BIOSYNTHESIS OF BIFUNCTIONAL TERPENOIDS
20250354182 ยท 2025-11-20
Assignee
Inventors
Cpc classification
C12P5/007
CHEMISTRY; METALLURGY
C12Y101/01034
CHEMISTRY; METALLURGY
International classification
Abstract
A strain of Yarrowia lipolytica was engineered to overexpress -hydroxy -methylglutaryl-CoA reductase and farnesyl pyrophosphate synthase, as rate-limiting enzymes in the mevalonate and sesquiterpenoid synthesis pathways respectively. Metabolite extracts from this strain were run on LC-MS and showed a number of novel compounds being produced, including terpenoids varying in lengths and oxidation states. Upon NMR and MS/MS structure validation as well as biochemical assays, these compounds were determined as a new class of non-natural compounds, bifunctional terpenoids. Studies on the overexpression of P450 enzymes, alcohol oxidase, aldehyde dehydrogenase, and alcohol dehydrogenase showed that expression of these enzymes in addition to -hydroxy -methylglutaryl-CoA reductase and farnesyl pyrophosphate synthase increase the production of bifunctional terpenoids. Bioactivity assays demonstrate the application of bifunctional terpenoids.
Claims
1. A composition of matter comprising a bifunctional terpenoid and a microorganism engineered to overexpress -hydroxy -methylglutaryl-CoA reductase and farnesyl pyrophosphate synthase.
2. The composition of claim 1, wherein the microorganism is further engineered to overexpress ALK3, ALK4, ALK5, ALK6 and/or ALK7 and oxidases and dehydrogenases, such as AOX, ALDH2, ADH1 and/or ADH3.
3. The composition of claim 1, wherein the bifunctional terpenoid comprises an isoprenoic diacid, a geranoic diacid, a farnesoid diacid, a geranylgeranoic diacid and/or a geranylfarnesoic diacid as well as their dihydro versions.
4. The composition of claim 1, wherein the bifunctional terpenoid comprises at least one compound comprising a structure: ##STR00005## where R.sub.1 and R.sub.2 are each CH.sub.3, CH.sub.2OH, CHO, or CO.sub.2H, and n is a whole number.
5. A composition of matter comprising microorganisms making a bifunctional terpenoid, wherein when combined with a culture media at 30 C., the microorganism makes the bifunctional terpenoid such that concentrations of the bifunctional terpenoid is at least 0.1, 0.5, 1 or 10 milligrams/L in the microorganisms within the culture media.
6. The composition of claim 5, wherein the microorganism is a yeast.
7. The composition of claim 5, wherein the microorganism is a Yarrowia, Saccharomyces, Candida, Rhodosporidium, Cryptococcus, Rhodotorula, Lipomyces, or Trichosporon yeast species or an Escherichia, Methylobacterium, or Rhodococcus bacteria species.
8. The composition of claim 5, wherein the microorganism comprises exogenous/altered nucleic acid sequences that increase the expression of -hydroxy -methylglutaryl-CoA reductase and farnesyl pyrophosphate synthase in the microorganism.
9. The composition of claim 8, wherein the microorganism comprises exogenous/altered nucleic acid sequences that increase the expression of ALK3, ALK4, ALK5, ALK6 and/or ALK7 and AOX, ALDH2, ADH1 and/or ADH3 polypeptides in the microorganism.
10. The composition of claim 5, wherein: the culture media does not include glucose as a carbon source; the culture media includes gluconate and/or acetate; and/or the culture media includes one or more agents selected to increase the production of bifunctional terpenoids.
11. The composition of claim 5, wherein the bifunctional terpenoid comprises a compound having a formula: ##STR00006## where R.sub.1 and R.sub.2 are each CH.sub.3, CH.sub.2OH, CHO, or CO.sub.2H, and n is a whole number.
12. A method of making a bifunctional terpenoid comprising: combining a microorganism with a culture media, wherein: the microorganism is selected to comprise exogenous/altered nucleic acid sequences selected to increase the expression of -hydroxy -methylglutaryl-CoA reductase and farnesyl pyrophosphate synthase polypeptides in the microorganism; and the culture media is selected to allow the production of the bifunctional terpenoid when the microorganism is disposed therein; such that the bifunctional terpenoid is made.
13. The method of claim 12, wherein the microorganism is further selected to comprise exogenous/altered nucleic acid sequences selected to increase the expression of ALK3, ALK4, ALK5, ALK6, ALK7, AOX, ALDH2, ADH1 and/or ADH3 polypeptides in the engineered microorganism.
14. The method of claim 12, wherein the microorganism is a Yarrowia, Saccharomyces, Candida, Rhodosporidium, Cryptococcus, Rhodotorula, Lipomyces, or Trichosporon yeast species or an Escherichia, Methylobacterium, or Rhodococcus bacteria species.
15. The method of claim 12, wherein the culture media comprises a YPD culture media, a YNB culture media, LB culture media, or M9 culture media.
16. The method of claim 12, wherein amounts of the bifunctional terpenoid within microorganism cells in the culture media are at least 0.1, 0.5, 1 or 10 milligrams/L.
17. The method of claim 12, further comprising performing a purification process on the bifunctional terpenoid.
18. The method of claim 17, further comprising performing a polymerization process on the bifunctional terpenoid.
19. The method of claim 17, further comprising performing a functionalization and/or cyclization process on the bifunctional terpenoid.
20. The method of claim 12, wherein: the culture media does not include glucose as a carbon source; the culture media includes gluconate and/or acetate; and/or the culture media includes one or more agents selected to increase the production of bifunctional terpenoids.
21. A bifunctional terpenoid made by the method of claim 12.
22. A composition of matter comprising at least one bifunctional terpenoid compound shown in
23. The composition of claim 22, further comprising a microorganism engineered to overexpress -hydroxy -methylglutaryl-CoA reductase and farnesyl pyrophosphate synthase.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION OF THE INVENTION
[0028] In the description of embodiments, reference may be made to the accompanying figures which form a part hereof, and in which is shown by way of illustration a specific embodiment in which the invention may be practiced. It is to be understood that other embodiments may be utilized, and structural changes may be made without departing from the scope of the present invention. Many of the techniques and procedures described or referenced herein are well understood and commonly employed by those skilled in the art. Unless otherwise defined, all terms of art, notations and other scientific terms or terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art.
[0029] Metabolism encompasses a vast and valuable repository of chemicals and reactions within biological organisms. Primary metabolism, involving reactions essential for growth and life, is well understood and largely conserved across all kingdoms of life. In contrast, secondary metabolism, which comprises specialized reactions for environmental interactions, remains underexplored. The molecules produced by secondary metabolism, commonly known as natural products (NPs), form a diverse chemical space that provides ecological advantages to the producing organisms. Some of these NPs include pheromones for chemical communication, siderophores for iron sequestration, and defense molecules to deter herbivores.
