Activin a antibody formulations and methods of use thereof

12472253 ยท 2025-11-18

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides novel pharmaceutical formulations comprising an antibody that specifically binds to human Activin A. The formulations may contain, in addition to an anti-Activin A antibody, a histidine buffer, an organic cosolvent, and a thermal stabilizer. The pharmaceutical formulations of the present invention exhibit a surprising degree of antibody stability after storage for several months and after being subjected to thermal and other physical stress.

Claims

1. A pharmaceutical formulation comprising: (i) 60 mg/mL6 mg/mL of an anti-human Activin A antibody, or antigen-binding portion thereof; (ii) 10 mM2 mM of a histidine buffer at pH of 6.30.3; (iii) 0.05% w/v0.025% polysorbate 20; and (iv) 5% w/v1% sucrose, and 70 mM14 mM arginine, wherein the antibody, or the antigen-binding portion thereof, comprises: (a) a heavy chain complementarity determining region (HCDR) 1 having the sequence GGSFSSHF (SEQ ID NO: 1); (b) an HCDR2 having the sequence ILYTGGT (SEQ ID NO: 2); (c) an HCDR3 having the sequence ARARSGITFTGIIVPGSFDI (SEQ ID NO: 3); (d) a light chain complementarity determining region (LCDR) 1 having the sequence QSVSSSY (SEQ ID NO: 4); (e) an LCDR2 having the sequence GAS (SEQ ID NO: 5); and (f) an LCDR3 having the sequence QQYGSSPWT (SEQ ID NO: 6), and wherein after 12 months of storage at 2-8 C.: at least 94% of the antibody, or the antigen-binding portion thereof, in the pharmaceutical formulation has native conformation; at least 45% of the antibody, or the antigen-binding portion thereof, in the pharmaceutical formulation is the main charge variant; and the antibody, or antigen-binding portion thereof, in the pharmaceutical formulation retains 95% of the potency of the antibody, or the antigen-binding portion thereof, prior to storage.

2. The pharmaceutical formulation of claim 1, wherein the antibody has a molecular weight of about 145,235.3 Da.

3. The pharmaceutical formulation claim 1, wherein after 12 months of storage at 2-8 C., at least 96% of the antibody, or the antigen-binding portion thereof, has native conformation, and at least 50% of the antibody, or the antigen-binding portion thereof, is the main charge variant.

4. The pharmaceutical formulation claim 1, wherein after 12 months of storage at 2-8 C., at least 98% of the antibody, or the antigen-binding portion thereof, has native conformation, and at least 55% of the antibody, or the antigen-binding portion thereof, is the main charge variant.

5. The pharmaceutical formulation claim 1, wherein after 18 months of storage at 2-8 C., at least 94% of the antibody, or the antigen-binding portion thereof, has native conformation, at least 45% of the antibody, or the antigen-binding portion thereof, is the main charge variant, and/or the antibody retains at least 95% of the potency of the antibody, or the antigen-binding portion thereof, prior to storage.

6. The pharmaceutical formulation claim 1, wherein after 18 months of storage at 2-8 C., at least 96% of the antibody, or the antigen-binding portion thereof, has native conformation, at least 50% of the antibody, or the antigen-binding portion thereof, is the main charge variant, and/or the antibody retains at least 95% of the potency of the antibody, or the antigen-binding portion thereof, prior to storage.

7. The pharmaceutical formulation claim 1, wherein after 18 months of storage at 2-8 C., at least 98% of the antibody, or the antigen-binding portion thereof, has native conformation, at least 55% of the antibody, or the antigen-binding portion thereof, is the main charge variant, and/or the antibody retains at least 95% of the potency of the antibody, or the antigen-binding portion thereof, prior to storage.

8. The pharmaceutical formulation claim 1, wherein after 24 months of storage at 2-8 C., at least 94% of the antibody, or the antigen-binding portion thereof, has native conformation, at least 45% of the antibody, or the antigen-binding portion thereof, is the main charge variant, and/or the antibody retains at least 99% of the potency of the antibody, or the antigen-binding portion thereof, prior to storage.

9. The pharmaceutical formulation claim 1, wherein after 24 months of storage at 2-8 C., at least 96% of the antibody, or the antigen-binding portion thereof, has native conformation, at least 50% of the antibody, or the antigen-binding portion thereof, is the main charge variant, and/or the antibody retains at least 99% of the potency of the antibody, or the antigen-binding portion thereof, prior to storage.

10. The pharmaceutical formulation claim 1, wherein after 24 months of storage at 2-8 C., at least 98% of the antibody, or the antigen-binding portion thereof, has native conformation, at least 55% of the antibody, or the antigen-binding portion thereof, is the main charge variant, and/or the antibody retains at least 99% of the potency of the antibody, or the antigen-binding portion thereof, prior to storage.

11. The pharmaceutical formulation of claim 1, wherein the formulation is contained in a container.

12. The pharmaceutical formulation of claim 11, wherein the container is a vial.

13. The pharmaceutical formulation of claim 12, wherein the vial is glass.

14. The pharmaceutical formulation of claim 13, wherein the glass is Type 1 borosilicate glass with a butyl rubber stopper.

15. The pharmaceutical formulation of claim 1, wherein the formulation is suitable for intravenous administration to a human subject in need thereof.

16. The pharmaceutical formulation of claim 1, wherein the formulation is suitable for subcutaneous administration to a human subject in need thereof.

17. The pharmaceutical formulation of claim 1, wherein the formulation is a liquid formulation.

18. The pharmaceutical formulation of claim 1, wherein the formulation is a lyophilized formulation.

19. A kit comprising a pharmaceutical formulation of claim 1, a container, and instructions of use thereof.

20. The kit of claim 19, wherein the container is a glass vial fitted with a chlorobutyl stopper.

21. A method of treating a disease or disorder associated with Activin A activity, the method comprising administration of a therapeutically effective amount of the pharmaceutical composition of claim 1 to a subject in need thereof.

22. The method of claim 21, wherein the disease or disorder associated with Activin A activity is Fibrodysplasia ossificans progressiva (FOP).

23. The pharmaceutical formulation of claim 1, wherein the antibody, or the antigen-binding portion thereof, comprises a heavy chain variable region comprising SEQ ID NO: 7 and a light chain variable region comprising SEQ ID NO: 8.

Description

BRIEF DESCRIPTION OF DRAWINGS

(1) FIG. 1 shows the heavy and light chain amino acid sequences (SEQ ID NO:9 and SEQ ID NO: 10, respectively) of an exemplary anti-activin A monoclonal antibody.

(2) FIG. 2 shows the effect of varying the formulation on the rate of an anti-activin A antibody degradation when it is incubated at 40 C./75% RH for 2 months. For particle levels by HIAC and MFI the results shown are the final particle levels after 2 months of incubation (USP<788> limits are indicated for the HIAC results). Formulation 15 is the control formulation in which all factors are nominal. The line is a reference line indicating the rate of change of the response for the control formulation.

(3) FIG. 3 shows the effect of varying the formulation on the rate of an anti-activin A antibody degradation when it is incubated at 25 C./60% RH for 6 months. For particle levels by HIAC and MFI the results shown are the final particle levels after 6 months of incubation (USP<788> limits are indicated for the HIAC results). Formulation 15 is the control formulation in which all factors are nominal. The line is a reference line indicating the rate of change of the response for the control formulation.

(4) FIG. 4 shows the effects of varying the formulation components in accordance with the DOE design on the stability of an anti-activin A antibody relative to the control formulation, indicated as delta control (8 cycles of freezing and thawing stress, 30 C. freeze, room temperature thaw; control formulation is F15). Results for particle levels by HIAC are shown as final particle levels after 8 cycles of freezing and thawing and are compared to the limits specified in USP<788>.

(5) FIG. 5 shows the effects of varying the formulation components in accordance with the DoE design on the stability of an anti-activin A antibody relative to the control formulation, indicated as delta control (120 minute agitation by vortexing; control formulation is F15). Results for particle levels by HIAC are shown as final particle levels after 120 minutes of agitation and are compared to the limits specified in USP<788>.

(6) FIG. 6 shows the effects of varying the formulation components in accordance with the DOE design on the long-term stability of an anti-activin A antibody when the formulations were stored at 2-8 C. for 12 months (see Table 24 for formulation descriptions). The limits specified in USP<788> are indicated on the plots showing the particle levels by HIAC. Results are shown as a function of storage time at 2-8 C.

(7) FIG. 7 shows the effects of varying the formulation components in accordance with the DOE design on the long-term stability of an anti-activin A antibody when the formulations were stored at 2-8 C. for 24 months (see Table 24 for formulation descriptions). The limits specified in USP<788> are indicated on the plots showing the particle levels by HIAC. Results are shown as a function of storage time at 2-8 C.

DETAILED DESCRIPTION

(8) Before the present invention is described, it is to be understood that this invention is not limited to particular methods and experimental conditions described, as such methods and conditions may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.

(9) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. As used herein, the term about, when used in reference to a particular recited numerical value or range of values, means that the value may vary from the recited value by no more than 5%. For example, as used herein, the expression about 100 includes 95 and 105 and all values in between (e.g., 95.00, 95.01, 95.02, 95.03, 95.04, . . . , 104.96, 104.97, 104.98, 104.99, 105.00).

(10) Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference in their entirety.

(11) Pharmaceutical Formulations

(12) As used herein, the expression pharmaceutical formulation means a combination of at least one active ingredient (e.g., a small molecule, macromolecule, compound, etc. which is capable of exerting a biological effect in a human or non-human animal), and at least one inactive ingredient which, when combined with the active ingredient or one or more additional inactive ingredients, is suitable for therapeutic administration to a human or non-human animal. The term formulation, as used herein, means pharmaceutical formulation unless specifically indicated otherwise. The present invention provides pharmaceutical formulations comprising at least one therapeutic polypeptide. According to certain embodiments of the present invention, the therapeutic polypeptide is an antibody, or an antigen-binding fragment thereof, which binds specifically to human Activin A protein. More specifically, the present invention includes pharmaceutical formulations that comprise: (i) a human antibody that specifically binds to human Activin A (ii) a histidine buffer; (iii) an organic cosolvent that is a non-ionic surfactant; and (iv) a stabilizer that is a carbohydrate or an inorganic salt, or a combination of carbohydrate and inorganic salt. Specific exemplary components and formulations included within the present invention are described in detail below.

(13) Anti-Activin A Antibodies

(14) The pharmaceutical formulations of the present invention may comprise a human antibody, or an antigen-binding fragment thereof, that binds specifically to human Activin A. As used herein, the term Activin A means a human Activin A, which is a homo- or heterodimeric protein. The homodimeric protein contains a homodimeric beta A subunit pair. The heterodimeric protein contains a beta subunit and a beta B, beta C or beta E subunit (i.e., beta A beta B, beta A beta C, or beta A beta E. The subunits are each expressed as precursor polypeptides including a signal peptide, propeptide and mature polypeptide. An exemplary form of human beta A subunit precursor is a polypeptide of length 426 amino acids designated Swiss Prot P08476 of which residues 1-20 are a signal peptide, residues 21-310 are a propeptide and residues 311-426 are the mature polypeptide. An exemplary form of a beta B subunit precursor polypeptide is designated Swiss Prot P09529 of which residues 1-28 are a signal peptide, residues 29-292 a propeptide and residues 293-407 a mature polypeptide. An exemplary form of a beta C subunit is designated Swiss Prot P55103, of which residues 1-18 are a signal peptide, residues 19-236 are a propeptide and residues 237-352 are a mature polypeptide. An exemplary form of a beta E subunit precursor is designated Swiss Prot P58166 of which residues 1-19 are a signal peptide, residues 20-236 are a propeptide and residues 237-350 are a mature polypeptide. Several variants of these sequences are known as described in the Swiss Prot Data base. Reference to Activin A includes any of the beta A homodimer, beta A beta B, beta A beta C and beta A beta E heterodimer forms, as well as their subunits, as well as their precursors in which subunits are attached to the propeptide and/or signal peptide defined by the exemplary Swiss Prot sequences provided or other natural occurring human forms of these sequences. Activin A signals through binding to ACVR2A or ACVR2B, but is not known to be a ligand for ACVR1. Activin A signals aberrantly via mutant ACVR to transduce osteogenic signals and trigger heterotopic bone formation.

(15) The term antibody, as used herein, is generally intended to refer to immunoglobulin molecules comprising four polypeptide chains: two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as multimers thereof (e.g., IgM); however, immunoglobulin molecules consisting of only heavy chains (i.e., lacking light chains) are also encompassed within the definition of the term antibody. Each heavy chain comprises a heavy chain variable region (abbreviated herein as HCVR or V.sub.H) and a heavy chain constant region. The heavy chain constant region comprises three domains, CH1, CH2 and CH3. Each light chain comprises a light chain variable region (abbreviated herein as LCVR or V.sub.L) and a light chain constant region. The light chain constant region comprises one domain (CL1). The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementary determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.

