. 240:608-613 (2004), which is hereby incorporated by reference in its entirety) and chest pain of esophageal origin (Schumulson et al., “Current and Future Treatment of Chest Pain of Presumed Esophageal Origin,” Gastroenterol. Clin. North Am. 33:93-105 (2004), which is hereby incorporated by reference in its entirety). Another neurologic treatment amenable to the methods of the present application is headache (Blumenfeld et al., “botulinum Neurotoxin for the Treatment of Migraine and Other Primary Headache Disorders,” Dermatol. Clin. 22:167-175 (2004), which is hereby incorporated by reference in its entirety).

    [0112] The methods of the present application are also suitable for treatment of cerebral palsy (Balkrishnan et al., “Longitudinal Examination of Health Outcomes Associated with botulinum Toxin Use in Children with Cerebral Palsy,” J. Surg. Orthop. Adv. 13:76-80 (2004); Berweck et al., “Use of botulinum Toxin in Pediatric Spasticity (Cerebral Palsy),” Mov. Disord. 19:S162-S167 (2004); Pidcock, “The Emerging Role of Therapeutic botulinum Toxin in the Treatment of Cerebral Palsy,” J. Pediatr. 145:S33-S35 (2004), which are hereby incorporated by reference in their entirety), hip adductor muscle dysfunction in multiple sclerosis (Wissel et al., “botulinum Toxin Treatment of Hip Adductor Spasticity in Multiple Sclerosis,” Wien Klin Wochesnchr 4:20-24 (2001), which is hereby incorporated by reference in its entirety), neurogenic pain and inflammation, including arthritis, iatrogenic parotid sialocele (Capaccio et al., “Diagnosis and Therapeutic Management of Iatrogenic Parotid Sialocele,” Ann. Otol. Rhinol. Laryngol. 113:562-564 (2004), which is hereby incorporated by reference in its entirety), and chronic TMJ pain and displacement (Aquilina et al., “Reduction of a Chronic Bilateral Temporomandibular Joint Dislocation with Intermaxillary Fixation and botulinum Toxin A,” Br. J. Oral Maxillofac. Surg. 42:272-273 (2004), which is hereby incorporated by reference in its entirety). Other conditions that can be treated by local controlled delivery of pharmaceutically active neurotoxin derivatives include intra-articular administration for the treatment of arthritic conditions (Mahowald et al., “Long Term Effects of Intra-Articular BoNT A for Refractory Joint Pain,” Annual Meeting of the American College of Rheumatology (2004), which is hereby incorporated by reference in its entirety), and local administration for the treatment of joint contracture (Russman et al., “Cerebral Palsy: A Rational Approach to a Treatment Protocol, and the Role of botulinum Toxin in Treatment,” Muscle Nerve Suppl. 6:S181-S193 (1997); Pucinelli et al., “Botulinic Toxin for the Rehabilitation of Osteoarthritis Fixed-Flexion Knee Deformity,” Annual Meeting of the Osteoarthitis Research Society International (2004), which are hereby incorporated by reference in their entirety). The methods of the present application are also suitable for the treatment of pain associated with various conditions characterized by the sensitization of nociceptors and their associated clinical syndromes, as described in Bach-Rojecky et al., “Antinociceptive Effect of botulinum Toxin Type A In Rat Model of Carrageenan and Capsaicin Induced Pain,” Croat. Med. 1 46:201-208 (2005); Aoki, “Evidence for Antinociceptive Activity of botulinum Toxin Type A in Pain Management,” Headache 43 Suppl 1:S9-15 (2003); Kramer et al., “botulinum Toxin A Reduces Neurogenic Flare But Has Almost No Effect on Pain and Hyperalgesia in Human Skin,” J Neurol. 250:188-193 (2003); Blersch et al., “botulinum Toxin A and the Cutaneous Nociception in Humans: A Prospective, Double-Blind, Placebo-Controlled, Randomized Study,” J Neurol. Sci. 205:59-63 (2002), which are hereby incorporated by reference in its entirety.