[0030] NPs encompass a wide array of bioactive molecules valuable to the pharmaceutical, agricultural, and nutrition industries. One of the most important discoveries of the 20th century is the antibiotic penicillin, produced by Penicillium, which has served as a life-saving drug for humans. Similarly, the antiparasitic drug ivermectin, derived from various soil bacteria, provides significant therapeutic benefits to humans with parasitic-borne diseases. These biochemical landmarks are attributed to serendipity. Thus, developing systematic strategies to navigate the extensive chemical space of secondary metabolism is crucial for uncovering new NPs as well as synthesizing new non-natural products (NNPs).
[0031] NPs and NNPs stem from a select few building blocks that are coupled to form general carbon scaffolds. Polyketides are derived from acyl-CoA units, terpenoids are built from isoprenyl units, and amino acids afford non-ribosomal peptides and phenylpropanoids. These general carbon backbones are then further functionalized by biosynthetic enzymes often specific to the organism, yielding a vast diversity of NPs with much more diverse functions and bioactivity than their core structures. Furthermore, several important NPs are biosynthesized through convergent pathways, featuring building blocks from different classes. These additional features, such as glycosyl groups for recognition and isoprenyl moieties for altered solubility, enhance their functionality both for the producer and for human applications. Thus, from a few building blocks, there is a wide variety of NPs and NNPs through shared precursors and distinct biosynthetic enzymes.
[0032] Building upon the idea of a limited yet shared pool of precursors potentially limiting (N)NP production, we sought to increase biosynthetic precursor availability to directly induce metabolic conditions favorable for (N)NP production and discovery. Instead of relying on modifying culture conditions to trigger production, genetic engineering can allow for the rational manipulation of specific enzymes to alter metabolic flux, such as overexpressing enzymes that are rate-limiting in biosynthesis. Using mass spectrometry-based detection, the metabolomes of modified and unmodified strains can be compared, enabling the identification of candidate compounds with much greater sensitivity than traditional bioactivity assays. This approach can be particularly fruitful for genetically tractable organisms by investigating their carbon yield, or the carbon output as the target product per input substrate carbon. With advancements in genetic tools, the large-scale production of (N)NPs through metabolic engineering has become accessible, yet carbon yield remains low as not all carbons are accounted for. By tracking biosynthetic precursor utilization with untargeted metabolomics, this is an orthogonal method to discover (N)NPs only accessible through a genetic manipulation of carbon flux.
[0033] Leveraging this carbon flux-pushing metabolome mining strategy, we performed untargeted metabolomics on a metabolically engineered chemical space and discovered terpenoids that, to our knowledge, have not been reported before (see, e.g.
[0034] Yarrowia lipolytica is often employed for heterologous expression and production of various lipids and metabolites. However, its terpenoid metabolism is underexplored. Here, we report the production of novel terpenoid compounds being produced through overexpression of -Hydroxy -methylglutaryl-CoA reductase (HMGR) and farnesyl diphosphate synthase (FPPS). Structure elucidation revealed that the new compound was a diacid derivative of farnesol, and overexpression of cytochrome P450 enzymes in the CYP52 family increased production of the compound and various other diacids. Interestingly, these P450s (ALK3-7) had different selectivity for different chain length bifunctional terpenoids. Our final engineered strain overexpressing HMGR, FPPS, and ALK5 had a 60-fold increase over the strain overexpressing only HMGR and FPPS. Our findings demonstrate that increased precursor supply and oxidative capacity in microorganisms such as Y. lipolytica unveil the untapped terpenoid chemical space.
[0035] Over the past several years, Yarrowia lipolytica has emerged as a prominent industrial organism in biotechnology to produce various commodity chemicals and acetyl-CoA-based terpenoids and polyketides. This research often involves overexpression of heterologous biosynthetic enzymes or pathways to produce a compound outside of its endogenous metabolism. However, the terpenoid and polyketide chemical space has yet to be fully mapped.
[0036] In Y. lipolytica and many other organisms, farnesyl diphosphate (FPP) is a central precursor to many terpene-derived natural products, including the triterpenoid squalene, and the sterol ergosterol. Its role in the biosynthesis of important lipids and fungal cell membranes components makes FPP a branchpoint in terpenoid metabolism, with little accumulation in the Y. lipolytica. Thus, an increase of FPP availability may allow for direction of flux towards unmapped pathways to produce novel molecules.
[0037] We set out to examine whether Y. lipolytica is capable of producing any novel terpenoids through an increased precursor FPP supply. In our investigation, we discovered and isolated a number of compounds including a new compound termed farnesoic diacid, a derivative of farnesol with carboxylic acid functionality at both termini of the molecule. We identified several cytochrome P450 enzymes (ALK3-7) that are involved in the biosynthesis of farnesoic diacid. The novel compounds were further confirmed by analyzing tandem mass spectrometry (MS/MS) fragmentation patterns and NMR. By combining the engineering strategies of increased precursor supply and increased expression of relevant biosynthetic enzymes, we designed a strain to overexpress HMGR, FPPS, and ALK5 resulting in a substantial accumulation of farnesoic diacid. To our knowledge, this is the first observed biosynthesis of farnesoic diacid in Y. lipolytica, representing the viability in activating silent biosynthetic pathways through increasing precursor availability.
[0038] As shown in
[0039] The invention disclosed herein has a number of embodiments. Embodiments of the invention include, for example, a composition of matter comprising one or more compounds shown in
[0040] Embodiments of the invention include a microorganism engineered to make a bifunctional terpenoid compound. Typically such compositions include a microorganism engineered to overexpress -hydroxy -methylglutaryl-CoA reductase (HMGR) and farnesyl pyrophosphate synthase (FPPS). In certain embodiments of the invention, the microorganism is further engineered to overexpress additional proteins such as phosphatases, oxidases, dehydrogenases, P450 enzymes, and the like, for example ALK3, ALK4, ALK5, ALK6 and/or ALK7 for P450 enzymes, Q6C1F6 (YALI0F16709g) for phosphatase, Q6CCQ8 (YALI0C07414g) for alcohol dehydrogenase, and Q6CG32 (YALI0B01298g) for aldehyde dehydrogenase. In some embodiments of the invention, the compound comprises an isoprenoic diacid, a geranoic diacid, geranoic diacid, a geranylgeranoic diacid, a geranylfarnesoic diacid and a squalene diacid. In certain embodiments of the invention, the terpenoid diacid comprises a compound having the general structures where n is a whole number:
##STR00003##
[0041] In some embodiments of the invention, the bifunctional terpenoid comprises a terpene having various oxidation states of its termini with the general structures and formulas:
##STR00004##
where R.sub.1 and R.sub.2 are each CH.sub.3, CH.sub.2OH, CHO, or CO.sub.2H, and n is a whole number. Compounds made by the methods of the invention include those shown in Table 1 below.