(16) Unless specifically indicated otherwise, the term antibody, as used herein, shall be understood to encompass complete antibody molecules as well as antigen-binding fragments thereof. The term antigen-binding portion or antigen-binding fragment of an antibody (or simply antibody portion or antibody fragment), as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to human Activin A or an epitope thereof.

(17) An isolated antibody, as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds human Activin A is substantially free of antibodies that specifically bind antigens other than human Activin A), with the notable exception of bi-specific (or multi-specific) antibodies that specifically bind Activin A on the one hand, and another epitope on the other. Moreover, an isolated antibody may be substantially free of other cellular material or chemicals.

(18) The term specifically binds, or the like, means that an antibody or antigen-binding fragment thereof forms a complex with an antigen that is relatively stable under physiologic conditions. Specific binding can be characterized by a dissociation constant of at least about 110.sup.6 M or greater. Methods for determining whether two molecules specifically bind are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, and the like. An isolated antibody that specifically binds human Activin A may, however, have cross-reactivity to other antigens, such as Activin A molecules from other species (orthologs). In the context of the present invention, multispecific (e.g., bispecific) antibodies that bind to human Activin A as well as one or more additional antigens are deemed to specifically bind human Activin A.

(19) Exemplary anti-human Activin A antibodies that may be included in the pharmaceutical formulations of the present invention are set forth in U.S. Pat. No. 9,718,881, the disclosure of which is incorporated herein by reference in their entirety.

(20) Antibodies can also include antibodies specifically binding to Activin A. Such antibodies can specifically bind to any or all of the beta A beta A, beta A beta B, beta A beta C and beta A beta E forms of Activin A. Some antibodies specifically bind to only one of these forms (i.e., beta A beta A, beta A beta B, beta A beta C or beta A beta E). Specificity for the beta A beta B, beta A beta C and beta A beta E forms can be conferred by an epitope within the beta B, beta C or beta E subunit, respectively, or for an epitope to which both components of the heterodimer contribute. Specificity for beta A beta can be conferred by an epitope contributed by both molecules within the homodimer (e.g., at the interface of subunits). Some antibodies specifically bind to all of these forms of Activin A, in which case the epitope is typically on the beta A subunit. Antibodies typically have epitopes within the mature polypeptide component of the precursor proteins. Some antibodies specifically bind to any or all forms of Activin A without binding to human inhibin, which exists in the form of alpha (Swiss Prot P05111) beta A or alpha beta B heterodimers. Some antibodies specifically bind to any or all forms of Activin A and bind to either or both forms of human inhibin. Although it is believed that such antibodies inhibit signal transduction of Activin A through one or more of its counterreceptors, ACVR2A and/or ACVR2B and/or BMPR2, an understanding of mechanism is not required for use of such antibodies in methods of treating FOP.

(21) A substantial number of antibodies against Activin A have been described. For example, US20150037339 discloses human antibodies designated H4H10423P, H4H10424P, H4H10426P, H4H10429P, H4H10430P, H4H10432P2, H4H10433P2, H4H10436P2, H4H10437P2, H4H10438P2, H4H10440P2, H4H10442P2, H4H10445P2, H4H10446P2, H4H10447P2, H4H10447P2, H4H10448P2, H4H10452P2.

(22) Preferred antibodies have an affinity for Activin A (measured at 25 C. as in Example 3 of U.S. Pat. No. 9,718,881) of at least 108 M.sup.1, 109 M.sup.1, 10.sup.10 M.sup.1, 10.sup.11 M.sup.1, 10.sup.12 M.sup.1, or 10.sup.13 M.sup.1. Some antibodies have an affinity within a range of 10.sup.9-10.sup.12 M.sup.1. Preferred antibodies inhibit signal transduction of Activin A with an IC50 of less than 4 nM, and preferably less than 400 pM or 40 pM. Some antibodies inhibit signal transduction with and IC50 in a range of 4 nM to 10 pM or 3.5 nM to 35 pM.

(23) Signal transduction inhibition can be measured as in Example 6 of U.S. Pat. No. 9,718,881, which is summarized as follows. A human A204 rhabdomyosarcoma cell line is transfected with a Smad 2/3-luciferase reporter plasmid to produce the A204/CAGAx 12-Luc cell line. A204/CAGAx12-Luc cells were maintained in McCoy's 5A supplemented with 10% fetal bovine serum, penicillin/streptomycin/glutamine and 250 g/mL of G418. For the bioassay, A204/CAGAx 12-Luc cells were seeded onto 96-well assay plates at 10,000 cells/well in low serum media, 0.5% FBS and OPTIMEM, and incubated at 37 C. and 5% CO.sub.2 overnight. Activin A is serially diluted at 1:3 from 100 to 0.002 nM and added to cells starting along with a control containing no Activin. Antibodies are serially diluted at 1:3 starting from 100 to 0.002 nM, 1000 to 0.02 nM, or 300 to 0.005 nM including control samples containing either an appropriate isotype control antibody or no antibody and added to cells with a constant concentration of 100 pM Activin A.

(24) Some antibodies inhibit binding of Activin A to ACVR2A and/or ACVR2B and/or BMPR2 by at least 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, as measured when the receptor is expressed from a cell or the extracellular domain is fused with an Fc domain as a fusion protein, and the fusion protein is immobilized to support (e.g., a Biacore sensor chip). In such measurements, the antibody and Activin A should be present in equimolar amounts and the receptor or extracellular domain in excess.

(25) An exemplary antibody used in the present examples is designated H4H10446P in U.S. Pat. No. 9,718,881. Its heavy chain variable region and heavy chain CDR1, CDR2 and CDR3 having the amino acid sequences of SEQ ID NOs: 162, 164, 166 and 168, respectively, of U.S. Pat. No. 9,718,881. Its light chain variable region and light chain CDRs, CDRL1, CDRL2 and CDRL3 having the amino acid sequences of SEQ ID NO: 146, 148, 150 and 152, respectively, of US2015/0037339. H4H10446P inhibits Activin A mediated signaling through ACVR2A and/or ACVR1IB, but does not inhibit strongly, if at all, Activin A binding to ACRIIA or ACVR2B. Other antibodies competing with H4H10446P for binding to human Activin A or binding to the same epitope on human Activin A as H4H10446P are included and sharing its inhibition of signaling are also included.

(26) Another exemplary antibody for use in the present methods is designated H4H10430P in U.S. Pat. No. 9,718,881. Its heavy chain variable region and heavy chain CDRs CDRH1, CDRH2 and CDRH3 having the amino acid sequences of SEQ ID NOs: 66, 68, 70 and 72, respectively, in U.S. Pat. No. 9,718,881. Its light chain variable region and light chain CDRs, CDRL1, CDRL2 and CDRL3 having the amino acid sequences of SEQ ID NOs: 74, 76, 78 and 80, respectively, in U.S. Pat. No. 9,718,881. This antibody inhibits binding of Activin A to ACRV2A and/or ACVR2B and inhibits signal transduction through one or both of these receptors. Other antibodies competing with H4H10430P for binding to Activin A or binding to the same epitope on Activin A as H4H10430P and sharing its property of inhibiting Activin A binding to and signal transduction through ACVR2A and ACVR2B are also included.

(27) An exemplary antibody for use in the present methods is garetosmab. The recombinant monoclonal antibody garetosmab is a covalent heterotetramer consisting of two disulfide-linked human heavy chains (IgG4 isotype), each covalently linked through a disulfide bond to a human kappa light chain. Based on the primary sequence, the antibody without glycans possesses a predicted molecular weight of 145,235.3 Da, assuming the formation of 16 canonical disulfide bonds and removal of Lys453 from each heavy chain C-terminus. Each heavy chain contains a serine-to-proline mutation at amino acid Pro234 within the hinge region of the Fc domain, to reduce the propensity of the IgG4 isotype antibody to form half-antibodies in solution. There is a single N-linked glycosylation site (Asn303) on each heavy chain, located within the constant region in the Fc domain of the molecule. The complementarity-determining regions (CDRs) within the garetosmab heavy chain and light chain variable domains together form the binding site for its targets: activin A, activin AB, and activin AC. The heavy and light chain amino acid sequences, the location of the CDRs within each polypeptide chain, the location of the heavy chain N-linked glycosylation site, and the predicted disulfide bond structures of the garetosmab monoclonal antibody are presented in FIG. 1.

(28) In some embodiments, the anti-human Activin A antibody comprises one or more amino acid substitutions in one or more framework regions relative to the canonical heavy chain variable region, which is reasonably expected to result in an altered charge distribution across the exposed surface of the antibody, and therefore affect its interaction with the surrounding solvent and excipients.

(29) The amount of antibody, or antigen-binding fragment thereof, contained within the pharmaceutical formulations of the present invention may vary depending on the specific properties desired of the formulations, as well as the particular circumstances and purposes for which the formulations are intended to be used. In certain embodiments, the pharmaceutical formulations are liquid formulations that may contain 20 mg/mL2 mg/mL to 200 mg/mL20 mg/mL of antibody; 303 mg/mL to 15015 mg/mL of antibody; 404 mg/mL to 1001 mg/mL of antibody; 454.5 mg/mL to 808 mg/mL of antibody; 505 mg/mL to 606 mg/mL of antibody; 555.5 mg/mL to 606 mg/mL of antibody; about 50 mg/mL; 50 mg/mL; 60 mg/mL6 mg/mL; about 60 mg/mL; 60 mg/mL; about 70 mg/mL; or 70 mg/mL of an antibody or an antigen-binding fragment thereof, that binds specifically to human Activin A.

(30) Excipients and pH

(31) The pharmaceutical formulations of the present invention comprise one or more excipients. The term excipient, as used herein, means any non-therapeutic agent added to the formulation to provide a desired consistency, viscosity or stabilizing effect.

(32) In certain embodiments, the pharmaceutical formulation of the invention comprises at least one organic cosolvent in a type and in an amount that stabilizes the human Activin A antibody under stress conditions of rough handling or agitation, such as, e.g., vortexing, or freezing and thawing. In some embodiments, what is meant by stabilizes is the maintenance of at least 95% of the Activin A antibody in its native state, i.e., not fragmented or aggregated, of antibody (on a molar basis) over the course of rough handling, such as by vortexing the antibody-organic cosolvent solution for about 30 minutes, 60 minutes or about 120 minutes, or by freezing and thawing the antibody-organic cosolvent solution for 4 cycles or 8 cycles.

(33) In certain embodiments, the organic cosolvent is a non-ionic surfactant, such as an alkyl poly(ethylene oxide). Specific non-ionic surfactants that can be included in the formulations of the present invention include, e.g., polysorbates such as polysorbate 20, polysorbate 28, polysorbate 40, polysorbate 60, polysorbate 65, polysorbate 80, polysorbate 81, and polysorbate 85; poloxamers such as poloxamer 181, poloxamer 188, poloxamer 407; or polyethylene glycol (PEG). Polysorbate 20 is also known as TWEEN 20, sorbitan monolaurate and polyoxyethylenesorbitan monolaurate. Poloxamer 188 is also known as PLURONIC F68.

(34) The amount of non-ionic surfactant contained within the pharmaceutical formulations of the present invention may vary depending on the specific properties desired of the formulations, as well as the particular circumstances and purposes for which the formulations are intended. In certain embodiments, the formulations may contain 0.01%0.0015% to 1%0.15% surfactant. For example, the formulations of the present invention may comprise about 0.0085%; about 0.01%; about 0.02%; about 0.03%; about 0.04%; about 0.05%; about 0.06%; about 0.07%; about 0.08%; about 0.09%; about 0.1%; about 0.11%; about 0.12%; about 0.13%; about 0.14%; about 0.15%; about 0.16%; about 0.17%; about 0.18%; about 0.19%; about 0.20%; about 0.21%; about 0.22%; about 0.23%; about 0.24%; about 0.25%; about 0.3%; about 0.4%; about 0.5%; about 0.6%; about 0.7%; about 0.8%; about 0.9%; about 1%; about 1.1%; about 1.15%; or about 1.2% polysorbate 20.