    [0113] The neurotoxin derivatives may be customized to optimize therapeutic properties (See e.g., Chaddock et al., “Retargeted Clostridial Endopeptidases: Inhibition of Nociceptive Neurotransmitter Release In Vitro, and Antinociceptive Activity in In Vivo Models of Pain,” Mov. Disord. 8:S42-S47 (2004); Finn, “botulinum Toxin Type A: Fine-Tuning Treatment of Facial Nerve Injury,” J. Drugs Dermatol. 3:133-137 (2004); Eleopra et al., “Different Types of botulinum Toxin in Humans,” Mov. Disord. 8:S53-S59 (2004); Flynn, “Myobloc,” Dermatol. Clin. 22:207-211 (2004); and Sampaio et al., “Clinical Comparability of Marketed Formulations of botulinum Toxin,” Mov. Disord. 8:S129-S136 (2004), which are hereby incorporated by reference in their entirety).

    [0114] The derivative of a Clostridial neurotoxin may also be used, pursuant to the treatment methods of the present application, to treat diseases influenced by activity-dependent changes in synaptic structure (e.g., synaptopathologies) or hyperactivity of synapse forming apparatus (e.g., tubulin polymerization), and conditions associated with the proliferation of microtubules. For example, Alzheimer's Disease, Parkinson's Disease, and neuronal cancers (of both neural and glial origin). Other conditions that may be treated by the method of the present application include conditions where the synaptic complex is a disease target.

    [0115] In one embodiment, neurotoxin derivatives of the present application accumulate within neuronal cytosol in higher amounts than wild-type Clostridial neurotoxin. In another embodiment, neurotoxin derivatives of the present application accumulate in muscle tissue in higher amounts than wild-type Clostridial neurotoxin. In some embodiments, neurotoxin derivatives of the present application are translocated at higher amounts than wild-type Clostridial neurotoxin.

    EXAMPLES

    Example 1—In-Vivo Pharmaceutical Activity Experiments for BoNT A/ad-0

    [0116] Material and Methods

    [0117] An atoxic (or reduced toxicity) derivative of Clostridium botulinum serotype A (“BoNT A/ad”), as described in U.S. Pat. No. 7,785,606 to Ichtchenko and Band (which is hereby incorporated by reference in its entirety), was expressed as described. Since this neurotoxin derivative is atoxic and does not possess a cargo attachment peptide sequence at its N-terminus, it was designated “BoNT A/ad-0,” where “ad-0” means atoxic derivative with no cargo site (0), as described herein. BoNT A/ad-0 was purified to electrophoretic homogeneity and activated by specific protease cleavage as described in Band et al., “Recombinant Derivatives of botulinum Neurotoxin A Engingeered for Trafficking Studies and Neuronal Delivery,” Protein Expression & Purification 71:62 (2010), which is hereby incorporated by reference in its entirety. The purified protein was prepared as a stock at a concentration of 10 mg/ml in PBS containing 40% glycerol for stabilization. The studies described below, evaluate the recombinant molecule's toxicity and pharmacologic activity.

    [0118] Animals

    [0119] Mice: female Balb/C mice, 5 to 7 weeks old; weight around 19 +/−3 grams.

    [0120] Digit Abduction Score (DAS) Assay

    [0121] A modification of the classic mouse Digit Abduction Scoring (“DAS”) assay was used to determine local pharmacologic activity in muscle, measured by muscle weakening effectiveness, as described in Aoki, “Preclinical Update on BOTOX® (botulinum Toxin Type A)-Purified Neurotoxin Complex Relative to Other botulinum Neurotoxin Preparations,” European Journal of Neurology (1999), which is hereby incorporated by reference in its entirety. In the DAS Assay, mice are suspended by their tails briefly to elicit a characteristic startle response in which the animal extends its hind limbs and abducts its hind digits. The DAS assay is especially useful to compare the muscle weakening effectiveness of different BoNT preparations (Aoki, “Preclinical Update on BOTOX® (botulinum Toxin Type A)-Purified Neurotoxin Complex Relative to Other botulinum Neurotoxin Preparations,” European Journal of Neurology (1999) and Aoki, “A Comparison of the Safety Margins of botulinum Neurotoxin Serotypes A, B, and F In Mice,” Toxicon 39:1815-1820 (2001), which are hereby incorporated by reference in their entirety).

    [0122] This test was utilized to define pharmacological activity of BoNT A/ad-0 in mice. Mice were scored as having a positive DAS response when they were unable to fully extend all digits on the injected leg. A negative score is given to mice that spread the toes of the injected leg comparable to that of the non-injected leg.

    [0123] Female Balb/C mice were given unilateral gastrocnemius intramuscular injections with the concentration described in a volume of 3 μl of 0.9% NaCl using a 25 μl Hamilton syringe. Muscle weakness was assessed from day 1 until 5 days post injection by suspending the mice in order to elicit a characteristic startle response and observing whether the toes on the injected leg were spreading compared to the non injected leg.