TABLE-US-00001 TABLE 1 COMPOUNDS OF THE INVENTION Formula R Dihydro (Y/N) C.sub.5nH(.sub.8n2)O.sub.4 R.sub.1 = R.sub.2 = CO.sub.2H N C.sub.5nH.sub.8nO.sub.4 R.sub.1 = R.sub.2 = CO.sub.2H Y C.sub.5nH(.sub.8n+2)O R.sub.1 = CH.sub.2OH, R.sub.2 = Me N C.sub.5nH(.sub.8n+4)O R.sub.1 = CH.sub.2OH, R.sub.2 = Me Y C.sub.5nH.sub.8nO R.sub.1 = CHO, R.sub.2 = Me N C.sub.5nH(.sub.8n+2)O R.sub.1 = CHO, R.sub.2 = Me Y C.sub.5nH.sub.8nO.sub.2 R.sub.1 = CO.sub.2H, R.sub.2 = Me N C.sub.5nH(.sub.8n+2)O.sub.2 R.sub.1 = CO.sub.2H, R.sub.2 = Me Y C.sub.5nH(.sub.8n+2)O.sub.2 R.sub.1 = CH.sub.2OH, R.sub.2 = CH.sub.2OH N C.sub.5nH(.sub.8n+4)O.sub.2 R.sub.1 = CH.sub.2OH, R.sub.2 = CH.sub.2OH Y C.sub.5nH.sub.8nO.sub.2 R.sub.1 = CHO, R.sub.2 = CH.sub.2OH or N R.sub.1 = CH.sub.2OH, R.sub.2 = CHO C.sub.5nH(.sub.8n+2)O.sub.2 R.sub.1 = CHO, R.sub.2 = CH.sub.2OH or Y R.sub.1 = CH.sub.2OH, R.sub.2 = CHO C.sub.5nH.sub.8nO.sub.3 R.sub.1 = CO.sub.2H, R.sub.2 = CH.sub.2OH or N R.sub.1 = CH.sub.2OH, R.sub.2 = CO.sub.2H C.sub.5nH(.sub.8n+2)O.sub.3 R.sub.1 = CO.sub.2H, R.sub.2 = CH.sub.2OH or Y R.sub.1 = CH.sub.2OH, R.sub.2 = CO.sub.2H C.sub.5nH(.sub.8n2)O.sub.2 R.sub.1 = R.sub.2 = CHO N C.sub.5nH.sub.8nO.sub.2 R.sub.1 = R.sub.2 = CHO Y C.sub.5nH(.sub.8n2)O.sub.3 R.sub.1 = CO.sub.2H, R.sub.2 = CHO or N R.sub.1 = CHO, R.sub.2 = CO.sub.2H C.sub.5nH.sub.8nO.sub.3 R.sub.1 = CO.sub.2H, R.sub.2 = CHO or Y R.sub.1 = CHO, R.sub.2 = CO.sub.2H
[0042] Embodiments of the invention also include compositions of matter comprising a microorganism making a bifunctional terpenoid, wherein when disposed in YPD and YNB culture media at 30 C., the microorganism can make the bifunctional terpenoid such that concentration of the bifunctional terpenoid is at least 0.1, 0.5, 1 or 10 milligrams/L, distributed in the microbial cells as well as the culture media.
[0043] Embodiments of the invention can utilize a variety of different microorganisms (see, e.g., Patel et al., Microorganisms. 2020 Mar. 19; 8 (3): 434). In typical embodiments of the invention, the microorganism is a yeast. Optionally, for example, the microorganism is a Yarrowia, Saccharomyces, Candida, Rhodosporidium, Cryptococcus, Rhodotorula, Lipomyces, or Trichosporon yeast species. In such embodiments of the invention, the microorganism comprises exogenous/altered nucleic acid sequences that increase the expression of -hydroxy -methylglutaryl-CoA reductase and farnesyl pyrophosphate synthase in the microorganism. In certain embodiments of the invention, the microorganism is a bacteria such as Escherichia, Methylobacterium, or Rhodococcus. In certain embodiments of the invention, the microorganism also comprises exogenous/altered nucleic acid sequences that increase the expression of additional proteins such as phosphatases, oxidases, dehydrogenases, and P450 enzymes and the like, for example ALK3, ALK3, ALK4, ALK5, ALK6, ALK7, Q6C1F6 (YALI0F16709g), Q6CCQ8 (YALI0C07414g), and/or Q6CG32 (YALI0B01298g) polypeptides in the microorganism.
[0044] Embodiments of the invention also include methods of making a bifunctional terpenoid disclosed herein (see, e.g.
[0045] Embodiments of the invention include methods of using a bifunctional terpenoid disclosed herein, for example to increase microbial cell growth and/or inhibit mammalian cell growth as shown in
[0046] In addition, the molecules that we discovered represent an exciting pool of organic building blocks that for novel polymer synthesis with desaturated branched-chains, variable chain lengths, and terminal functionalities. Furthermore, the molecules that we discovered may be used as effectors of mammalian cell lipid metabolism and signaling molecules in methods of treating cancer-like mammalian cells with farnesoic diacid to decrease cell growth rate.
[0047] As discussed in detail below, in illustrative working embodiments of the invention, a strain of Yarrowia lipolytica PO1f (ATCC MYA-2613) was engineered to overexpress -hydroxy -methylglutaryl-CoA reductase (YALI0E04807g) and farnesyl pyrophosphate (FPP) synthase (YALI0E05753g), as rate-limiting enzymes in the mevalonate pathway and sesquiterpenoid synthesis respectively. Metabolite extractions from this strain were run on liquid chromatography-mass spectrometry (LC-MS) and showed a novel compound being produced, with a molecular weight of about 266 g/mol. To elucidate the structure, eight liters of the strain was cultured and about 4 mg of this compound was purified. Upon NMR structure validation, this compound was termed farnesoic diacid, as it resembles farnesol with two terminal carboxylic acids. Currently, its biosynthetic enzymes are known, with one of potential pathway known. Several P450 enzymes were screened. These include ALK3 (YALI0E23474p), ALK4 (YALI0B13816p), ALK5 (YALI0B13838p), ALK6 (YALI0B01848p), ALK5 (YALI0A15488p), which are P450 enzymes that are involved in the conversion of dodecanoic acid to dodecanedioc acid due to structural similarity of proposed substrates. The biosynthesis follows -oxidation via ALK5 and AOX to farnesoic acid, followed by -hydroxylation by ALK5 to 12-hydroxyfarnesoic acid. Then AOX and ALDH2 will oxidize the -termini to the aldehyde and acid, respectively. Other alcohol dehydrogenases may also be involved in alcohol oxidation at either terminus, representing another branch in the biosynthetic pathway. Compounds derived from squalene, geranylfarnesol, geranylgeraniol, geraniol, and isoprenol were also seen from metabolite extractions, and several were identified and confirmed via NMR, providing evidence of wide substrate usage when it comes to carbon chain lengths.