(35) The pharmaceutical formulations of the present invention may also comprise one or more stabilizers in a type and in an amount that stabilizes the human Activin A antibody under conditions of thermal stress. In some embodiments, what is meant by stabilizes is maintaining greater than about 90% of the antibody in a native conformation when the solution containing the antibody and the thermal stabilizer is kept at about 2-8 C. for up to about 18 months, at about 25 C. for up to about 6 months, or at about 40 C. for up to about 56 days. In some embodiments, what is meant by stabilizes is maintaining greater than about 90% of the antibody in a native conformation when the solution containing the antibody, or antigen-binding fragment thereof, and the thermal stabilizer is kept at about 2-8 C. for up to about 24 months. As used herein, native means the major form of the antibody by size exclusion, which is generally an intact monomer of the antibody.

(36) In certain embodiments, the thermal stabilizer is a sugar or sugar alcohol selected from sucrose, sorbitol, glycerol, trehalose and mannitol, or any combination thereof, the amount of which contained within the formulation can vary depending on the specific circumstances and intended purposes for which the formulation is used. In certain embodiments, the formulations may contain about 5% to about 40% sugar or sugar alcohol; about 1% to about 20% sugar or sugar alcohol; about 5% to about 15% sugar or sugar alcohol; about 7.5% to about 12.5% sugar or sugar alcohol; about 10% sugar or sugar alcohol; 10%+1.5% sugar or sugar alcohol; or 10% sugar or sugar alcohol. For example, the pharmaceutical formulations of the present invention may comprise 1%0.2%; 2%0.4%; 3%0.6%; 4%0.8%; 5%1%; 6%1.2%; 7%1.4%; 8%1.6%; 9%1.8%; 10%2%; 11%2.2%; 12%2.4%; 13%2.6%; 14%2.8%; or about 15%3% (w/v) of sugar or sugar alcohol (e.g., sucrose).

(37) In certain embodiments, the thermal stabilizer is an amino acid (e.g., arginine), the amount of which contained within the formulation can vary depending on the specific circumstances and intended purposes for which the formulation is used. In certain embodiments, the formulations may contain about 0 mM to about 150 mM arginine; about 10 mM to about 140 mM arginine; about 20 mM to about 130 mM arginine; about 30 mM to about 120 mM arginine; about 40 mM to about 110 mM arginine; about 50 mM to about 100 mM arginine; about 60 mM to about 90 mM arginine; about 70 mM to about 80 mM arginine; or about 70 mM arginine. For example, the pharmaceutical formulations of the present invention may comprise 0 mM; 10 mM2 mM arginine; 20 mM4 mM arginine; 30 mM6 mM arginine; 40 mM8 mM arginine; 50 mM10 mM arginine; 60 mM12 mM arginine; 70 mM14 mM arginine; about 70 mM arginine; or 70 mM arginine.

(38) The pharmaceutical formulations of the present invention may also comprise a buffer or buffer system, which serves to maintain a stable pH and to help stabilize the human Activin A antibody. In some embodiments, what is meant by stabilizes is wherein at least 90% of the antibody is in its native conformation as determined by size exclusion chromatography when the solution containing the antibody and the buffer is kept at about 2-8 C. for up to about 18 months, at about 25 C. for up to about 6 months, or at about 40 C. for up to about 56 days. In some embodiments, what is meant by stabilizes is wherein at least 90% of the antibody is in its native conformation as determined by size exclusion chromatography when the solution containing the antibody, or the antigen-binding fragment thereof, and the buffer is kept at about 2-8 C. for up to about 24 months. By native or native conformation, what is meant is the antibody fraction that is not aggregated or degraded. This is generally determined by an assay that measures the relative size of the antibody entity, such as a size exclusion chromatographic assay. The non-aggregated and non-fragmented antibody elutes at a fraction that equates to the native antibody, and is generally the main elution fraction. Aggregated antibody elutes at a fraction that indicates a size greater than the native antibody. Fragmented antibody elutes at a fraction that indicates a size less than the native antibody.

(39) In some embodiments, what is meant by stabilizes is wherein at least 40% of the antibody is in its main charge form as determined by cation exchange chromatography when the solution containing the antibody and the buffer is kept at about 2-8 C. for up to about 18 months, at about 25 C. for up to about 6 months, or at about 40 C. for up to about 56 days. In some embodiments, what is meant by stabilizes is wherein at least 40% of the antibody is in its main charge form as determined by cation exchange chromatography when the solution containing the antibody, or the antigen-binding fragment thereof, and the buffer is kept at about 2-8 C. for up to about 24 months. By main charge or main charge form, what is meant is the fraction of antibody that elutes from an ion exchange resin in the main peak, which is generally flanked by more basic peaks on one side and more acidic peaks on the other side.

(40) The pharmaceutical formulations of the present invention may have a pH of from about 4.5 to about 7.0. For example, the formulations of the present invention may have a pH of about 4.5; about 4.6; about 4.7; about 4.8; about 4.9; about 5.0; about 5.1; about 5.2; about 5.3; about 5.4; about 5.5; about 5.6; about 5.7; about 5.8; about 5.9; about 6.0; about 6.1; about 6.2; about 6.3; about 6.4; about 6.5; or about 6.6. In some embodiments, the pH is 6.30.5; 6.30.4; 6.30.3; 6.30.2; 6.30.1; about 6.3; or 6.3.

(41) In some embodiments, the buffer or buffer system comprises at least one buffer that has a buffering range that overlaps fully or in part the range of pH 5.5-7.4, such as, e.g., a buffer having a useful buffering range of pH 4.8 to pH 8.8. In one embodiment, the buffer has a pH of about 6.3. In certain embodiments, the buffer comprises a histidine buffer. In certain embodiments, the histidine is present at a concentration of 5 mM1 mM to 25 mM5 mM; 6 mM1.2 mM to 20 mM4 mM; 7 mM1.4 mM to 15 mM3 mM; 8 mM1.6 mM to 12 mM2.4 mM; 9 mM1.8 mM to 11 mM2.2 mM; 10 mM2 mM; about 10 mM; or 10 mM. In certain embodiments, the buffer system comprises phosphate at 10 mM2 mM, at a pH of 6.30.3.

(42) Exemplary Formulations

(43) According to one aspect of the present invention, the liquid pharmaceutical formulation comprises: (i) 60 mg/mL6 mg/mL of a human antibody that specifically binds to human Activin A (e.g., garetosmab); (ii) a buffer system that buffers at about pH 6.30.3; (iii) a thermal stabilizer comprising a sugar and a salt; and (iv) an organic cosolvent.

(44) According to one embodiment, the pharmaceutical formulation comprises: (i) 202 mg/mL to 20020 mg/mL human antibody that specifically binds to human Activin A; (ii) a histidine buffer, which buffers at pH 6.30.3; (iii) sucrose and arginine; and (iv) a non-ionic detergent, such as a polysorbate.

(45) According to one embodiment, the pharmaceutical formulation comprises: (i) 50 mg/ml 5 mg/mL human IgG1 antibody that specifically binds to human Activin A, and which comprises an HCDR1 of SEQ ID NO: 1, an HCDR2 of SEQ ID NO: 2, an HCDR3 of SEQ ID NO: 3, an LCDR1 of SEQ ID NO: 4, an LCDR2 of SEQ ID NO: 5, and an LCDR3 of SEQ ID NO: 6; (ii) 10 mM2 mM histidine, pH 6.30.3; (iii) 5%1% sucrose; (iv) 70 mM14 mM arginine; and (v) 0.05%0.025% polysorbate 20.

(46) According to one embodiment, the pharmaceutical formulation comprises: (i) 60 mg/ml 6 mg/mL human antibody that specifically binds to human Activin A, and which comprises an HCDR1 of SEQ ID NO: 1, an HCDR2 of SEQ ID NO: 2, an HCDR3 of SEQ ID NO: 3, an LCDR1 of SEQ ID NO: 4, an LCDR2 of SEQ ID NO: 5, and an LCDR3 of SEQ ID NO: 6; (ii) 10 mM2 mM histidine, pH 6.30.3; (iii) 5%1% sucrose; (iv) 70 mM14 mM arginine; and (v) 0.05%0.025% polysorbate 20.

(47) According to one embodiment, the pharmaceutical formulation comprises: (i) 70 mg/ml7 mg/mL human IgG1 antibody that specifically binds to human Activin A, and which comprises an HCDR1 of SEQ ID NO: 1, an HCDR2 of SEQ ID NO: 2, an HCDR3 of SEQ ID NO: 3, an LCDR1 of SEQ ID NO: 4, an LCDR2 of SEQ ID NO: 5, and an LCDR3 of SEQ ID NO: 6, at a concentration of; (ii) 10 mM2 mM histidine pH 6.30.3; (iii) 5%1% sucrose; (iv) 70 mM14 mM arginine; and (iv) 0.05%0.025% polysorbate 20.

(48) According to one embodiment, the pharmaceutical formulation comprises: (i) 60 mg/ml+6 mg/mL human antibody that specifically binds to human Activin A, and which comprises a heavy chain variable domain of SEQ ID NO: 1, and a light chain variable domain of SEQ ID NO: 5; (ii) 10 mM2 mM histidine, pH 6.30.3; (iii) 5%1% sucrose; (iv) 70 mM14 mM arginine; and (v) 0.05%0.025% polysorbate 20.

(49) Exemplary formulations and primary container closures used during garetosmab preclinical and clinical development are listed in Table.

(50) TABLE-US-00001 TABLE 1 Garetosmab Drug Product Formulations Tested During Initial Toxicology Studies, Phase 1, and Phase 2 Clinical Studies Toxicology Phase 1 Phase 2/Commercial Garetosmab 50 mg/mL 50 mg/mL 60 mg/mL concentration L-histidine 10 mM 10 mM 10 mM pH 6.3 6.3 6.3 Sucrose 5% (w/v) 5% (w/v) 5% (w/v) L-arginine HCl 70 mM Polysorbate 80 0.1% (w/v) 0.1% (w/v) Polysorbate 20 0.05% (w/v) Drug Product Form Frozen Liquid Lyophilized Liquid Primary Type I Glass vial with Type I Glass vial with Type I Glass vial with Container/Closure FluroTec coated FluroTec coated FluroTec coated chlorobutyl stopper chlorobutyl stopper chlorobutyl stopper

(51) Additional non-limiting examples of pharmaceutical formulations encompassed by the present invention are set forth elsewhere herein, including the working Examples presented below.

(52) Stability and Robustness of the Pharmaceutical Formulations

(53) The pharmaceutical formulations of the present invention typically exhibit high levels of stability. The term stable, as used herein in reference to the pharmaceutical formulations, means that the antibodies within the pharmaceutical formulations retain an acceptable degree of physical and/or chemical structure or biological function after storage under defined conditions. A formulation may be stable even though the antibody contained therein does not maintain 100% of its physical and/or chemical structure or biological function after storage for a defined amount of time. Under certain circumstances, maintenance of at least about 90%, 95%, 96%, 97%, 98% or 99% of an antibody's structure or function after storage for a defined amount of time may be regarded as stable.

(54) Stability can be measured, inter alia, by determining the percentage of native antibody that remains in the formulation after storage for a defined amount of time at a defined temperature and/or relative humidity (RH). The percentage of native antibody can be determined by, inter alia, size exclusion chromatography (e.g., size exclusion ultra performance liquid chromatography [SE-UPLC]), reversed-phase chromatography (e.g., reversed-phase ultra performance liquid chromatography [RP-UPLC]), and/or microchip capillary electrophoresis (e.g., reduced MCE or non-reduced MCE), such that native means non-aggregated and non-fragmented. An acceptable degree of stability, as that phrase is used herein, means that at least 90% of the native form of the antibody can be detected in the formulation after storage for a defined amount of time at a given temperature. In certain embodiments, at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% of the native form of the antibody can be detected in the formulation after storage for a defined amount of time at a defined temperature. The defined amount of time after which stability is measured can be at least 7 days, at least 14 days, at least 21 days, at least 28 days, at least 56 days, at least 1 month, at least 2 months, at least 3 months, at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least 18 months, at least 24 months, or more. The defined temperature at which the pharmaceutical formulation may be stored when assessing stability can be any temperature from about 80 C. to about 45 C., e.g., storage at about 80 C., about 30 C., about 20 C., about 0 C., about 28 C., about 5 C., about 25 C., about 40 C., or about 45 C. The defined relative humidity (RH) at which the pharmaceutical formulation may be stored when assessing stability can be about 20-90% RH, about 20% RH, about 25% RH, about 30% RH, about 35% RH, about 40% RH, about 45% RH, about 50% RH, about 55% RH, about 60% RH, about 65% RH, about 70% RH, about 75% RH, about 80% RH, about 85% RH, or about 90% RH. Stress conditions may be applied to the pharmaceutical formulation to assess stability, e.g., vortexing, or freezing and thawing. Stress conditions include, for example, vortexing the antibody-organic cosolvent solution for about 30 minutes, 60 minutes or about 120 minutes, or freezing and thawing the antibody-organic cosolvent solution for 4 cycles or 8 cycles. Thermal stress may be applied to the pharmaceutical formulation to assess stability. Thermal stress includes for example holding the formulation for about 14 days, about 28 days or about 56 days at about 25 C., about 35 C., about 37 C., about 40 C. or about 45 C. In certain embodiments, stress may be applied to the pharmaceutical formulation for about 56 days at about 40 C. and about 75% RH.