    [0124] Measuring Paralysis

    [0125] Definitive paralysis is described using two independent variables. First, the inability to use the injected leg to walk (paralysis); and second, the inability to spread the toes on the injected leg (digital abduction).

    [0126] Results: Toxicity, LD.sub.50

    [0127] The BoNT A/ad-0 preparation described above was used for the following toxicity study. The study was designed to approximate the standard murine LD.sub.50 test for wild type BoNT A (“wt BoNT A”). See Pearce et al., “Measurement of botulinum Toxin Activity: Evaluation of the Lethality Assay,” Toxicol Appl Pharmacol. 128:69-77 (1994), which is hereby incorporated by reference in its entirety).

    [0128] A total of 30 female mice were used in this study. Each mouse was injected intraperitoneally with the indicated dose of BoNT A/ad-0 in 200 μl of PBS (Table 1), and observed for 24 hours.

    [0129] Doses ranging from 0.5 pg/mouse to 2 μg/mouse, based on the LD.sub.50 published by Pellett et al., “Neuronal Targeting, Internalization, and Biological Activity of a Recombinant Atoxic Derivative of botulinum Neurotoxin A,” Biochemical & Biophysical Research Communications 405(4):673-677 (2011), which is hereby incorporated by reference in its entirety), using BoNT A/ad (1.2 μg per mouse or 50 μg/kg body weight. The LD.sub.50 for BoNT A/ad-0 was found to be very similar to that for BoNT A/ad (Table 1). Briefly, 50% or 5 out of 10 mice injected with a dose of 50 μg/kg body weight showed symptoms of botulism intoxication by 36 hours. All mice injected with a dose of 2μg, which is approximately 83.3 μg/kg body weight, expired within 48 hours. From this study it is concluded that 50 μg/kg body weight is the approximate LD.sub.50 of BoNT A/ad-0.

    TABLE-US-00020 TABLE 1 Results of Toxicity (LD50) Study for BoNT A/ad-0 Injected Dose No. Mice Dead Survive   2 μg 10 10 0 1.2 μg 10 5 5   1 μg 5 1 4 0.5 μg 5 0 5

    [0130] The LD.sub.50 of wt BoNT A is approximately 0.5 ng/kg (Aoki, “A Comparison of the Safety Margins of botulinum Neurotoxin Serotypes A, B, and F In Mice,” Toxicon 39:1815-1820 (2001), which is hereby incorporated by reference in its entirety), or 100,000-fold lower than that of BoNT A/ad-0. Because of this toxicity, the effectiveness of wt BoNT A at extremely low doses, and the variability in potency for BoNTs produced from a wild type bacterial source, pharmacological doses of wt BoNT A are generally specified in terms of “activity units,” with 1 mouse LD.sub.50 of wt BoNT A considered to be 1 activity unit, or approximately 0.5 ng/kg of wt BoNT A (Aoki, “A Comparison of the Safety Margins of botulinum Neurotoxin Serotypes A, B, and F In Mice,” Toxicon 39:1815-1820 (2001), which is hereby incorporated by reference in its entirety). This takes into account concentration variations in the level of active toxin between preparations and manufacturers. Harmonized standards across producers remain undefined. This is due to both different manufacturing methods, batch-to-batch variation and difference in the mouse leathality assay protocol across different manufacturers, but is also related to marketing claims. The final pharmaceutical preparations are formulated with albumin (BOTOX®) and/or lactose (DYSPORT®)). From the LD.sub.50 results described here, it can be concluded that 1 LD.sub.50 Unit (1U) of BoNT A/ad-0 corresponds to a dose of approximately 50 μg/kg, or approximately 1.2 μg per mouse.

    [0131] Results: Muscle Paralysis Study/DAS Assay for Pharmacologic Activity In Vivo

    [0132] BoNT A/ad-0 described above was tested in the murine DAS to determine if BoNT A/ad-0 possesses pharmacological activity at doses significantly below its LD.sub.50, and whether it displays typical dose-response activity. Mice were injected in the gastrocnemius muscle with 3 μl of BoNT A/ad-0 in 0.9% NaCl using a 25 μl Hamilton Syringe. The doses administered are expressed as the μg administered per mouse, or units of BoNT A/ad-0 activity administered per mouse (Table 2).