[0048] Briefly, our studies initially set out to examine whether Y. lipolytica is capable of producing any novel terpenoids through an increased precursor FPP supply. In our investigation, we discovered and isolated a new compound termed farnesoic diacid, a derivative of farnesol with carboxylic acid functionality at both ends of the molecule. We identified several cytochrome P450 enzymes (ALK3-7) that are implicated in the biosynthesis of farnesoic diacid. By combining the engineering strategies of increased precursor pools and increased expression of relevant biosynthetic enzymes, we designed a strain to overexpress HMGR, FPPS, and ALK5 resulting in a substantial farnesoic diacid production. We mapped its biosynthetic pathway by characterizing each enzyme individually, as well as conferring the full pathway in a heterologous host for de novo production of farnesoic diacid. We also identified a number of peaks corresponding to novel bifunctional terpenoids through overexpression of key biosynthetic enzymes, demonstrating a new class of NNPs being produced as a result of rational strain engineering. To our knowledge, this is the first observed biosynthesis of farnesoic diacid, other terpenoid diacids, and bifunctional terpenoids in Y. lipolytica and other microorganisms. Our work constitutes a general metabolic engineering strategy for discovering novel biosynthetic pathways through increasing precursor supply and oxidative capacity in microorganisms.
EXAMPLES
Example 1: Biosynthesis of Novel Bifunctional Terpenoids in Yarrowia Lipolytica
[0049] The metabolome encompasses a diverse array of small molecules with bioenergetic, biosynthetic, and specialized functions. Secondary metabolism produces numerous specialized metabolites; however, we have yet to complete the map of its biochemical networks and realize its full potential. Here, we map the uncharted terpenoid chemical space using an engineered oleaginous yeast Yarrowia lipolytica. Pushing carbon flux through the mevalonate pathway by overexpression of its rate-determining steps results in various functionalities on terpene backbones. Using nuclear magnetic resonance spectroscopy, mass spectrometry, and biochemical assays, we uncover a novel class of terpenoids that are variously functionalized at both termini. We reconstitute their biosynthetic routes and provide a glimpse of their bioactivities in bacteria and cancer cells. We discover that one of our novel molecules, farnesoic diacid, increases microbial cell growth and decreases mammalian (cancer-like) cell growth. These findings suggest potential application of our novel molecules in the biotechnology industry to enhance the growth of microorganisms for bioproduct synthesis and to inhibit cancer growth. Other bifunctional terpenoids present a growing arsenal of biochemical compounds with novel bioactivities.
Enhanced Terpenoid Precursor Flux Yields a Novel Farnesol-Derived Diacid
[0050] A key characteristic of Y. lipolytica is its inherent hydrophobic metabolism and intracellular environment, which enables the production of lipid droplets and ample supply of acetyl-CoA. To investigate and engineer this hydrophobic chemical space, we overexpressed 3-hydroxy-3-methyl-glutaryl-coenzyme A reductase (HMGR) and farnesyl pyrophosphate synthase (FPPS), which are rate-limiting enzymes in the mevalonate pathway and sesquiterpenoid synthesis.sup.1 respectively.
[0051] We began by profiling the metabolome of our engineered strain of Y. lipolytica and comparing it to the wild-type at two points during both the exponential and lipogenic phases (
[0052] With confirmation that our engineered strain exhibited increased mevalonate and terpenoid flux, we aimed to identify novel compounds within the engineered strain's chemical space. LC-MS peaks from both the wild-type and engineered strains were collected from extractions from whole cultures three days post-inoculation, revealing unique peaks in the engineered strain. Filtering for plausible terpenoid monoisotopic mass-to-charge ratios (m z) and retention times identified four prominent unique peaks (
[0053] Following compound purification via culture extraction and structural elucidation through nuclear magnetic resonance (NMR) spectroscopy (
Identification and Structural Determination or Related Sesquiterpenoid-Derived Compounds
[0054] Since farnesoic diacid production resulted solely from overexpression of the mevalonate pathway, we hypothesized that increased flux toward FPP led to the activation of otherwise silent metabolic routes, where enzymes catalyzed the requisite oxidation reactions. Given the structural transformations required, we proposed that oxidation could occur at either the - or -termini of the molecule to our confirmed compound farnesoic diacid (12a) (
[0055] Indeed, we observed peaks corresponding to the expected m z values of several proposed intermediates (
ALK Enzymes Drive Farnesoic Diacid Biosynthesis
[0056] Given that 12a was discovered through untargeted metabolomics, we could not employ the conventional genome-mining strategy to identify the associated biosynthetic genes corresponding to an NP. We reasoned that enzymes that work on aliphatic substrates would facilitate terminal oxidation. The initial oxidation step involves Cytochrome P450-mediated CH bond activation to introduce a hydroxyl group, with the P450 enzymes belonging to the CYP52 gene family found in various fungi that can assimilate hydrophobic substrates. In Y. lipolytica, these P450s, known as ALK proteins, have been shown to oxidize fatty acids and alkanes.sup.2. The final -terminus oxidations of fatty acids and alkanes are carried out by non-P450 oxidizing enzymes; Y. lipolytica utilizes an alcohol oxidase (AOX) and various aldehyde dehydrogenases (ALDH) 3.4. To test the biocatalytic activity of each of these enzymes, we examined their individual activity in heterologous systems by substrate-to-product conversion.
[0057] Given the challenges of in vitro P450 expression, we created a strain of S. cerevisiae with episomal expression of ALK5 for whole cell biocatalysis. The culture was grown and exchanged into a Tris buffer with or without farnesol (1a). This resulted in the emergence of previously verified compound 6a in the ALK5 with 1a reaction, but not in the empty vector and no 1a controls (
[0058] Next, we performed in vitro reactions with AOX expressed and purified from E. coli. This afforded a new compound 9a (MWT: 250) was observed in reactions with both 6a and AOX while absent in control reactions (
[0059] To assay the activity of ALDH2, we first attempted S. cerevisiae biotransformation. However, this resulted in background activity with aldehyde oxidation, likely due to the presence of promiscuous ALDHs in S. cerevisiae or the high reactivity of 9a (
[0060] With several biosynthetic enzymes identified, we then examined the impact of their overexpression in Y. lipolytica (
Pathway Reconstitution and Kinetics Reveal Multifunctionality of AOX and Substrate Preference of ALK5
[0061] To examine the production of 12a and its precursors in a heterologous host, we reconstituted the entire biosynthetic pathway in S. cerevisiae (
[0062] Considering the increased accumulation of 6a with AOX expression (in addition to ALK5 expression) in our in vivo reconstitution system, we hypothesized that AOX facilitates more efficient biocatalysis of 6a. To explore this, we conducted a time-course biotransformation assay (
[0063] These results provide evidence that while ALK5 alone can convert farnesol to 6a through farnesoic acid as an intermediate, the initial -oxidation step is slower than the subsequent -oxidation. However, AOX enables the accumulation of farnesoic acid, thus accelerating the production of 6a by ALK5. We posit that this kinetic difference is likely due to a substrate preference for more oxidized farnesol derivatives, which is further supported by biotransformation assays. Although farnesol, farnesal, and farnesoic acid were all utilized, increasing levels of production of 6a were obtained as the oxidation state of the substrate increased. While the ability of ALK5 has been shown to oxidize both alcohols and fatty acids.sup.7, our kinetic studies establish the differential catalytic efficiency across farnesol and its oxidized derivatives as substrates.