(55) For example, a pharmaceutical formulation may be deemed stable if after twenty-four months of storage at 2-8 C., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 98.5%, 99% or 99.5% of antibody, or antigen-binding fragment thereof, detected by SE-UPLC, RP-UPLC or MCE is native (i.e., in the native peak fraction). A pharmaceutical formulation may be deemed stable if after eighteen months of storage at 2-8 C., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 98.5%, 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native (i.e., in the native peak fraction). A pharmaceutical formulation may be deemed stable if after six months of storage at 25 C., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 98.5%, 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native (i.e., in the native peak fraction). A pharmaceutical formulation may be deemed stable if after six months of storage at 25 C. and at 60% RH, at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 98.5%, 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native (i.e., in the native peak fraction). A pharmaceutical formulation may also be deemed stable if after six months of storage at 25 C. at least 97%, 97.5%, 98%, 98.5%, 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native. A pharmaceutical formulation may also be deemed stable if after six months of storage at 25 C. and at 60% RH, at least 97%, 97.5%, 98%, 98.5%, 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native. A pharmaceutical formulation may be deemed stable if after three months of storage at 25 C., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 98.5%, 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native (i.e., in the native peak fraction). A pharmaceutical formulation may be deemed stable if after one month of storage at 25 C., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 98.5%, 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native (i.e., in the native peak fraction). A pharmaceutical formulation may also be deemed stable if after 56 days of storage at 40 C., at least 96%, 96.5%, 97%, 97.5%, 98%, 98.5%, 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native. A pharmaceutical formulation may also be deemed stable if after 56 days of storage at 40 C. and at 75% RH, at least 96%, 96.5%, 97%, 97.5%, 98%, 98.5%, 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native. A pharmaceutical formulation may also be deemed stable if after 56 days of storage at 40 C. at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of antibody detected by SE-UPLC, RP-UPLC or MCE is native. A pharmaceutical formulation may also be deemed stable if after 56 days of storage at 40 C. and at 75% RH, at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of antibody detected by SE-UPLC, RP-UPLC or MCE is native. A pharmaceutical formulation may also be deemed stable if after six months of storage at 20 C. at least 98.5%, 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native. A pharmaceutical formulation may also be deemed stable if after 18 months of storage at 30 C. at least 99% or 99.5% of antibody detected by SE-UPLC, RP-UPLC or MCE is native. A pharmaceutical formulation may also be deemed stable if after six months of storage at 80 C. at least 99% or 99.5% of antibody detected by SE-UPLC is native.

(56) Stability can be measured, inter alia, by determining the percentage of antibody that migrates in the main fraction of antibody (main charge form) during ion exchange, relative to the total combined peak area, wherein stability is proportional to the fraction of antibody in the main charge form. The charge form can be determined by, inter alia, cation exchange chromatography (e.g., cation exchange ultra performance liquid chromatography [CEX-UPLC]), or imaged capillary isoelectric focusing (ICIEF). While not wishing to be bound by theory, deamidation of the antibody may cause the antibody to become more negatively charged and thus more acidic relative to the non-deamidated antibody (see, e.g., Robinson, N., Protein Deamidation, PNAS, Apr. 16, 2002, 99 (8): 5283-5288). An acceptable degree of stability, as that phrase is used herein, means that at least 30% of the antibody is in a main charge form detected in the formulation after storage for a defined amount of time at a defined temperature. In certain embodiments an acceptable degree of stability means that at least about 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the antibody can be detected in a main charge form after storage for a defined amount of time at a given temperature, or under thermal, freeze/thaw, or agitation stress. The defined amount of time after which stability is measured can be at least 7 days, at least 14 days, at least 28 days, at least 1 month, at least 2 months, at least 3 months, at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least 18 months, at least 24 months, or more. The temperature at which the pharmaceutical formulation may be stored when assessing stability can be any temperature from about 80 C. to about 45 C., e.g., storage at about 80 C., about 30 C., about 20 C., about 0 C., about 28 C., about 5 C., about 25 C., about 37 C., about 40 C. or about 45 C. The relative humidity (RH) at which the pharmaceutical formulation may be stored when assessing stability can be about 20-90% RH, about 20% RH, about 25% RH, about 30% RH, about 35% RH, about 40% RH, about 45% RH, about 50% RH, about 55% RH, about 60% RH, about 65% RH, about 70% RH, about 75% RH, about 80% RH, about 85% RH, or about 90% RH. For example, a pharmaceutical formulation may be deemed stable if after 24 months of storage at 2-8 C. no less than about 30%, 35%, 40%, 45%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, or 61% of the antibody, or antigen-binding fragment thereof, is in a main charge form. A pharmaceutical formulation may be deemed stable if after 18 months of storage at 2-8 C. no less than about 30%, 35%, 40%, 45%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, or 61% of the antibody is in a main charge form. A pharmaceutical formulation may also be deemed stable if after six months of storage at 25 C. and 60% RH, no less than about 30%, 35%, 40%, 45%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, or 61% of the antibody is in a main charge form. A pharmaceutical formulation may also be deemed stable if after six months of storage at 25 C., no less than about 45% of the antibody is in a main charge form. A pharmaceutical formulation may also be deemed stable if after 56 days of storage at 40 C. and 75% RH, no less than about 30%, 35%, 40%, 45%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, or 61% of the antibody is in a main charge form. A pharmaceutical formulation may also be deemed stable if after 56 days of storage at 40 C., no less than about 34% of the antibody can be detected in a main charge form.

(57) Measuring the binding affinity of the antibody to its target may also be used to assess stability or potency. The term potency refers to any of the factors that contribute to the utility or biological activity of an antibody to recognize an antigen. Potency can be assayed by ligand-binding assays or functional assays, for example, ELISA, flow cytometry and/or other in vitro cell-based assays. For example, a formulation of the present invention may be regarded as stable if, after storage at e.g., 80 C., 30 C., 20 C., 5 C., 25 C., 37 C., 40 C., 45 C., etc. for a defined amount of time (e.g., 7 days to 24 months), the anti-Activin A antibody contained within the formulation maintains at least 50% and up to about 150% of the potency, measured as binding affinity, of the antibody prior to said storage. Binding affinity may be determined by e.g., ELISA or plasmon resonance. Biological activity may be determined by a Activin A activity assay, such as e.g., by contacting a cell that expresses Activin A with the formulation comprising the anti Activin A antibody. The binding of the antibody to such a cell may be measured directly, such as via FACS analysis. Alternatively, the downstream activity of the Activin A signaling pathway may be measured in the presence of the antibody, and compared to the activity of the Activin A signaling pathway in the absence of antibody. In some embodiments, the Activin A may be endogenous to the cell. In other embodiments, the Activin A may be ectopically (heterologously) expressed in the cell.

(58) Additional methods for assessing the stability of an antibody in formulation are demonstrated in the Examples presented below.

(59) Containers and Methods of Administration

(60) The pharmaceutical formulations of the present invention may be contained within any container suitable for storage or administration of medicines and other therapeutic compositions. For example, the pharmaceutical formulations may be contained within a sealed and sterilized plastic or glass container having a defined volume such as a vial, ampule, syringe, cartridge, bottle, or IV bag. Different types of vials can be used to contain the formulations of the present invention including, e.g., clear and opaque (e.g., amber) glass or plastic vials. Likewise, any type of syringe can be used to contain or administer the pharmaceutical formulations of the present invention.

(61) The pharmaceutical formulations of the present invention may be contained within normal tungsten syringes or low tungsten syringes. As will be appreciated by persons of ordinary skill in the art, the process of making glass syringes generally involves the use of a hot tungsten rod which functions to pierce the glass thereby creating a hole from which liquids can be drawn and expelled from the syringe. This process results in the deposition of trace amounts of tungsten on the interior surface of the syringe. Subsequent washing and other processing steps can be used to reduce the amount of tungsten in the syringe. As used herein, the term normal tungsten means that the syringe contains greater than or equal to 500 parts per billion (ppb) of tungsten. The term low tungsten means that the syringe contains less than 500 ppb of tungsten. For example, a low tungsten syringe, according to the present invention, can contain less than about 490, 480, 470, 460, 450, 440, 430, 420, 410, 390, 350, 300, 250, 200, 150, 100, 90, 80, 70, 60, 50, 40, 30, 20, 10 or fewer ppb of tungsten.

(62) The rubber plungers used in syringes, and the rubber stoppers used to close the openings of vials, may be coated to prevent contamination of the medicinal contents of the syringe or vial, or to preserve their stability. Thus, pharmaceutical formulations of the present invention, according to certain embodiments, may be contained within a syringe that comprises a coated plunger, or within a vial that is sealed with a coated rubber stopper. For example, the plunger or stopper may be coated with a fluorocarbon film. Examples of coated stoppers or plungers suitable for use with vials and syringes containing the pharmaceutical formulations of the present invention are mentioned in, e.g., U.S. Pat. Nos. 4,997,423; 5,908,686; 6,286,699; 6,645,635; and 7,226,554, the contents of which are incorporated by reference herein in their entireties. Particular exemplary coated rubber stoppers and plungers that can be used in the context of the present invention are commercially available under the tradename FluroTec, available from West Pharmaceutical Services, Inc. (Lionville, PA). FluroTec is an example of a flurocarbon coating used to minimize or prevent drug product from adhering to the rubber surfaces.

(63) According to certain embodiments of the present invention, the pharmaceutical formulations may be contained within a low tungsten syringe that comprises a fluorocarbon-coated plunger.

(64) The pharmaceutical formulations can be administered to a patient by parenteral routes such as injection (e.g., subcutaneous, intravenous, intramuscular, intraperitoneal, etc.) or percutaneous, mucosal, nasal, pulmonary or oral administration. Numerous reusable pen or autoinjector delivery devices can be used to subcutaneously deliver the pharmaceutical formulations of the present invention. Examples include, but are not limited to AUTOPEN delivery pen (Owen Mumford, Inc., Woodstock, UK), DISETRONIC delivery pen (Disetronic Medical Systems, Bergdorf, Switzerland), HUMALOG MIX 75/25TM delivery pen, HUMALOG delivery pen, HUMALIN 70/30TM delivery pen (Eli Lilly and Co., Indianapolis, IN), NOVOPEN I, II and III delivery device (Novo Nordisk, Copenhagen, Denmark), NOVOPEN JUNIOR delivery device (Novo Nordisk, Copenhagen, Denmark), BD delivery pen (Becton Dickinson, Franklin Lakes, NJ), OPTIPEN delivery device, OPTIPEN PRO delivery device, OPTIPEN STARLET delivery device, and OPTICLIK delivery device (sanofi-aventis, Frankfurt, Germany). Examples of disposable pen or autoinjector delivery devices having applications in subcutaneous delivery of a pharmaceutical composition of the present invention include, but are not limited to the SOLOSTAR delivery pen (sanofi-aventis), the FLEXPEN delivery device (Novo Nordisk), the KWIKPEN delivery device (Eli Lilly), the SURECLICK Autoinjector (Amgen, Thousand Oaks, CA), the PENLET delivery device (Haselmeier, Stuttgart, Germany), the EPIPEN delivery device (Dey, L.P.), and the HUMIRA delivery pen (Abbott Labs, Abbott Park, IL).

(65) The use of a microinfusor to deliver the pharmaceutical formulations of the present invention is also contemplated herein. As used herein, the term microinfusor means a subcutaneous delivery device designed to slowly administer large volumes (e.g., up to about 2.5 mL or more) of a therapeutic formulation over a prolonged period of time (e.g., about 10, 15, 20, 25, 30 or more minutes). See, e.g., U.S. Pat. Nos. 6,629,949; 6,659,982; and Mechan et al., J. Controlled Release 46:107-116 (1996). Microinfusors are particularly useful for the delivery of large doses of therapeutic proteins contained within high concentration (e.g., about 100, 125, 150, 175, 200 or more mg/mL) or viscous solutions.

(66) In one embodiment, the pharmaceutical formulation is administered via an IV drip, such that the formulation is diluted in an IV bag containing a physiologically acceptable solution. In one embodiment, the pharmaceutical composition is a compounded sterile preparation in an intravenous infusion bag, such that a single dose of drug product is diluted into 100 mL, 250 mL (or other like amount suitable for intravenous drip delivery) of a physiological buffer (e.g., 0.9% saline). In some embodiments, the infusion bag is made of a polyvinyl chloride (e.g., VIAFLEX, Baxter, Deerfield, Illinois). In some embodiments, the infusion bag is made of a polyolefin (EXCEL IV Bags, Braun Medical Inc., Bethlehem, Pennsylvania).