    [0133] Two observations are noted to categorize a mouse as positive for muscle paralysis induced by administration of BoNT A/ad-0. First, by the inability of the mouse to use the injected leg to walk (muscle paralysis). Second, by observing whether the digits on the injected leg appeared collapsed (digital abduction). Definite muscle paralysis was initially observed and recorded 24 hours after the initial administration. Mice were daily evaluated for definitive muscle paralysis for a maximum of 5 days.

    [0134] The results of this pharmacologic study of BoNT A/ad-0 are shown in Table 2 and FIG. 2. Mice administered doses ranging from 0.008 LD.sub.50 units (0.01 μg) to 0.42 LD.sub.50 units (0.5 μg) of BoNT A/ad-0 showed definitive muscle paralysis and digital abduction (FIG. 2 and Table 2), without any signs of mortality. In fact, 4 out of 5 animals injected with 0.01 μg presented with muscle paralysis and some degree of digital abduction (Table 2), indicating that the ED.sub.50 for BoNT A/ad-0, the lowest dose at which 50% of the injected animals demonstrate the intended pharmacologic activity, is 0.01 μg or lower, which corresponds to 0.008 LD.sub.50 units or lower. All mice that presented paralysis on day 1 continued to present paralysis to the end of the study, day 5. No signs of systemic toxicity were observed in any of the mice in this study.

    [0135] These data confirm that BoNT A/ad-0 has similar pharmaceutical properties compared to wt BoNT A, albeit with a different dose-response profile, a significantly increased range of safe therapeutic activity and, therefore, an improved therapeutic index, and an improved safety margin. This comparison of BoNT A/ad-0 to pharmaceutical preparations of wt BoNT is illustrated in Table 3, and contrasted to the data reported by Aoki, “A Comparison of the Safety Margins of botulinum Neurotoxin Serotypes A, B, and F In Mice,” Toxicon 39:1815-1820 (2001), which is hereby incorporated by reference in its entirety. For instance, Aoki, “A Comparison of the Safety Margins of botulinum Neurotoxin Serotypes A, B, and F In Mice,” Toxicon 39:1815-1820 (2001), which is hereby incorporated by reference in its entirety, reported that the safety margin for BOTOX® is about 13.9 +/−1.7 and for DYSPORT® 7.6 +/−0.9. Here it is shown that at the lowest dose of BoNT A/ad-0 studied, 0.01 pg, definite paralysisis was observed in ⅘ mice. This dose can be considered a conservative estimate of the ED.sub.50. Therefore, for BoNT A/ad-0, the safety margin is approximately 120, or expressed differently, approximately 10-fold better than that for BOTOX® or DYSPORT® (Table 3).

    TABLE-US-00021 TABLE 2 Results of Pharmacologic Study of BoNT A/ad-0 Dose No. with Injected per Definitive No. Mouse LD.sub.50 Units No. Mice Paralysis Dead 0 (placebo) 0 9 0 0 0.01 μg 0.008 5 4 0  0.1 μg 0.08 5 5 0  0.5 μg 0.42 10 10 0    1 μg 0.83 5 5 0  1.2 μg 1 5 2 3  1.5 μg 1.25 5 1 4
    Naïve mice were administered BoNT A/ad-0 in the left gastrocnemius via intramuscular injection with 3 μl containing the indicated mass or units of BoNT A/ad-0.

    TABLE-US-00022 TABLE 3 LD50 and ED50 of BoNT A/ad-0 LD.sub.50 = ~1.2 μg ED.sub.50 = ~0.01 μg (ED.sub.50 = 0.01 μg or lower) LD.sub.50/ED.sub.50 = safety margin = ~120

    [0136] If expressed as units, the ED.sub.50 of BoNT A/ad-0 is 0.008 LD.sub.50 units, or lower.

    [0137] Comparison to Prior Studies and Conclusions

    Prior studies have found that mutations introduced into the light chain of recombinant BoNT A/ad (a molecule containing a cargo attachment peptide as described in U.S. Patent Application Publication No. 2011/0206616 to Ichtchenko and Band, which is hereby incorporated by reference in its entirety) increased the LD.sub.50 of the toxin by 100,000-fold. However, experimentation determined that recombinant BoNT Cyto-012 can cause an immunogenetic response in mice. See Vasquez-Cintron et al., “Pre-Clinical Study of a Novel Recombinant botulinum Neurotoxin Derivative Engineered for Improved Safety,” Sci. Rep. 6:30429 (2016), which is hereby incorporated by reference in its entirety.