[0064] We elucidated the biosynthetic pathway for 12a (
Varied Chain-Length Diacids are Produced by Other ALK Proteins
[0065] Inspired by the discovery and biosynthesis of farnesoic diacid from the result of terpenoid precursors and ALK enzymes, we looked for other similar terpenoid diacids. We hypothesized that since our strains were engineered to produce increased amounts of FPP, other terpenoid precursors such as geranylgeranyl-pyrophosphate (GGPP), geranylfarnesyl-pyrophosphate (GFPP), and squalene were also increased, as FPP is the precursor to these longer compounds (
[0066] With these m z ratios corresponding to longer chain terpenoid diacids and their biosynthetic intermediates, we analyzed culture extracts with LC-MS of strains overexpressing HMGR, FPPS, and ALK proteins. Gratifyingly, we found signals corresponding to several of these proposed compounds, as the strain overexpressing HMGR+FPPS+ALK6 had more peaks not found in the WT (
Bioactivity of Farnesoic Diacid and Other Bifunctional Terpenoids
[0067] Given the structural similarity between 12a and other molecules involved in cell membrane synthesis, signaling, and lipid metabolism, we investigated whether this newly identified compound exhibited bioactivity across different biological systems. We supplemented cultures with 12a to a final concentration of 10 M and monitored growth in both Escherichia coli (
Derivatization and Modification of Bifunctional Terpenoids
[0068] With varied lengths, desaturations, and oxidative state of functionalized termini of the discovered terpenoids, these compounds have the potential for derivatization with applications in polymer and NNP synthesis.
[0069] Additionally, due to the potentially reactive nature of the diacid ends of the newly discovered bifunctional terpenoids, we hypothesized that several annulations could occur either enzymatically or synthetically (
Methods
Materials
[0070] Biological reagents, chemicals, and media were purchased from standard commercial sources unless stated. DNA isolation was carried out using Zymo Quick-DNA Fungal/Bacterial Kit. High-fidelity PCR amplification was carried out using NEB Q5 Hot Start High-Fidelity Master Mix, and colony PCR screening was carried out with Thermo Scientific Phire Tissue Direct PCR Master Mix. DNA sequencing was performed at Plasmidsaurus. The primers were synthesized by IDT and the codon-optimized genes were synthesized by Twist Bioscience.
Integration and Overexpression of Genes in Y. lipolytica
[0071] To overexpress the mevalonate or sesquiterpenoid pathway or identify potential biosynthetic enzymes for farnesoic diacid, plasmids pHR_AXP_hrGFP and pHR_D17_hrGFP.sup.8 were digested with NheI and AscI to excise hrGFP and insert genes or expression cassette elements. Promoters (pFBAin, pEXP), terminators (LIP2t, PRC1t), and genes to be expressed were generated by PCR amplification with the genomic DNA of Y. lipolytica PO1f as the template. The recombinant pHR plasmids were generated using NEBuilder HiFi DNA Assembly (NEB) with the digested vector backbone and inserts with 30 bp homology regions, which were immediately transformed into NEB5-alpha Competent E. coli for sequencing verification.
[0072] Recombinant pHR plasmids were co-transformed with their corresponding pCRISPRyl plasmids into Y. lipolytica using Frozen-EZ Yeast Transformation II Kit (Zymo Research). Selection for cassette integration and plasmid dropout were performed as described by Schwartz et al.sup.8.
Construction of S. cerevisiae Strains
[0073] For episomal heterologous expression, plasmids pXW55 (URA3 marker), pXW06 (TRP1 marker), and pXW02 (LEU2 marker) digested with NdeI and PmeI were used to introduce the candidate Y. lipolytica genes. The recombinant pX plasmids were generated using NEBuilder HiFi DNA Assembly (NEB) with the digested vector backbone and inserts with 30 bp homology regions, which were immediately transformed into NEB5-alpha Competent E. coli for sequencing verification. Recombinant pX plasmids were transformed into S. cerevisiae RC01 to generate the strains.
Metabolite Extraction
[0074] To measure intracellular metabolites and measure the perturbed metabolism after genetic manipulations on Y. lipolytica, 1 ml of culture was vacuum-filtered on membrane filters (nylon, 47 mm diameter, 0.45 m pore size, Millipore) and flipped cell-side down into 400 l of extraction solvent (40:40:20 acetonitrile/methanol/water) in a six-well plate. To quickly quench metabolism and minimize metabolite degradation, filtration was performed as quickly as possible, and the extraction solvent was pre-cooled to 20 C. After incubation at 20 C. for 20 minutes, the filter was flipped cell-side up and washed with the extraction solvent in the well. The extract was then collected in a 1.5 ml centrifuge tube and centrifuged at 4 C. The supernatant was then used directly for LC-MS analysis.
Metabolite Measurement and Characterization
[0075] LC-MS analysis was carried out on an HPLC (Vanquish Duo UHPLC, Thermo Fisher Scientific) coupled to a high-resolution orbitrap mass spectrometer (Q Exactive Plus, Thermo Fisher Scientific). The LC separation was achieved using a hydrophilic interaction chromatography column (XBridge BEH Amide XP Column, 130 , 2.5 m, 2.1 mm150 mm, Waters). MS was performed in both positive and negative mode using a mass resolution of 140,000 at 200 m/z. The resulting LC-MS data were processed using the Metabolomic Analysis and Visualization Engine (MAVEN) 9. NMR spectra were acquired on Bruker AV500 spectrometer with 5 mm dual cryoprobe (1H 500 MHz, 13C 125 MHz). The resulting spectra were processed using Bruker TopSpin and Mnova NMR software.
Fermentation and Compound Isolation
[0076] A seed culture of Y. lipolytica strain was grown in 3 ml of YPD (yeast extract 10 g/l, peptone 20 g/1, dextrose 20 g/l) overnight at 30 C. and 350 rpm. Fermentation of the yeast was carried out using either YPD or modified YPD (yeast extract 10 g/l, peptone 20 g/l, dextrose 100 g/l, leucine 10 g/l) for 3 days at 30 C. and 250 rpm.
[0077] To isolate compound 12a, the fermentation broth of Y. lipolytica strain HMGR+FPPS was centrifuged (5,000 g, 30 min), and the cell pellet was collected and soaked in acetone while the supernatant was extracted three times with ethyl acetate. The extract was then dried and concentrated using rotary evaporation and subjected to flash silica column purification with a gradient of hexane and ethyl acetate. Fractions were tested on the HPLC-MS system described above, and those containing compound 12a were pooled and dried using rotary evaporation. The residue was dissolved in acetonitrile and subjected to semipreparative HPLC purification using a reverse-phase column (XBridge BEH C18 OBD Prep Column, 130 , 5 m, 10 mm250 mm).
[0078] To isolate compound 6a and 12b, the fermentation broth of Y. lipolytica strain HMGR+FPPS was centrifuged (5,000 g, 30 min), and the cell pellet was collected and soaked in acetone while the supernatant was extracted three times with dichloromethane. The extract was then dried and concentrated using rotary evaporation and subjected to flash silica column purification with a gradient of hexane and ethyl acetate. Fractions were tested on the HPLC-MS system described above, and those containing compound 2 were pooled and dried using rotary evaporation. The residue was dissolved in acetonitrile and subjected to semipreparative HPLC purification using a reverse-phase column (XBridge BEH C18 OBD Prep Column, 130 , 5 m, 10 mm250 mm).