(67) Therapeutic Uses of the Pharmaceutical Formulations

(68) The pharmaceutical formulations of the present invention are useful, inter alia, for the treatment, prevention or amelioration of any disease or disorder associated with Activin A activity, including diseases or disorders mediated by Activin A. Exemplary, non-limiting diseases and disorders that can be treated or prevented by the administration of the pharmaceutical formulations of the present invention include Fibrodysplasia ossificans progressiva (FOP). FOP is a rare heritable disorder in which heterotopic ossification forms histologically and biomechanically normal bone at extraskeletal sites, such as connective tissue. This disorder, although episodic, is cumulative, and results in permanent disability of increasing severity. FOP is a relentless, progressive, ultra-rare genetic disorder in which muscles, tendons and ligaments are progressively replaced by bone, a process known Heterotopic Ossification (HO). HO of the jaw, spine and rib cage can make it difficult to speak, cat or breathe, leading to weight loss and escalating loss of mobility and skeletal deformity. People with FOP also experience episodic, localized inflammation known as a flare-ups though HO may occur both silently as well as in association with symptoms. Most people with FOP are wheelchair bound by 30 years old and the median age of survival is approximately 40 years. Death often results from complications, such as pneumonia, heart failure and aspiration, stemming from HO and loss of mobility in the chest, neck and jaw.

Examples

(69) The following examples are presented so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the methods and compositions of the invention, and are not intended to limit the scope of what the inventors regard as their invention. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by mole, molecular weight is average molecular weight, percent concentration (%) means the mass of the solute in grams divided by the volume of the solution in milliliters times 100% (e.g., 10% sucrose means 0.1 gram of sucrose per milliliter of solution), temperature is in degrees Centigrade, and pressure is at or near atmospheric pressure. Initial formulation development activities involved screening organic cosolvents, thermal stabilizers, and buffers in liquid and lyophilized formulations of anti-Activin A antibodies to identify excipients that are compatible with the protein and enhance its stability, while maintaining near physiologic osmolality and low viscosity for intravenous and subcutaneous injection. Buffer conditions were also examined to determine the optimal pH for maximum protein stability.

Example 1: Exemplary Anti-Activin A Antibody Formulation

(70) For First in Human (FIH) studies, a lyophilized drug product (DP) was developed intended to be used for both intravenous (IV) and subcutaneous (SC) administration. The formulation for FIH was developed by assessing the effects of different components of the formulation on the stability of an anti-Activin A antibody, for example, garetosmab. These components included pH, buffer, thermal stabilizers, and surfactants. The major degradation pathways for garetosmab are formation of high and low molecular weight species, and acidic charge variants. Analytical methods were developed to monitor these degradation products. In addition, general quality attributes were monitored. These included protein concentration, pH, solubility, and biological potency. Based on the formulation development studies executed, a lyophilized formulation was developed which included histidine at pH 6.3, sucrose and polysorbate 80. The lyophilized formulation developed for FIH was stable for at least 36 months.

(71) Garetosmab was delivered by IV and SC administration in a Phase 1 clinical study. A single, dual-use lyophilized formulation was developed such that lyophilized garetosmab DP was reconstituted with sterile water for injection (WFI) to a concentration of either 50 mg/mL garetosmab for IV infusion, or 150 mg/mL garetosmab for SC injection. Formulation development activities involved assessment of buffers, pH, organic co-solvents, surfactants, and sucrose (as the thermal stabilizer) to identify excipients that optimize protein stability. Garetosmab DP was produced by lyophilization of an optimized, aqueous buffered formulation containing 10 mM histidine, pH 6.3, 0.1% (w/v) polysorbate 80, 5% (w/v) sucrose, and 50 mg/mL garetosmab. Table lists the composition of garetosmab DP after reconstitution with different volumes of WFI for IV or SC administration.

(72) TABLE-US-00002 TABLE 2 Composition of Garetosmab DP for First in Human Studies After Reconstitution with Different Volumes of WFI for IV or SC Administration Formulation Reconstituted for IV Reconstituted for SC Component Administration Administration Garetosmab 50 mg/mL 150 mg/mL Histidine 10 mM 30 mM Sucrose 5% 15% Polysorbate 80 0.1% 0.3% pH 6.3 6.3 DP, drug product; IV, intravenous; SC, subcutaneous; WFI, Water for Injection

(73) The effect of buffer and pH on the thermal stability of garetosmab was initially examined in liquid formulations by incubating 5 mg/mL garetosmab at 45 C. for 28 days in a series of buffer systems at varying pH ranges. Maximum protein stability was observed when garetosmab was formulated between pH 5.5 and 6.5 in 10 mM histidine buffer (Table). The effect of pH on the thermal stability of garetosmab was further examined in liquid formulations in histidine buffers ranging in pH from 6.0 to 6.6. A pH of 6.3 was selected for the DP formulation because the formation of high molecular weight (HMW) species was minimal at this pH (Table). This target pH would also permit a suitable pH range for maximal stability that could be achieved in a large-scale manufacturing setting. Based on these results, 10 mM histidine buffer at pH 6.3 was selected for the garetosmab DP formulation.

(74) The effect of surfactants and organic co-solvents on the agitation stress stability, freeze/thaw stability, and thermal stability of 10 mg/mL garetosmab was examined in liquid formulations. The results of these studies are summarized in Table through Table. Garetosmab was unstable when agitated in the absence of an organic co-solvent or surfactant. All the organic co-solvents and surfactants that were tested protected garetosmab from agitation-induced instability (Table). 10 mg/mL garetosmab was unstable when exposed to multiple freeze/thaw cycles in the absence of an organic co-solvent or surfactant (Table). All the organic co-solvents and surfactants that were tested protected garetosmab from freeze/thaw-induced instability (Table). In a subsequent study, which exposed 70 mg/mL garctosmab to eight freezing and thawing cycles, no visual failures or increases in HMW species were observed, even in solutions which did not contain surfactant or co-solvent (Table). 70 mg/mL is representative of the concentrations of garetosmab that were subjected to freezing and thawing in a manufacturing setting during clinical trials of garetosmab. Polysorbate 80 was selected as the surfactant for the initial garetosmab DP formulation because it stabilized the protein to agitation stress and freeze/thaw-induced instability and had a minimal adverse impact on the thermal stability, while demonstrating a safe history of use in monoclonal antibody formulations (Table through Table).

(75) The stabilizing effect of sucrose on garetosmab was assessed. 10 mg/mL garetosmab in a liquid formulation exhibited improved stability when formulated with 5% sucrose, compared to no sucrose present, and incubated under accelerated conditions (Table). Garetosmab was sufficiently stable for initial clinical use when formulated in the presence of histidine, polysorbate 80, and sucrose, at pH 6.3.

(76) Based on the initial formulation development studies, the following formulation was selected for clinical use: 50 mg/mL garetosmab, 10 mM histidine, pH 6.3, 5% (w/v) sucrose, and 0.1% (w/v) polysorbate 80. The DP was produced by filling 5.74 mL of this formulation into 20 mL glass vials and lyophilized. Research stability studies indicated that this formulation was stable for 36 months (Table 9).

(77) TABLE-US-00003 TABLE 3 Effect of Buffer and pH on the Stability of 5 mg/mL Garetosmab Incubated at 45 C. for 28 Days Formulation 5 mg/mL garetosmab, 10 mM buffer Fill Volume 0.4 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluroTec-coated 4432/50 butyl rubber stopper % Total Turbidity Protein Change in Charge (Increase Recovered Change in Purity by Variants by in by SE-UPLC.sup.a CEX-UPLC.sup.a FDG Lot Color and OD at RP- % % % % % % pH/Buffer Number Appearance 405 nm) UPLC HMW Native LMW Acidic Main Basic pH 4.5, Acetate L13-322 Pass 0.00 102 2.5 4.3 1.9 5.4 16.4 21.8 pH 5.0, Acetate L13-323 Pass 0.00 96 1.6 3.2 1.6 0.9 14.6 15.5 pH 5.5, Acetate L13-324 Pass 0.00 106 1.4 1.9 0.5 11.0 11.3 0.4 pH 5.5, Histidine L13-325 Pass 0.00 92 1.2 2.2 1.0 3.6 7.9 4.3 pH 6.0, Histidine L13-326 Pass 0.01 100 0.8 1.8 1.0 8.7 11.6 2.9 pH 6.5, Histidine L13-327 Pass 0.00 97 1.0 1.3 0.3 17.2 16.7 0.5 pH 6.5, Phosphate L13-328 Pass 0.00 95 2.5 2.9 0.3 20.3 17.2 3.0 pH 7.0, Phosphate L13-329 Pass 0.00 94 2.9 3.6 0.7 36.2 31.4 4.8 .sup.aReported as a change in purity relative to the starting material; The starting material (no incubation) contains 98.5% native peak by SE-UPLC and 55.8% main peak by CEX-UPLC in all formulations. CEX, cation exchange; DS, drug substance; FDG, Formulation Development group; HMW, high molecular weight; LMW, low molecular weight; OD, optical density; RP, reversed-phase; SE, size exclusion; UPLC, ultra performance liquid chromatography

(78) TABLE-US-00004 TABLE 4 Effect of Buffer and pH on the Stability of 25 mg/mL Garetosmab Incubated at 45 C. for 28 Days Formulation 25 mg/mL garetosmab, 10 mM buffer Fill Volume 0.5 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluroTec-coated 4432/50 butyl rubber stopper % Total Turbidity Protein Change in Charge (Increase Recovered Change in Purity by Variants by in by SE-UPLC.sup.a CEX-UPLC.sup.a FDG Lot Color and OD at RP- % % % % % % pH/Buffer Number Appearance 405 nm) UPLC HMW Native LMW Acidic Main Basic pH 6.0, Histidine L13-1003 Pass 0.01 95 2.3 6.2 3.7 3.8 11.0 7.2 pH 6.1, Histidine L13-1004 Pass 0.00 99 1.5 3.6 2.0 6.2 12.8 6.6 pH 6.2, Histidine L13-1005 Pass 0.00 97 1.2 2.7 1.4 8.8 14.1 5.3 pH 6.3, Histidine L13-1006 Pass 0.00 100 1.4 2.4 1.0 10.6 14.6 4.0 pH 6.4, Histidine L13-1007 Pass 0.00 100 1.4 2.1 0.7 12.1 14.7 2.6 pH 6.5, Histidine L13-1008 Pass 0.01 100 1.5 2.2 0.6 13.2 15.6 2.5 pH 6.6, Histidine L13-1009 Pass 0.01 99 1.8 2.0 0.2 15.2 18.1 2.9 .sup.aReported as a change in purity relative to the starting material; The starting material (no incubation) contains 98.6% native peak by SE-UPLC and 64.7% main peak by CEX-UPLC in all formulations. CEX, cation exchange; DS, drug substance; FDG, Formulation Development group; HMW, high molecular weight; LMW, low molecular weight; OD, optical density; RP, reversed-phase; SE, size exclusion; UPLC, ultra performance liquid chromatography

(79) TABLE-US-00005 TABLE 5 Effect of Organic Co-solvents and Surfactants on the Stability of 10 mg/mL Garetosmab After Agitation (120 Minutes of Vortexing) Formulation 10 mg/mL garetosmab, 10 mM histidine, pH 6.0 Fill Volume 0.4 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluorTec- coated 4432/50 butyl rubber stopper Turbidity % Total Change in Purity by Change in Charge Variants (Increase in Protein SE-UPL C.sup.a by CEX-UPLC.sup.a Co-Solvent/ FDG Lot Color and OD at Recovered by % % % % % % Surfactant Number Appearance 405 nm) pH RP-UPLC HMW Native LMW Acidic Main Basic No Co-Solvent/ L13-468 Pass 0.13 6.1 101 0.5 0.5 0.1 0.4 0.3 0.1 Surfactant 5% (w/v) L13-469 Pass 0.16 6.1 98 0.8 0.8 0.0 0.4 0.3 0.1 Sucrose 0.1% (w/v) L13-470 Pass 0.00 6.1 100 0.1 0.1 0.0 0.1 0.2 0.1 Polysorbate 20, 5% Sucrose 0.1% (w/v) L13-471 Pass 0.00 6.1 100 0.0 0.0 0.0 0.2 0.2 0.0 Polysorbate 80, 5% Sucrose 0.5% (w/v) L13-472 Pass 0.00 6.1 100 0.0 0.1 0.0 0.2 0.8 0.6 PEG3350, 5% Sucrose 1.5% (w/v) L13-473 Pass 0.00 6.1 100 0.0 0.1 0.0 0.2 0.3 0.1 PEG3350, 5% Sucrose .sup.aReported as a change in purity relative to the starting material; The starting material (no incubation) contains 98.8% native peak by SE-UPLC and 55.5% main peak by CEX-UPLC in all five formulations. CEX, cation exchange; DS, drug substance; FDG, Formulation Development group; HMW, high molecular weight; LMW, low molecular weight; OD, optical density; RP, reversed-phase; SE, size exclusion; UPLC, ultra performance liquid chromatography

(80) TABLE-US-00006 TABLE 6 Effect of Organic Co-Solvents and Surfactants on the Stability of 10 mg/mL Garetosmab After Eight Freezing and Thawing Cycles Formulation 10 mg/mL garetosmab, 10 mM histidine, pH 6.0 Fill Volume 0.4 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluorTec- coated 4432/50 butyl rubber stopper Turbidity % Total Change in Purity by Change in Charge Variants (Increase in Protein SE-UPL C.sup.a by CEX-UPLC.sup.a Co-Solvent/ FDG Lot Color and OD at Recovered by % % % % % % Surfactant Number Appearance 405 nm) pH RP-UPLC HMW Native LMW Acidic Main Basic No Co-Solvent/ L13-468 Fail 0.47 6.1 107 0.0.sup.b 0.0.sup.b 0.0.sup.b 0.1 0.1 0.0 Surfactant 5% (w/v) L13-469 Fail 0.40 6.1 97 1.0 1.0 0.0 0.1 0.1 0.0 Sucrose 0.1% (w/v) L13-470 Pass 0.00 6.1 102 0.1 0.1 0.0 0.0 0.1 0.1 Polysorbate 20, 5% Sucrose 0.1% (w/v) L13-471 Pass 0.00 6.1 102 0.0 0.0 0.0 0.0 0.5 0.5 Polysorbate 80, 5% Sucrose 0.5% (w/v) L13-472 Pass 0.00 6.1 105 0.1 0.2 0.1 0.1 0.3 0.1 PEG3350, 5% Sucrose 1.5% (w/v) L13-473 Pass 0.00 6.1 104 0.1 0.2 0.1 0.2 0.4 0.2 PEG3350, 5% Sucrose .sup.aReported as a change in purity relative to the starting material; The starting material (no incubation) contains 98.8% native peak by SE-UPLC and 55.5% main peak by CEX-UPLC in all five formulations. .sup.bValues for four freeze/thaw cycles are: HMW = 0.5%, Native = 0.4%, and LMW = 0.0% CEX, cation exchange; DS, drug substance; FDG, Formulation Development group; HMW, high molecular weight; LMW, low molecular weight; OD, optical density; RP, reversed-phase; SE, size exclusion; UPLC, ultra performance liquid chromatography

(81) TABLE-US-00007 TABLE 7 Effect of Organic Co-Solvents and Surfactants on the Stability of 70 mg/mL Garetosmab after Eight Freezing and Thawing Cycles Formulation 70 mg/mL garetosmab, 10 mM histidine, pH 6.0 Fill Volume 0.4 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluorTec-coated 4432/50 butyl rubber stopper % Total Turbidity Protein Change in Charge (Increase Recovered Change in Purity by Variants by in by SE-UPLC.sup.a CEX-UPLC.sup.a Co-Solvent/ FDG Lot Color and OD at RP- % % % % % % Surfactant Number Appearance 405 nm) pH UPLC HMW Native LMW Acidic Main Basic No Co-Solvent/ L13-595 Pass 0.03 6.1 102 0.0 0.1 0.1 0.2 0.1 0.1 Surfactant 5% (w/v) L13-596 Pass 0.02 6.1 100 0.1 0.1 0.2 0.3 0.3 0.0 Sucrose 0.1% (w/v) L13-597 Pass 0.01 6.1 102 0.1 0.0 0.1 0.3 0.3 0.0 Polysorbate 80, 5% Sucrose 0.5% (w/v) L13-598 Pass 0.01 6.1 99 0.1 0.0 0.1 0.4 0.4 0.1 PEG3350, 5% Sucrose .sup.aReported as a change in purity relative to the starting material; The starting material (no incubation) contains 98.6% native peak by SE-UPLC and 56.3% main peak by CEX-UPLC in all five formulations. CEX, cation exchange; DS, drug substance; FDG, Formulation Development group; HMW, high molecular weight; LMW, low molecular weight; OD, optical density; RP, reversed-phase; SE, size exclusion; UPLC, ultra performance liquid chromatography

(82) TABLE-US-00008 TABLE 8 Effect of Organic Co-Solvents and Surfactants on the Stability of 10 mg/mL Garetosmab Incubated at 45 C. for 28 Days Formulation 10 mg/mL garetosmab, 10 mM histidine, pH 6.0 Fill Volume 0.4 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluorTec-coated 4432/50 butyl rubber stopper % Total Turbidity Protein Change in Charge (Increase Recovered Change in Purity by Variants by in by SE-UPLC.sup.a CEX-UPLC.sup.a Co-Solvent/ FDG Lot Color and OD at RP- % % % % % % Surfactant Number Appearance 405 nm) pH UPLC HMW Native LMW Acidic Main Basic No Co-Solvent/ L13-468 Pass 0.00 6.2 98 0.9 3.2 2.4 9.1 12.5 3.5 Surfactant 5% (w/v) L13-469 Pass 0.00 6.1 101 0.6 2.7 2.0 10.2 13.0 2.8 Sucrose 0.1% (w/v) L13-470 Pass 0.01 6.0 101 6.1 8.1 2.1 12.1 22.2 10.1 Polysorbate 20, 5% Sucrose 0.1% (w/v) L13-471 Pass 0.01 6.1 101 4.2 6.6 2.3 13.2 24.5 11.3 Polysorbate 80, 5% Sucrose 0.5% (w/v) L13-472 Pass 0.01 6.1 101 1.2 3.1 2.0 14.1 17.4 3.3 PEG3350, 5% sucrose 1.5% (w/v) L13-473 Pass 0.02 6.0 103 5.7 8.1 2.4 14.9 28.4 13.5 PEG3350, 5% Sucrose .sup.aReported as a change in purity relative to the starting material; The starting material (no incubation) contains 98.8% native peak by SE-UPLC and 55.5% main peak by CEX-UPLC in all five formulations. CEX, cation exchange; DS, drug substance; FDG, Formulation Development group; HMW, high molecular weight; LMW, low molecular weight; OD, optical density; RP, reversed-phase; SE, size exclusion; UPLC, ultra performance liquid chromatography

(83) TABLE-US-00009 TABLE 9 Development Stability of Garetosmab Lyophilized C1P2 Drug Product Stored at 5 C. Pre-lyophilized Formulation 50 mg/mL garetosmab, 10 mM histidine, pH 6.3, 5% (w/v) sucrose, 0.1% (w/v) polysorbate 80 Fill Volume 5.3 mL Container/Closure 20 mL Type 1 borosilicate glass vials with a West V10-F597W 4432/50 GRY B2-TR stopper Length of Storage at 5 C. (months) Assay 0 1 3 6 9 12 18 24 36 Analysis of Lyophilized Drug Product Cake Appearance Pass Pass Pass Pass Pass Pass Pass Pass Pass % Moisture 0.13 NR NR 0.18 NR 0.19 NR 0.25 0.29 Reconstitution Time (seconds) 60 60 60 90 70 60 60 60 120 Analysis of Reconstituted Drug Product.sup.a Color and Appearance Pass Pass Pass Pass Pass Pass Pass Pass Pass Turbidity (Increase in OD at 405 nm) 0.00 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.00 pH 6.4 6.3 6.3 6.3 6.3 6.3 6.3 6.3 6.3 Particulate 2 to 10 m 1168 NR NR 2744 NR 1122 NR 1941 6357 Analysis by 10 m 15 NR NR 48 NR 17 NR 6 121 MFI 25 m 7 NR NR 10 NR 4 NR 0 7 % Total Protein Recovered by 100 94 96 93 94 95 95 96 94 RP-UPLC Purity by Non-reduced; 100 NR NR 100 NR 100 NR 100 100 MCE-SDS % main peak Reduced; 100 NR NR 100 NR 100 NR 100 100 % heavy + light chain Purity by % HMW 0.8 0.8 0.8 0.9 0.9 0.9 0.9 1.0 1.2 SE-UPLC % Native 98.7 98.8 98.6 98.5 98.5 98.5 98.5 98.3 97.8 % LMW 0.5 0.4 0.6 0.6 0.6 0.6 0.6 0.7 1.1 Charge % Acidic 31.4 31.6 30.7 31.4 31.5 31.7 32.7 32.0 32.2 Variant % Main 53.4 52.5 51.3 52.3 51.6 52.7 50.2 51.6 52.4 Analysis by % Basic 15.1 15.9 18.0 16.3 17.0 15.6 17.1 16.4 15.4 CEX-UPLC Charge % Acidic 48.4 NR NR 44.6 NR 48.5 NR 49.8 49.0 Variant % Main 48.4 NR NR 51.5 NR 46.3 NR 43.6 45.7 Analysis by % Basic 3.2 NR NR 3.9 NR 5.1 NR 6.6 5.3 iCIEF % Relative Potency by Bioassay 103 NR NR 114 NR 135 NR 106 95 .sup.aSamples were reconstituted with sterile Water for Injection to 100 mg/mL garetosmab. C1P2, cell line 1 process 2; CEX, cation exchange; DS, drug substance; FDG, Formulation Development group; HMW, high molecular weight; iCIEF, imaged capillary isoelectric focusing; LMW, low molecular weight; MCE-SDS, microchip capillary electrophoresis-sodium dodecyl sulfate; MFI, Micro-Flow Imaging; NR, not required; OD, optical density; RP, reversed-phase; SE, size exclusion; UPLC, ultra performance liquid chromatography.

Example 2: Exemplary Anti-Activin A Antibody Formulations

(84) The objective of the drug product (DP) commercial development activities were to develop an anti-Activin A antibody (e.g., garetosmab) DP with the following attributes: a liquid formulation in glass vials with a concentration of garetosmab sufficient to deliver a dose of 10 mg/kg garctosmab by intravenous (IV) infusion; the vial of garctosmab should contain 300 mg in 5 mL; a near iso-osmolar formulation that can be diluted for IV infusion with commonly available diluents; a formulation that is compatible with and stable in type 1 clear glass vials and standard serum stopper as the primary packaging system; a sterile DP that supports long-term stability with a shelf-life of 24 months or longer at 2-8 C.; a robust formulation that minimizes formation of garetosmab high molecular weight (HMW) species, minimizes changes in the relative distribution of garetosmab charge variant species, minimizes the presence of visible and subvisible particles, and maintains the biological activity when subjected to handling and thermal stresses; and a formulation that will stabilize high garetosmab concentrations and have characteristics that are acceptable for use in subcutaneous (SC) administration.

(85) This study describes the late phase formulation optimization, garctosmab commercial formulation confirmation, and garetosmab robustness. The garetosmab commercial formulation is a liquid containing 60 mg/mL garctosmab in an aqueous solution containing 10 mM L-histidine, pH 6.3, 5% (w/v) sucrose, 70 mM L-arginine HCl, and 0.05% (w/v) polysorbate 20. This formulation stabilizes garetosmab during long-term storage at 2-8 C. and when exposed to accelerated and stress conditions, including agitation, freezing and thawing, and thermal stress. For Phase 2 clinical studies and commercialization, a liquid DP formulation suitable for IV administration was developed. This formulation was built upon knowledge gained during initial development, plus additional formulation development studies performed to refine and optimize the formulation for the specific clinical indication and to optimize product stability. The formulation for garetosmab consists of the following: 60 mg/mL garetosmab, 10 mM histidine, pH 6.3, 5% sucrose, 70 mM arginine-HCl, and 0.05% polysorbate 20. The DP is manufactured by filling 5.61 mL into a 10 mL glass vial and sealed with an elastomeric stopper. Long-term stability studies have been initiated and indicate that the formulation is stable for at least 12 months. The stability studies will continue for 60 months. Robustness studies have been initiated. Long-term, accelerated and stress stability studies thus far indicate that the formulation is robust with respect to pH, protein concentration and excipient concentration. Small variations that might occur in the manufacturing process have no meaningful impact to the quality of garctosmab DP.