    [0138] In the present study it was found that the LD.sub.50 of BoNT A/ad-0, which has identical toxin-disabling mutations as BoNT A/ad, is likewise elevated ˜100,000-fold relative to wt BoNT A. But surprisingly, it was observed that BoNT A/ad-0 still possessed pharmacologic activity similar to that observed for wt BoNT A, and that a therapeutic agent need not be delivered via the cargo site of BoNT A ad to render it therapeutic. By comparing the dose-response of BoNT A/ad-0 to that reported for pharmaceutical preparations of wt BoNT A, it can be concluded that BoNT A/ad-0 can be used for pharmaceutical treatments in the same way as wt BoNTs, but with significantly reduced danger of systemic toxicity, and thus significant improved safety advantages for clinical use.

    Example 2—BoNT A Can Cause an Immunogenetic Response in Mice

    [0139] As demonstrated in Example 1, the safety margin of botulinum neurotoxin (BoNT) can be improved by attenuating the activity of the light chain (LC) protease via substitution of amino acids in the protease active center. The molecules of Example 1 contain two amino acid substitutions (E224 >A and Y366 >A), and are approximately 100,000-fold less toxic than wt BoNT A1 (from which their sequence is derived), with a 2-fold improved safety margin (LD50/ED50 ratio).

    [0140] However, experimentation determined that recombinant BoNTs of Example 1 can cause an immunogenetic response in mice. See Vasquez-Cintron et al., “Pre-Clinical Study of a Novel Recombinant botulinum Neurotoxin Derivative Engineered for Improved Safety,” Sci. Rep. 6:30429 (2016), which is hereby incorporated by reference in its entirety. To overcome this limitation, we developed a recombinant BoNT derivative which was only 10-fold less toxic than wild type BoNT A1 (“Cyto-014”), and evaluated its safety, effectiveness, and immunogenicity.

    Example 3—Cyto-014 Overcomes the Immunological Limitations of BoNT A

    [0141] A recombinant BoNT derivative (“Cyto-014”, encoded by nucleotide sequence SEQ ID NO:18) with a single amino acid substitution in the metalloprotease domain was developed (Y366>F), in order to increase the potency of the derivative such that it was only 10-fold less toxic than wt BoNT A1, and which would thereby potentially overcome the immunological limitations of the molecules described in Example 1 and Vasquez-Cintron et al., “Pre-Clinical Study of a Novel Recombinant botulinum Neurotoxin Derivative Engineered for Improved Safety,” Sci. Rep. 6:30429 (2016), which is hereby incorporated by reference in its entirety. The molecular structure of Cyto-014 is identical to the previously tested Cyto-012 (the molecule described in Example 1), except that E224 is not substituted at all, and Y366 is replaced by phenylalanine (F) instead of alanine. This substitution is based on crystallographic studies of the BoNT A LC co-crystalized with its SNAP-25 substrate, and from studies of the catalytic activity of recombinant LC derivatives produced in E. coli. The substituting amino acid was chosen to be more structurally analogous to the amino acid substituted; thus instead of replacing Y366 with A, Y366 was replaced with F.

    [0142] As described in more detail below, the resulting active BoNT derivative produced after processing (Cyto-014, as shown in SEQ ID NOs:21-24) was tested in vivo and in-vitro. In primary rat hippocampal cultures, Cyto-014 cleaved SNAP-25 under conditions similar to wt BoNT A1. The potency of Cyto-014 was determined by the standard murine lethality assay to have an IP-LD.sub.50 35 pg in 25 g mice, compared to 4.6 pg in a 25 g mice for wild type BoNT A1. Using the murine digital abduction assay, Cyto-014 was found to have an IM -ED.sub.50 of 12 pg in 25 g mice compared to 0.6 pg in 25 g mice for wild type BoNT A1. The IM-LD.sub.50 of Cyto-014 was 240 pg in 25 g mice compared to 6.22 pg in 25 g mice for wild type BoNT A1. Thus, Cyto-014 has a safety margin (IMLD.sub.50/IMED.sub.50 ratio) of 20 compared to a safety margin of 13 for wild type BoNT A1. When mice are subjected to repeat treatment 4 weeks after the first treatment with Cyto-014, overall treatment response (area under the DAS score curve) is similar to that for first injection. When the sera of mice receiving two injections of Cyto-014 was evaluated by ELISA for anti-BoNT A1 antibodies, there was no increase in immunoreactivity compared to mice receiving two injections of wt BoNT A1. When the same sera was evaluated for the presence of BoNT A neutralizing antibodies, no BoNT A neutralizing activity was found.