[0079] To isolate compounds 24b, 36b, and 45, the fermentation broth Y. lipolytica strain HMGR+FPPS+ALK6 was centrifuged (5,000 g, 30 min), and the cell pellet was collected and soaked in 1:1 acetone: dichloromethane. The extract was then dried and concentrated using rotary evaporation and subjected to flash silica column purification with a gradient of hexane and ethyl acetate. Fractions were tested on the HPLC-MS system described above, and those containing the compound were pooled and dried using rotary evaporation. The residue was dissolved in acetonitrile and subjected to semipreparative HPLC purification using a reverse-phase column (XBridge BEH C18 OBD Prep Column, 130 , 5 m, 10 mm250 mm).
Protein Expression, Purification and Biochemical Assay
[0080] The cDNA sequence of AOX was codon-optimized for E. coli and cloned into a pET28a plasmid with a N-(His).sub.6-SUMO tag using NEBuilder HiFi DNA Assembly Master Mix (NEB). The resulting recombinant pET28a plasmid was transformed into chemically competent BL21 (DE3) E. coli (NEB) and sequence verified. For protein production, a seed culture of the E. coli strain was grown in 3 ml of LB medium with 50 g/mL kanamycin overnight at 37 C. and 250 rpm. A 1:1000 dilution of the culture was used to inoculate 1 L of LB medium with 50 g/mL kanamycin pre-warmed at 37 C. The culture was shaken at 37 C. and 250 rpm until OD600 reached 0.8-1 and cooled to 16 C. IPTG was added to the cooled culture to a final concentration of 100 M and the culture was left to induce at 16 C. and 220 rpm for 18-24 hours. After protein expression was completed, cells were harvested by centrifugation and frozen.
Feeding Assay
[0081] To test in vivo biocatalytic activity of candidate enzymes, recombinant S. cerevisiae harboring a pX expression plasmid was utilized. A seed culture of the S. cerevisiae was grown in selective synthetic complete media overnight before fermentation of the yeast in YPD for 2 days. Cells were harvested at centrifuged at 4 C., washed with 10 mM Tris-HCl 1 mM EDTA buffer at pH 8, and resuspended in 2 mL of Tris-HCl-EDTA buffer. Proposed substrates were then spiked from a 10 mM solution in ethanol for a final concentration of 20 M. Cultures were incubated at 30 C. while shaking at 350 rpm with shaking for an additional day. For extractions, all 3 ml of culture were extracted one time with an equal volume of ethyl acetate with 500-700 m glass beads. The organic phase was dried and concentrated to oil form, then reconstituted in 200 ul methanol for LC-MS analysis.
Table a: Illustrative Polypeptide Sequences
[0082] Embodiments of the invention include microorganisms engineered to express a polypeptide having at least 60%, 70%, 80%, 85%, 90%, 95%, 97%, 98% or 99% sequence identity with the amino acid sequence set out below.
TABLE-US-00002 -Hydroxy-methylglutaryl-CoAreductase: (SEQIDNO:1) MLQAAIGKIVGFAVNRPIHTVVLTSIVASTAYLAILDIAIPGFEGTQPISYYHPAAK SYDNPADWTHIAEADIPSDAYRLAFAQIRVSDVQGGEAPTIPGAVAVSDLDHRIV MDYKQWAPWTASNEQIASENHIWKHSFKDHVAFSWIKWFRWAYLRLSTLIQGA DNFDIAVVALGYLAMHYTFFSLFRSMRKVGSHFWLASMALVSSTFAFLLAVVAS SSLGYRPSMITMSEGLPFLVVAIGFDRKVNLASEVLTSKSSQLAPMVQVITKIASK ALFEYSLEVAALFAGAYTGVPRLSQFCFLSAWILIFDYMFLLTFYSAVLAIKFEIN HIKRNRMIQDALKEDGVSAAVAEKVADSSPDAKLDRKSDVSLFGASGAIAVFKIF MVLGFLGLNLINLTAIPHLGKAAAAAQSVTPITLSPELLHAIPASVPVVVTFVPSV VYEHSQLILQLEDALTTFLAACSKTIGDPVISKYIFLCLMVSTALNVYLFGATREV VRTQSVKVVEKHVPIVIEKPSEKEEDTSSEDSIELTVGKQPKPVTETRSLDDLEAI MKAGKTKLLEDHEVVKLSLEGKLPLYALEKQLGDNTRAVGIRRSIISQQSNTKTL ETSKLPYLHYDYDRVFGACCENVIGYMPLPVGVAGPMNIDGKNYHIPMATTEGC LVASTMRGCKAINAGGGVTTVLTQDGMTRGPCVSFPSLKRAGAAKIWLDSEEG LKSMRKAFNSTSRFARLQSLHSTLAGNLLFIRFRTTTGDAMGMNMISKGVEHSL AVMVKEYGFPDMDIVSVSGNYCTDKKPAAINWIEGRGKSVVAEATIPAHIVKSV LKSEVDALVELNISKNLIGSAMAGSVGGFNAHAANLVTAIYLATGQDPAQNVES SNCITLMSNVDGNLLISVSMPSIEVGTIGGGTILEPQGAMLEMLGVRGPHIETPGA NAQQLARIIASGVLAAELSLCSALAAGHLVQSHMTHNRSQAPTPAKQSQADLQR LQNGSNICIRS Farnesylpyrophosphatesynthase: (SEQIDNO:2) MSKAKFESVFPRISEELVQLLRDEGLPQDAVQWFSDSLQYNCVGGKLNRGLSVV DTYQLLTGKKELDDEEYYRLALLGWLIELLQAFFLVSDDIMDESKTRRGQPCWY LKPKVGMIAINDAFMLESGIYILLKKHFRQEKYYIDLVELFHDISFKTELGQLVDL LTAPEDEVDLNRFSLDKHSFIVRYKTAYYSFYLPVVLAMYVAGITNPKDLQQAM DVLIPLGEYFQVQDDYLDNFGDPEFIGKIGTDIQDNKCSWLVNKALQKATPEQRQ ILEDNYGVKDKSKELVIKKLYDDMKIEQDYLDYEEEVVGDIKKKIEQVDESRGF KKEVLNAFLAKIYKRQK ALK3: (SEQIDNO:3) MIIIETLIGAVVFVAVYVAFVKLDYYRRKAKFETSDMPVAYNGLLGWKGLRHM LTVFNNDIGPVGWREVFATYGKTLKYYAFPSNTILTYDPDNIKAMLATQFKDFSL GLRKEALAPSLGYGIFTLDGSSWSHSRALLRPQFSREQISRLESVETHVQEMMSCI DRNQGAYFDIQRLFFSLAMDTATDFLLGEAVGNLQEILHPEMPRTGTTFQVAFD RAQRLGSLRIICQEAFWVVGSLFWRRDFNNTNQHIHDYVDRYVDKALLARKEKS EIYTNPDKYIFLYELARETTNKITLRDQVLNILIAGRDTTASTLSWIFMELAKKPDI FHKLREAILNDFGTSCESISFESLKKCDYLRQVLNEGLRLHPVVPVNLRVAVRDT TLPRGGGPQGDKPIFVAKGQKINYAIFWTHRDKEYWGEDAEEFRPERWETTSGG ALGKGWEFLPFNGGPRICLGQQFALTEMGYVITRLLQEYSDISIQPSDAAVKVRH SLTMCSAQGINISLTRAKEE ALK4: (SEQIDNO:4) MLTNLTIVLITLLVTYTVLTRTALRIQRARKAKQMGATLPPRVNNGILGWYGLW LVIQNARSMKLPHTLGKRFANGPTWLTPVAGNEPINTIDPENVKAILATQFKDFC LGIRHRALSPSIGDGIFTLDGEGWTHSRALLRPQFSRQQISRVHSLERLMQILFKLI RKENGEYFDLQNLFFMFTLDSATEFLYGASVDTLADLLGEPVEGDHGGVGEEVR KAYQQSINNAQDISAIRTRLQGLYWIAGNIYQRNLYQKSNKGVKDFSQFFVDKA LNTSKEKLKEMEDSDNYVFLYELVKSTRNPVVIRDQLINILVAGRDTTASLLSFTF YTLGRRPDVLKKLRAAILEDFGTSPDEITFESLKRCDYLRYVLNEVLRLYPSVPIN ARSATRDTTLPRGGGPDGKQPVFVYKGQMVAYCVYWMHRDKKYWGEDALEF NPDRWDPKVQPQNKGWEYLPFNGGPRICLGQQFALTEAGYVVTRMLQEFDTVH CKNQKEEEHPPYALDLTMRHGEGVWVSMK ALK5: (SEQIDNO:5) MLQLFGVLVLALTTALLAQLAYNKYEYNRKVKQFGCGELTVAKNGFLGWKGIR AVLHVLKTKKGPAALKERIDAYGRTYVFHIGPAPVISTMEPENIKAMLATQFKDF SLGTRYRSLAPTLGDGIFTLDGHGWTHSRALLRPQFAREQVSRLDSLEAHFQILK MCVDKEMREKGNDPRGFDIQNLFFLFTLDSATEFLFGSSVDSLVDFLDDPSVRTG DHGGVDEAARKGFNNSFNHAQELCALRSRLHTLYWIVGSVVKKEPFERYNKEIK TFVDFFAAKALKARKEKDMSLMDNDQYIFMYELVKETTNPVTLRDQMLNILLA GRDTTASMLSWIYFRLARDPKLYAKLRSAILEDFGTTPEAITFESLKQCDYLRYV LNEALRLYPVVPINGRTATRDTTLPRGGGPDQSQPIFIPKGQTVSYSVYWTHRDP RFWGEDAEEFIPERWDPRNGNIGRGWEYLPFNGGPRICLGQQFALTEVGYVLSR LVQTYETLETCDHKPLPPLYNHALTMCHEEGVWVKMYKGEKA ALK6: (SEQIDNO:6) MIQSVFLALAILIAYLGFAEWFSRFQHRRISKKKGCGMPPMANGGFLGWYGLYK TYQITSERTYPHSMRMGLEAFGHTFVYPVPGTDMLQTIHPDNIKAILATQFKDFS LGTRHKIMLPTLGDGIFTLDGEGWTHSRALLRPQFARDQVSHVASLERHIQVLFK TIKKENKECDPAKGFDIQELFFMLTLDTATEFLCGDSVDSLTDYLADPTAPQLDH SGIDENVRRAFPEAFNTAQWFCSIRAKLMKLYFFAGTVFYRKKYADANKIVHDF TDFYVSKALAARKEKFQELDQEGKYIFLYELAKETRNPKVLRDQMLNILLAGRD TTASLLSWVMFRMARQPETWKKLRQAVINDFGDTPDELSFESLKRCEYLRYVLN EGLRLYPSVPMNFRVATRDTTLPKGGGPDLDQPIFIPKGGIVVYSVYHTHRAEEY WGKDTEEFIPERWDPAEGYQIARGWEYLPFNGGPRICLGQQFALTEAGYVLARL AQEFETVTSCDDKPLPPKYNTHLTMSHDDGVWLKME ALK7: (SEQIDNO:7) MFQLFSILVLAFTTALVAQLAYNQYDYQRKVKKFGCGQLRVAENGLFGWKGLR EVLRINKYKLGPAALKDRFEKYGKTHVFHVGPSPLITTMDPENIKAMLATQFKDF CLIARYKALGPMLGDGIFTLDGHGWTHSRALLRPQFAREQVSRLDSIEHHFQILK KCISKEMSDKRDTQRGFDIQNLFFLMTLDTATEFLFGSSVDSLVDFLDDPSIQTGD HGGIDEAARKGFSNAFNRAQELSSLRTRLHKLYWVIGTLAVREPYHRYNREVKT FVDHYAAKAIKARNEKNTDLLDNDKYIFMYELVKETSNPITLRDQMLNILLAGR DTTASMLSWIYFRLARDPKRYAKLRAAVLADFGPGPENITFESLKKCDYLRYVL NESLRVYPVVPINARTASRDTTLPRGGGPDGSQPIFVPKGQTVSYSVWWTHRDPE FWGQDAEEFIPERWDTKNGSIGRGWEYLPFNGGPRICLGQQFALTEVGYVLSRM VQTYETLESGDTKPLPPLYNHALTLCHQEGVWIKTE CP124: (SEQIDNO:8) MGLNTAIATRVNGTPPPEVPIADIELGSLDFWALDDDVRDGAFATLRREAPISFW PTIELPGFVAGNGHWALTKYDDVFYASRHPDIFSSYPNITINDQTPELAEYFGSMI VLDDPRHQRLRSIVSRAFTPKVVARIEAAVRDRAHRLVSSMIANNPDRQADLVSE LAGPLPLQIICDMMGIPKADHQRIFHWTNVILGFGDPDLATDFDEFMQVSADIGA YATALAEDRRVNHHDDLTSSLVEAEVDGERLSSREIASFFILLVVAGNETTRNAIT HGVLALSRYPEQRDRWWSDFDGLAPTAVEEIVRWASPVVYMRRTLTQDIELRG TKMAAGDKVSLWYCSANRDESKFADPWTFDLARNPNPHLGFGGGGAHFCLGA NLARREIRVAFDELRRQMPDVVATEEPARLLSQFIHGIKTLPVTWS CP2E1: (SEQIDNO:9) MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPK SFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHA HRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQG QPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLENENFHLLSTPWLQLY NNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVE MEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHE EIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIP KGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCA GEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS AOX: (SEQIDNO:10) MSDDKHTFDFIIVGGGTAGPTLARRLADAWISGKKLKVLLLESGPSSEGVDDIRC PGNWVNTIHSEYDWSYEVDEPYLSTDGEERRLCGIPRGHCLGGSSCLNTSFVIRG TRGDFDRIEEETGAKGWGWDDLFPYFRKHECYVPQGSAHEPKLIDFDTYDYKKF HGDSGPIKVQPYDYAPISKKFSESLASFGYPYNPEIFVNGGAPQGWGHVVRSTSN GVRSTGYDALVHAPKNLDIVTGHAVTKILFEKIGGKQTAVGVETYNRAAEEAGP TYKARYEVVVCCGSYASPQLLMVSGVGPKKELEEVGVKDIILDSPYVGKNLQDH