(86) The pharmaceutical development studies executed during the garetosmab development process resulted in a stable formulation for garetosmab that meets the goals set forth to address the clinical and commercial needs. The goal for late-stage clinical development was to produce a formulation that would deliver 300 mg of garetosmab in 5 mL of solution. A secondary goal was to have a formulation that would be easily converted to a subcutaneous formulation for future use. Formulation development studies were conducted with the goal of developing a liquid formulation containing 60 mg/mL garetosmab that will be used for IV administration. Formulation development activities for the liquid formulation involved assessment of histidine buffer concentration, surfactant concentration, and other stabilizers.

(87) Selection of Buffer and pH for the Garetosmab Liquid Formulation

(88) Initial FIH development activities determined that the optimal pH for garetosmab was 6.3. The pH remained unchanged throughout development. Histidine buffer was utilized for the lyophilized formulation for initial Phase 1 studies of garetosmab based upon a buffer screening study. The same buffer was chosen for late stage formulation development. The stability of 50 mg/mL garetosmab was tested when incubated at 45 C. for 28 days at pH 6.3 when the histidine concentration was 5 mM, 10 mM or 25 mM to assess the optimal histidine concentration. The results of this stress test indicate that 10 mM histidine at pH 6.3 falls in a stable region of the design space with sufficient space on either end to tolerate small variations in the buffer concentration (Table) or pH (Table). Based on these results the same buffer composition and pH used for the lyophilized formulation, histidine, at a concentration of 10 mM and a pH of 6.3, was selected as the buffer, buffer concentration, and pH for the late stage liquid formulation.

(89) Selection of Thermal Stabilizers for the Garetosmab Liquid Formulation

(90) Initial development studies for garetosmab demonstrated that 5% (w/v) sucrose was required to stabilize garetosmab to freeze-thaw stress. Therefore, 5% (w/v) sucrose was added to the bulk Drug Substance (DS) because it adequately stabilizes the bulk DS against the formation of HMW species when subjected to freezing and thawing cycles that the DS would be exposed to during manufacturing (freezing and thawing stability for DS is discussed in Module S.7.1). A study was performed to assess the stability of 50 mg/mL liquid garetosmab when incubated at 45 C. for 28 days or subjected to 8 cycles of freezing and thawing, when the sucrose concentration in the formulation was varied between 0 and 10%. The results of these stress tests indicate that 5% sucrose falls in a stable region of the design space with sufficient space on either end to tolerate small variations in the sucrose concentration that may be experienced as a result of normal manufacturing variability (Table and Table). 5% sucrose was chosen as a stabilizer because it sufficiently stabilizes garetosmab to thermal, and freezing and thawing stresses and provides an acceptable osmolality in the final formulation.

(91) Arginine was evaluated as an additional stabilizer for the garetosmab liquid formulation. During the assessment, a range of arginine concentrations from 0 to 100 mM was evaluated (Table). The results of the stress test indicates that 70 mM arginine falls in a stable region of the design space with sufficient space on either end to tolerate small variations in the arginine concentration that may be experienced as a result of normal manufacturing variability (Table). 70 mM arginine was chosen as the stabilizer concentration in the garetosmab liquid formulation due to the reduced formation of HMW species and acidic charge variants observed under stress stability conditions and because it provides an acceptable osmolality in the final formulation.

(92) Selection of a Surfactant for the Garetosmab Liquid Formulation

(93) 0.1% (w/v) polysorbate 80 was chosen for the garetosmab Phase 1 formulation. Further testing, comparing the stability of 50 mg/mL garetosmab in the presence of polysorbate 20 or polysorbate 80, indicated that both surfactants provided comparable stability to 50 mg/mL garetosmab when incubated at 45 C. for 28 days or at 25 C. for 6 months (Table). Polysorbate 20 was chosen for further development of a garetosmab liquid formulation. The stability of 50 mg/mL garetosmab was assessed when agitated for 30 minutes or incubated at 45 C. for 28 days at varying polysorbate 20 concentrations. The results of the stress test indicates that 0.05% polysorbate 20 falls in a stable region of the design space with sufficient space on either end to tolerate small variations in the polysorbate 20 concentration that may be experienced as a result of normal manufacturing variability (Table and Table). A polysorbate 20 concentration of 0.05% (w/v) was chosen for the garetosmab liquid formulation.

(94) Conclusions

(95) Results of studies testing garetosmab stability when formulations were subjected to stress conditions, incubation at 45 C., vortex agitation and freeze/thaw cycling, were used to select the late-stage formulation. Based on data collected from these studies a garetosmab formulation containing 10 mM histidine, pH 6.3, 5% sucrose, 70 mM arginine-HCl and 0.05% polysorbate 20 was selected and subsequently demonstrated to be suitable for clinical or commercial use. The excipient concentrations were chosen such that small variations that may be experienced during normal manufacturing will have no observable impact on the stability or quality of the garetosmab DP. The selected formulation contains 60 mg/mL garetosmab to provide a 300 mg dose in a withdrawable volume of 5 mL. The suitability of this formulation has been confirmed based on 18 months of long-term development stability data at 5 C., 6 months of accelerated stability data at 25 C./60% RH and stress stability testing including 56 days of stability data at 40 C./75% RH,8 cycles of freezing and thawing and 120 minutes of agitation (vortex).

(96) TABLE-US-00010 TABLE 10 Effect of Histidine Concentration on the Stability of 50 mg/mL Garetosmab Incubated at 45 C. for 28 Days Formulation 50 mg/mL garetosmab, pH 6.3 Fill Volume 0.3 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluroTec coated 4432/50 butyl rubber stopper % Total Change in Purity Change in Charged Variants Turbidity Protein by SE-UPLC.sup.a by CEX-UPLC.sup.a Histidine Lot Color and (Increase in OD Recovered by % % % % % % concentration Number Appearance at 405 nm) pH RP-UPLC HMW Native LMW Acidic Main Basic 5 mM L16-1298 Pass 0.01 6.4 104 3.2 3.7 0.5 13.5 15.2 1.7 10 mM L16-1299 Pass 0.01 6.4 103 2.9 3.5 0.6 13.5 14.6 1.2 25 mM L16-1300 Pass 0.01 6.4 103 2.6 3.2 0.6 13.5 14.6 1.1 .sup.aReported as a change in purity relative to the starting material. The starting material (no incubation) contains 98.6% native peak by SE-UPLC and 50.3% main peak by CEX-UPLC in all formulations. Negative numbers indicate a decrease in the measured attribute and positive numbers indicate an increase.

(97) TABLE-US-00011 TABLE 11 Effect of Sucrose Concentration on the Stability of 50 mg/mL Garetosmab Incubated at 45 C. for 28 Days Formulation 50 mg/mL garetosmab, 10 mM histidine, pH 6.3 Fill Volume 0.3 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluroTec coated 4432/50 butyl rubber stopper % Total Change in Purity Change in Charged Variants Turbidity Protein by SE-UPLC.sup.a by CEX-UPLC .sup.a Sucrose Lot Color and (Increase in OD Recovered % % % % % % concentration Number Appearance at 405 nm) pH by RP-UPLC HMW Native LMW Acidic Main Basic 0% L16-1306 Pass 0.00 6.4 100 3.0 3.5 0.5 13.2 14.0 0.8 2.5% L16-1307 Pass 0.00 6.4 102 2.7 3.2 0.6 13.0 13.4 0.4 5% L16-1308 Pass 0.00 6.3 101 2.5 3.0 0.5 13.2 13.9 0.7 7.5% L16-1309 Pass 0.00 6.3 101 2.5 3.0 0.5 13.9 14.5 0.6 10% L16-1310 Pass 0.00 6.3 102 2.2 2.8 0.6 13.2 14.7 1.5 .sup.aReported as a change in purity relative to the starting material. The starting material (no incubation) contains 98.8% native peak by SE-UPLC and 50.2% main peak by CEX-UPLC in all formulations. Negative numbers indicate a decrease in the measured attribute and positive numbers indicate an increase.

(98) TABLE-US-00012 TABLE 12 Effect of Sucrose Concentration on the Stability of 50 mg/mL Garetosmab After 8 Cycles of Freezing and Thawing Formulation 50 mg/mL garetosmab, 10 mM histidine, pH 6.3 Fill Volume 0.3 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluroTec coated 4432/50 butyl rubber stopper Turbidity % Total Change in Purity Change in Charged Variants (Increase Protein by SE-UPLC.sup.a by CEX-UPLC.sup.a Sucrose Lot Color and in OD Recovered by % % % % % % concentration Number Appearance at 405 nm) pH RP-UPLC HMW Native LMW Acidic Main Basic 0% L16-1306 Pass 0.00 6.3 98 0.7 0.9 0.2 0.7 0.7 0.0 2.5% L16-1307 Pass 0.00 6.3 98 0.1 0.3 0.2 0.5 0.5 0.0 5% L16-1308 Pass 0.00 6.3 98 0.1 0.2 0.2 0.6 0.0 0.5 7.5% L16-1309 Pass 0.00 6.3 98 0.0 0.2 0.2 0.6 0.5 0.1 10% L16-1310 Pass 0.00 6.3 98 0.1 0.2 0.2 0.6 0.1 0.5 .sup.aReported as a change in purity relative to the starting material. The starting material (no incubation) contains 98.8% native peak by SE-UPLC and 50.2% main peak by CEX-UPLC in all formulations. Negative numbers indicate a decrease in the measured attribute and positive numbers indicate an increase.

(99) TABLE-US-00013 TABLE 13 Effect of Arginine Concentration on the Stability of 50 mg/mL Garetosmab Incubated at 45 C. for 28 Days Formulation 50 mg/mL garetosmab, 10 mM histidine, pH 6.3 Fill Volume 0.3 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluroTec coated 4432/50 butyl rubber stopper % Total Change Change in Turbidity Protein in Purity Charged Variants (Increase Recovered by SE-UPLC.sup.a by CEX-UPLC .sup.a Arginine Lot Color and in OD by % % % % % % concentration Number Appearance at 405 nm) pH RP-UPLC HMW Native LMW Acidic Main Basic 0 mM L16-1403 Pass 0.00 6.4 102 3.0 3.6 0.6 13.2 14.4 1.2 25 mM L16-1311 Pass 0.00 6.4 102 2.3 2.9 0.6 11.1 12.5 1.5 50 mM L16-1312 Pass 0.00 6.4 100 2.3 2.9 0.6 10.6 13.7 3.1 70 mM L16-1313 Pass 0.00 6.3 99 2.2 2.8 0.6 10.3 12.9 2.6 100 mM L16-1314 Pass 0.00 6.4 98 2.3 3.0 0.7 9.7 11.5 1.8 .sup.aReported as a change in purity relative to the starting material. The starting material (no incubation) contains 98.8% native peak by SE-UPLC and 50.3% main peak by CEX-UPLC in all formulations. Negative numbers indicate a decrease in the measured attribute and positive numbers indicate an increase.

(100) TABLE-US-00014 TABLE 14 Stability of 50 mg/mL Garetosmab Liquid Formulation in the Presence of 0.05% Polysorbate 20 or 0.05% Polysorbate 80 Incubated at 45 C. for 28 Days or 25 C. for 6 Months Formulation 50 mg/mL garetosmab, 10 mM Histidine, pH 6.3, 5% sucrose, 70 mM arginine Fill Volume 0.5 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluroTec coated 4432/50 butyl rubber stopper Turbidity % Total Change in Purity Change in Charged (Increase Protein by SE-UPLC.sup.a Variants by CEX-UPLC.sup.a Lot Color and in OD Recovered by % % % % % % Formulation Number Appearance at 405 nm) pH RP-UPLC HMW Native LMW Acidic Main Basic 45 C. 0.05% L13-883 Pass 0.01 6.4 104 2.2 2.9 0.6 7.0 10.6 3.6 Polysorbate 20, 28 days 45 C. 0.05% L13-884 Pass 0.01 6.4 104 2.1 2.7 0.6 9.5 13.6 4.1 Polysorbate 80, 28 days 25 C. 0.05% L13-883 Pass 0.01 6.4 102 0.1 0.4 0.3 2.8 8.2 5.4 Polysorbate 20, 6 months 25 C. 0.05% L13-884 Pass 0.01 6.4 103 0.2 0.1 0.1 3.7 10.2 6.5 Polysorbate 80, 6 months .sup.aReported as a change in purity relative to the starting material. The starting material (no incubation) contains 98.9% native peak by SE-UPLC and 55.5% main peak by CEX-UPLC in all formulations. Negative numbers indicate a decrease in the measured attribute and positive numbers indicate an increase.