    [0143] Expression

    [0144] Cyto-014 was expressed and purified using previously published methods. FIG. 3 illustrates the expression, purification and activation of Cyto-014. Briefly, the Cyto-014 genetic construct is optimized for expression in insect cells. The construct includes an N-terminal signal sequence followed by a histidine affinity tag followed by the modified LC and heavy chain (HC) of BoNT A1, followed by strep affinity tags (SEQ ID NO:20). TEV protease cleavage sites have been placed between the affinity tags on the N- and C-termini, and between the LC and HC. The expressed proprotein is collected from the media (FIG. 3, lane 2, SEQ ID NO:20) as a soluble, stable proprotein, which is concentrated and purified by 2-step tandem affinity chromatography. The inactive proprotein is treated with TEV to enable simultaneous removal of the affinity tags and activation of the proprotein into the pharmacologically active disulfide-bonded heterodimer, and polished to remove impurities and produce the pure 150-kD Cyto-014 active drug (FIG. 3, lanes 15-16 reduced, SEQ ID NOs:21 (light chain) and 22 (heavy chain).

    [0145] Cyto-014 IP-LD.sub.50 Determination:

    [0146] The mouse lethality assay (MLA) was used to determine the LD.sub.50 of Cyto-014 and thereby define its Unit of activity (pg per LD.sub.50 unit) in the fashion used to specify the activity of pharmaceutical BoNT products. Serial dilutions of purified Cyto-014 were injected into the intraperitoneal (IP) space of mice, and the average survival for each dosage group determined. A best-fit logistic regression curve calculated an IP-LD.sub.50 (1 Unit activity) for Cyto-014 of 35 pg. This is ˜8-fold less toxic than wt BoNT A1 (FIG. 5 and Table 4).

    [0147] Cyto-014 IM-ED50 and LD50 Determination:

    [0148] A wide-ranged dose-response study was performed comparing Cyto-014 to wt BoNT A, using the DAS assay to quantify effectiveness and survival to quantify toxicity. Mice were injected into the gastrocnemius muscle, as previously described and paralysis was measured using the DAS assay. An evaluator blinded to treatment group performed DAS assessments. FIGS. 6 and 7 present the average survival and mean DAS response for each dosage group. The IM-LD.sub.50 and IM-ED.sub.50 were calculated from these curves by logistic regression analysis. The IM-LD.sub.50 for Cyto-014 was determined to be 240 pg, and the IM-ED.sub.50 12 pg. This yields a calculated safety margin (IM-LD.sub.50/ED.sub.50 ratio) for Cyto-014 of 20.

    TABLE-US-00023 TABLE 4 Summary of Safety Margin Results IP-LD.sub.50 IM-LD.sub.50 IM-ED.sub.50 Safety Margin (95% Cl) (95% Cl) (95% Cl) (95% Cl) wt BoNT 4.6 pg  9.8 pg 0.74 pg 13 A1 (4.0-5.3) (8.0-12)  (0.57-0.98) (12-14) Cyto-014  35 pg 240 pg   12 pg 20 (22-56) (190-300) (6.8-19)  (16-28)

    [0149] The data described above show that Cyto-014 could be reliably produced in an Sf9-baculovirus system and purified to homogeneity. Cyto-014 was also found to have potency at the desired dose range, and to demonstrate an increased safety margin compared to wt BoNT A1. Cyto-014 was found to have an IMED.sub.50 of 12 pg, combining the pharmacological activity of BoNT A1 with a lower risk of lethality. This IM-ED.sub.50 is orders of magnitude lower than that reported for the previous double-mutant, Cyto-012, which should allow it to be repeatedly effective in mice without inducing a disadvantageous humoral immune response. These preliminary data suggest that Cyto-014 meets the criteria required for a rBoNT A derivative to have an improved safety margin, while remaining potent enough to minimize immunological reactivity and allow effective repeat treatment.