LICGIFVEIKEPGYTRDHQFFDDEGLDKSTEEWKTKRTGFFSNPPQGIFSYGRIDNL LKDDPVWKEACEKQKALNPRRDPMGNDPSQPHFEIWNAELYIELEMTQAPDEG QSVMTVIGEILPPRSKGYVKLLSPDPMENPEIVHNYLQDPVDARVFAAIMKHAA DVATNGAGTKDLVKARWPPESKPFEEMSIEEWETYVRDKSHTCFHPCGTVKLG GANDKEAVVDERLRVKGVDGLRVADVSVLPRVPNGHTQAFAYAVGEKAADLIL ADIAGKDLRPRI AP: (SEQIDNO:11) MDQKTDSREYLDGFKAGQKVAYERLYWRRILVLFGGLAMVLGFFGYKGYAVN DVLDLDLSMSRADSVNDNPLVSPLSKPKKNVIFMVTDGMGPASVSLARTYRQY VQGLAYNNTLTIDKHFIGSSRTRSSDSPVTDSAAGATAFSCGAKSYNGAISVTPD YKACGSVLEAAKRQGLKTGLVVTTRITDATPACFGAHVAHRSQEDEIADQLLGY ATPLGRSVDLLMGGGRIHFTTKGRQDGRDLIAEAQIDGFQYIANRKEFDELDTSN ATLPLLALFTDYDMPYEIDRVPEQFPSLKETAISALEILHQETKDSDEGFFIMIEGS RIDHAGHQNDPAAQVREVMAFDEMFAAVVDFADSLDTETIIVSTSDHETGGLAI ARQVQAEYPEYVWYPEALAAAQHSGEYIARKLQAFARPDHPSEASGSKLEKFV KREILENDLGVKDYTKQEVKALIRNRADPIDTIVDIVSRRSQTGWSTHGHSAVDV NIYAHSNKQSGLDKLDALRGNHENIEIGQFLAKYLEVDVARVTEILEDLPVRVQH VEEIDDCDQYHHGLY DP1: (SEQIDNO:12) MTYSTQSSSTLVAIRRDECFFPISSHSISLSSVLSYLIDWIFYISLTTLALVYAKIVSP LFAEFYLYNTSLWYSHIPTDLTIVPTFLLIIYSILIPIGQFALTIGFTTSHRWHRRLW DLHAILLTLMAAHALQTVIVSLLKNLVGAPRPDMLARCRPMSWMRPSFGTLSNV GICTQTDIGHLEEGFRSFPSAHSATAFTSAMVQVLFWIARTRMLDCSGWSWKLL LSLVPLLSASAVAFSRISDNRHHVFDVIIGMLIGLIAGYLAFIHYFPFPTFANVCTG GRAYSPRCGILGSVGCWSLGDETGCLRTKLFKTPKCSVKATFTMGCGTELCVCK KPSCGACSVGGEGAKCSLRCSIRNCTGNACTSRPVSRRSTRRTPSRRSRRSHQTY PGRSSETACLPSCSPTCTGNCHDTTCSSCDSSATATEPSHTRSAHRCTNPVCTIAG CIGACLRRVTSRPRCTTVGCTVANCIGISCLVGRVRTCRIPWCRNERCMRLAREH CFDEEASIIDVGGGRSRASRHRRVSRHAITP DP2: (SEQIDNO:13) MLSSSSTLKQYHVIEWITAFTLIFLWYVSESAAPFTREFIISDPTINHSHVTVERVSS EACILYTIIIPFFVLIGLSAIMAPRPQDRLKFMSITLSTFLVAAFFNGFITNFLKIYMG RHRPDFIARCEPSKRAPIDKYVTIEVCTGDMDTILEGMKSTPSGHSSTAFVGMTFF CLWVYGQINAYKTYGSKASKLLLAFFPLLLAIYIALSRTEDYRHHFVDIVLGSLL GMTIAYYFYRREFPRTTSKTSHIPYCLGSEGADDDHHYDRVDDVQLENQV
REFERENCES
[0083] 1. Grabiska, K. & Palamarczyk, G. Dolichol biosynthesis in the yeast Saccharomyces cerevisiae: an insight into the regulatory role of farnesyl diphosphate synthase. FEMS Yeast Res. 2, 259-265 (2002). [0084] 2. Iida, T., Sumita, T., Ohta, A. & Takagi, M. The cytochrome P450ALK multigene family of an n-alkane-assimilating yeast, Yarrowia lipolytica: cloning and characterization of genes coding for new CYP52 family members. Yeast 16, 1077-1087 (2000). [0085] 3. Fickers, P. et al. Hydrophobic substrate utilisation by the yeast Yarrowia lipolytica, and its potential applications. FEMS Yeast Res. 5, 527-543 (2005). [0086] 4. Gatter, M. et al. A newly identified fatty alcohol oxidase gene is mainly responsible for the oxidation of long-chain -hydroxy fatty acids in Yarrowia lipolytica. FEMS Yeast Res. 14, 858-872 (2014). [0087] 5. Johnston, J. B., Kells, P. M., Podust, L. M. & Ortiz de Montellano, P. R. Biochemical and structural characterization of CYP124: A methyl-branched lipid -hydroxylase from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. 106, 20687-20692 (2009). [0088] 6. FUKUDA, R. Metabolism of Hydrophobic Carbon Sources and Regulation of It in n-Alkane-Assimilating Yeast Yarrowia lipolytica. Biosci. Biotechnol. Biochem. 77, 1149-1154 (2013). [0089] 7. Iwama, R. et al. Functional roles and substrate specificities of twelve cytochromes P450 belonging to CYP52 family in n-alkane assimilating yeast Yarrowia lipolytica. Fungal Genet. Biol. FG B 91, 43-54 (2016). [0090] 8. Schwartz, C., Shabbir-Hussain, M., Frogue, K., Blenner, M. & Wheeldon, I. Standardized Markerless Gene Integration for Pathway Engineering in Yarrowia lipolytica. ACS Synth. Biol. 6, 402-409 (2017). [0091] 9. Seitzer, P., Bennett, B. & Melamud, E. MAVEN2: An Updated Open-Source Mass Spectrometry Exploration Platform. Metabolites 12, 684 (2022). [0092] 10. Gennaiou, K., Kelesidis, A. & Zografos, A. L. Climbing the Oxidase Phase Ladder by Using Dioxygen as the Sole Oxidant: The Case Study of Costunolide. Org. Lett. 26, 2934-2938 (2024).
CONCLUSION
[0093] This concludes the description of the illustrative embodiments of the present invention. The foregoing description of one or more embodiments of the invention has been presented for the purposes of illustration and description. It is not intended to be exhaustive or to limit the invention to the precise form disclosed. Many modifications and variations are possible in light of the above teaching.