    [0150] ELISA Studies

    [0151] Enzyme-linked immunosorbent assays (ELISA) were carried out on 96-well plates as follows: 1) coating: with 4 μ.g/mL of Cyot-014 in 0.01M sodium bicarbonate buffer, pH 9.5, overnight; 2) blocking with 2% BSA, 200 μL/well, for two hours at room temperature; 3) incubating with sera diluted 1:50, 1:150, 1:450. 1:1250 in 0.1% BSA/PBS for 2 hours at room temperature; 4) incubating with 1:10,000 of 2Ab HRP-conjugate (anti-IgG and IgM); 5) develop with TMB solution for twenty minutes; and 6) stop reaction with H.sub.2SO.sub.4. Washes were performed after steps 1-4. This procedure was carried out separately on pooled and unpooled samples as follows.

    [0152] First Bleed (pooled) ELISA protocol: small samples of serum (100 μL) were collected from the tail veins of mice two weeks after the first injection. Serum from individual mice per group (n=3-5) were pooled together to perform ELISA assay. Compromised serum samples (hemolytic, icteric, or lipemic) were omitted from the experiment. Samples were run in duplicates. All incubation step were performed at room temperature for one hour using 50 μL/well unless otherwise stated.

    [0153] Second Bleed (unpooled) ELISA protocol: larger samples of serum were collected by cardiac puncture two weeks after the second injection. Serum from individual mice per group (n=3-5) were used without pooling to perform the ELISA assay. Samples were run in duplicates. All incubation step were performed at room temperature for one hour using 50 μL/well unless otherwise stated.

    [0154] The results of the 2.sup.nd bleed (pooled) ELISA experiments are shown in FIGS. 8A-8D. The results of the 2.sup.nd bleed individual mouse sera (unpooled) ELISA are shown in FIGS. 9A-9B. The results for the positive control, using an antibody that recognizes BoNT A, are shown in FIG. 10. Thes results of these ELISA experiments demonstrate that when the sera of mice receiving two injections of Cyto-014 was evaluated by ELISA for anti-Cyto-014 antibodies, there was no increase in immunoreactivity compared to mice receiving two injections of wild type BoNT A1 despite administration at 10-fold higher doses.

    [0155] Mouse Protection Assay

    [0156] When the sera collected two weeks after the second injection was evaluated for the presence of BoNT A neutralizing antibodies using the mouse protection assay, no BoNT A neutralizing activity was found in the sera of the Cyto-014 treated mice. Wild type BoNT A (2IP-LD.sub.50; ˜8 pg per mouse) ws mixed with mouse sera collected from animals injected with Cyto-014 or wild type BoNT A at a 6:1 toxin to neat serum ratio. The mixture was incubated for 30 minutes prior to injections. At time 0, mice were injected with 0.250 mL of toxin-serum mixture via the intraperitoneal cavity and monitored for 72 hours. Survival was used as a primary readout.

    [0157] The results of the mouse protection assay are shown in FIGS. 11A-11B.

    Example 4—Cyto-013 Overcomes the Immunological Limitations of BoNT A

    [0158] A recombinant BoNT derivative (“Cyto-013”), encoded by nucleotide sequence SEQ ID NO:19) with a single amino acid substitution in the metalloprotease domain is developed (E.sub.224>Q) in order to increase the potency of the derivative such that it is only approximately 10-fold less toxic than wt BoNT A1, and which would thereby potentially overcome the immunological limitations of the molecules described in Example 1 and Vasquez-Cintron et al., “Pre-Clinical Study of a Novel Recombinant botulinum Neurotoxin Derivative Engineered for Improved Safety,” Sci. Rep. 6:30429 (2016), which is hereby incorporated by reference in its entirety. The molecular structure of Cyto-013 is identical to the previously tested Cyto-012 (the molecule described in Example 1), except that E.sub.224 is substituted with a glutamine (Q) instead of an alanine, and Y.sub.366 is not substituted at all. This substitution is based on crystallographic studies of the BoNT A LC co-crystalized with its SNAP-25 substrate, and from studies of the catalytic activity of recombinant LC derivatives produced in E. coli. The substituting amino acid was chosen to be more structurally analogous to the amino acid substituted; thus instead of replacing E.sub.224 with A, E.sub.224 is replaced with Q.

    [0159] The immunological reactivity and efficacy of Cyto-013 is tested as described in Example 3 for Cyto-014.

    [0160] Although the application has been described in detail for the purposes of illustration, it is understood that such detail is solely for that purpose, and variations can be made therein by those skilled in the art without departing from the spirit and scope of the application which is defined by the following claims.