(101) TABLE-US-00015 TABLE 15 Effect of Polysorbate 20 Concentration on the Stability of 50 mg/mL Garetosmab After Agitation for 30 Minutes Formulation 50 mg/mL garetosmab, 10 mM histidine, pH 6.3, x % polysorbate 20 Fill Volume 0.5 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluroTec coated 4432/ 50 butyl rubber stopper % Total Change in Purity Change in Charged Variants Turbidity Protein by SE-UPLC.sup.a by CEX-UPLC.sup.a Polysorbate 20 Lot Color and (Increase in OD Recovered by % % % % % % concentration Number Appearance at 405 nm) pH RP-UPLC HMW Native LMW Acidic Main Basic 0.025% L16-1302 Pass 0.00 6.3 100 0.0 0.0 0.0 0.0 0.4 0.5 0.05% L16-1303 Pass 0.00 6.3 100 0.0 0.1 0.0 0.1 0.2 0.3 0.075% L16-1304 Pass 0.00 6.3 100 0.0 0.0 0.0 0.1 0.2 0.3 0.1% L16-1305 Pass 0.00 6.4 100 0.0 0.1 0.1 0.0 0.0 0.0 .sup.aReported as a change in purity relative to the starting material. The starting material (no incubation) contains 98.8% native peak by SE-UPLC and 50.1% main peak by CEX-UPLC in all formulations. Negative numbers indicate a decrease in the measured attribute and positive numbers indicate an increase.

(102) TABLE-US-00016 TABLE 16 Effect of Polysorbate 20 Concentration on the Stability of 50 mg/mL Garetosmab Incubated at 45 C. for 28 Days Formulation 50 mg/mL garetosmab, 10 mM histidine, pH 6.3, x % polysorbate 20 Fill Volume 0.5 mL Container/Closure 2 mL Type 1 borosilicate glass vial with a FluroTec coated 4432/ 50 butyl rubber stopper % Total Change in Purity Change in Charged Variants Turbidity Protein by SE-UPLC.sup.a by CEX-UPLC.sup.a Polysorbate 20 Lot Color and (Increase in OD Recovered by % % % % % % concentration Number Appearance at 405 nm) pH RP-UPLC HMW Native LMW Acidic Main Basic 0.025% L16-1302 Pass 0.01 6.4 103 3.2 3.8 0.6 13.7 14.7 1.0 0.05% L16-1303 Pass 0.01 6.4 104 3.1 3.7 0.6 13.5 13.9 0.4 0.075% L16-1304 Pass 0.01 6.4 103 3.1 3.6 0.6 13.2 13.7 0.4 0.1% L16-1305 Pass 0.01 6.4 103 3.1 3.7 0.6 13.6 15.8 2.2 .sup.aReported as a change in purity relative to the starting material. The starting material (no incubation) contains 98.8% native peak by SE-UPLC and 50.1% main peak by CEX-UPLC in all formulations. Negative numbers indicate a decrease in the measured attribute and positive numbers indicate an increase.

Example 3: Stability Studies

(103) The suitability of the garetosmab liquid formulation developed and intended for late-stage clinical and commercial use was confirmed with long-term, accelerated and stress stability studies. In addition, the robustness of the commercial formulation was confirmed using a Design-Of-Experiment (DOE) approach.

(104) Studies were initiated to evaluate the storage, accelerated and stress stability of a research lot of garetosmab DP. The FDS lot used for these studies is representative of the FDS manufactured for clinical use. The DP configuration used in these studies was identical to the DP configuration used in Phase 2 clinical studies and was produced by filling 5.5 mL of FDS into 10 mL Type 1 glass vials.

(105) Research Storage, Accelerated and Stress Stability for Garetosmab Drug Product

(106) Garetosmab DP was physically and chemically stable when stored at 2-8 C. for at least 12 months, 18 months or 24 months (

(107) Table). No appreciable changes were detected in any of the monitored attributes. Results from the analysis of the garetosmab DP after incubation under stress and accelerated temperature conditions are provided in Table. After incubation for 56 days at 40 C./75% RH, some formation of HMW species, LMW species and charge variants (increased relative percentage of acidic species (Region 1)) were detected. Following incubation at 25 C./60% RH for 6 months, no increase in HMW species was observed by SE-UPLC, but some increases in acidic species (Region 1) were observed by CEX-UPLC and icIEF. Furthermore, small increases in LMW species were observed by non-reduced and reduced MCE, respectively, after incubation for 6 months at 25 C./60% RH. No meaningful changes in any of the other monitored attributes were observed. The liquid DP will be exposed to room temperature conditions for only short periods of time. Temperatures above room temperature will be avoided.

(108) Results from the analysis of the garetosmab DP after being subjected to agitation or multiple cycles of freezing and thawing are shown in Table. No meaningful changes in any of the monitored attributes were observed when garetosmab DP was subjected to 120 minutes of agitation or 8 cycles of freezing and thawing. The results of this research stability study confirmed that the garetosmab formulation developed for commercial use is suitable and provides a stable drug product.

(109) TABLE-US-00017 TABLE 17 Research Stability of Garetosmab Liquid Drug Product Stored at 2-8 C. Formulation 60 mg/mL garetosmab, 10 mM histidine, pH 6.3, 70 mM arginine-HCl, 5% sucrose, 0.05% polysorbate 20 Fill Volume 5.5 mL Container/Closure 10 mL Type 1 borosilicate glass vials with a West S10- F451W 4432/50 GRY B2-40 stopper Length of Storage at 2-8 C. (months) Assay 0 1 2 3 6 9 12 18 24 Color and Appearance Pass Pass Pass Pass Pass Pass Pass Pass Pass Turbidity 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 (Increase in OD at 405 nm) pH 6.3 6.3 6.3 6.4 6.3 6.3 6.4 6.3 6.4 Particulate 10 m 33 NR NR NR 11 NR 61 28 28 Analysis by 25 m 0 NR NR NR 0 NR 0 0 0 HIAC (particles per container) Particulate 2 to 10 m 59 NR NR NR 940 NR 2303 1664 2934 Analysis by 10 m 5 NR NR NR 12 NR 9 4 3 MFI 25 m 1 NR NR NR 3 NR 3 2 2 (particles per mL) % Total Protein Recovered by 100 101 106 101 101 96 100 98 100 RP-UPLC Non- % Main Peak 96.6 NR NR NR 96.1 NR 96.7 96.1 96.5 reduced Purity MCE % LMW Species 3.0 NR NR NR 3.4 NR 3.2 3.5 3.1 % HMW Species 0.5 NR NR NR 0.5 NR 0.2 0.5 0.4 Reduced % Purity 94.7 NR NR NR 94.6 NR 95.0 94.2 94.5 MCE % LMW Species 1.9 NR NR NR 2.1 NR 1.8 2.5 2.0 % NGHC 1.5 NR NR NR 1.5 NR 1.5 1.7 1.5 Purity by % HMW species 0.8 0.7 0.7 0.7 0.7 0.7 0.7 0.7 0.7 SE-UPLC % Main peak 98.7 98.6 98.8 98.8 98.2 98.6 98.4 98.1 98.1 purity % LMW species 0.5 0.7 0.5 0.5 1.1 0.7 0.9 1.2 1.2 Charge % Region 1 24.1 24.2 24.1 23.7 24.4 24.6 22.4 24.4 24.6 Variant % Region 2 55.6 57.5 57.7 58.2 57.5 58.1 57.9 56.9 57.5 Analysis by % Region 3 20.3 18.3 18.2 18.2 18.1 17.4 19.7 18.7 17.9 CEX- UPLC Charge % Region 1 40.6 NR NR NR 40.9 NR 40.0 40.6 42.4 Variant % Region 2 52.8 NR NR NR 52.3 NR 52.7 52.1 51.3 Analysis by % Region 3 6.6 NR NR NR 6.9 NR 7.3 7.3 6.3 iCIEF % Relative Potency by Bioassay 111 NR NR NR 110 NR 106 95 99 CEX, cation exchange; DS, drug substance; FDG, Formulation Development group; HMW, high molecular weight; iCIEF, imaged capillary isoelectric focusing; LMW, low molecular weight; MCE, microchip capillary electrophoresis; MFI, Micro-Flow Imaging; NR, not required; OD, optical density; RP, reversed-phase; SE, size exclusion; UPLC, ultra- performance liquid chromatography

(110) TABLE-US-00018 TABLE 18 Research Stability of Garetosmab Liquid Drug Product Stored Under Accelerated Conditions Formulation 60 mg/mL garetosmab, 10 mM histidine, pH 6.3, 70 mM arginine-HC1, 5% sucrose, 0.05% polysorbate 20 Fill Volume 5.5 mL Container/Closure 10 mL Type 1 borosilicate glass vials with a West S10- F451W 4432/50 GRY B2-40 stopper No 25 C./60% RH Storage Storage (months) 40 C./75% RH Storage (days) Assay T = 0 1 2 3 6 7 14 28 56 Color and Appearance Pass Pass Pass Pass Pass Pass Pass Pass Pass Turbidity (Increase in 0.00 0.00 0.00 0.00 0.00 0.01 0.01 0.01 0.00 OD at 405 nm) pH 6.3 6.4 6.3 6.4 6.3 6.3 6.4 6.4 6.3 Particulate 10 m 33 NR NR 28 6 NR NR 6 61 Analysis by HIAC 25 m 0 NR NR 0 0 NR NR 0 0 (particles per container) Particulate 2 to 59 NR NR 774 1468 NR NR 641 308 Analysis by 10 m MFI (particles 10 m 5 NR NR 7 10 NR NR 19 9 per mL) 25 m 1 NR NR 3 1 NR NR 5 1 % Total Protein 100 102 106 101 102 101 101 101 102 Recovered by RP-UPLC Non-reduced % Main 96.6 NR NR 96.3 95.2 NR NR 95.6 93.7 MCE Peak Purity % 3.0 NR NR 3.3 4.3 NR NR 3.9 5.6 LMW Species % 0.5 NR NR 0.4 0.5 NR NR 0.6 0.7 HMW Species Reduced % 94.7 NR NR 93.4 92.3 NR NR 93.6 91.5 Purity MCE % 1.9 NR NR 2.9 4.0 NR NR 2.9 4.6 LMW Species % 1.5 NR NR 1.5 1.6 NR NR 1.6 1.7 NGHC Purity by % 0.8 0.7 0.7 0.8 0.8 0.8 0.9 1.1 1.6 SE-UPLC HMW species % 98.7 98.6 98.6 98.6 98.1 98.6 98.5 98.2 97.5 Main peak purity % 0.5 0.7 0.7 0.6 1.1 0.6 0.7 0.8 0.9 LMW species Charge % 24.1 24.4 25.2 25.8 29.6 24.3 26.1 30.6 39.1 Variant Region 1 Analysis by % 55.6 57.3 56.9 56.6 53.3 58.0 56.6 52.1 45.1 CEX-UPLC Region 2 % 20.3 18.3 17.9 17.5 17.1 17.7 17.3 17.3 15.7 Region 3 Charge % 40.6 NR NR 44.4 48.9 NR 44.4 51.6 60.0 Variant Region 1 Analysis by % 52.8 NR NR 48.1 45.2 NR 48.8 42.6 34.5 iCIEF Region 2 % 6.6 NR NR 7.6 6.0 NR 6.8 5.7 5.5 Region 3 CEX, cation exchange; DS, drug substance; FDG, Formulation Development group HMW, high molecular weight; iCIEF, imaged capillary isoelectric focusing; LMW, low molecular weight; MCE, microchip capillary electrophoresis; MFI, Micro-Flow Imaging; NR, not required; OD, optical density; RH, relative humidity; RP, reversed-phase; SE, size exclusion; UPLC, ultra- performance liquid chromatography

(111) TABLE-US-00019 TABLE 19 Research Stability of Garetosmab Liquid Drug Product to Agitation and Freezing and Thawing Stress Formulation 60 mg/mL garetosmab, 10 mM histidine, pH 6.3, 70 mM arginine-HCl, 5% sucrose, 0.05% polysorbate 20 Fill Volume 5.5 mL Container/Closure 10 mL Type 1 borosilicate glass vials with a West S10- F451W 4432/50 GRY B2-40 stopper #Freezing and Thawing No Storage Agitation by Vortex (minutes) Cycles Assay T = 0 30 60 120 4 8 Color and Appearance Pass Pass Pass Pass Pass Pass Turbidity (Increase 0.00 0.00 0.00 0.00 0.00 0.00 in OD at 405 nm) pH 6.3 6.3 6.3 6.3 6.3 6.3 Particulate 10 m 33 NR NR 66 NR 77 Analysis by 25 m 0 NR NR 11 NR 6 HIAC (particles per container) Particulate 2 to 10 m 59 NR NR 1362 NR 695 Analysis by 10 m 5 NR NR 13 NR 10 MFI (particles 25 m 1 NR NR 3 NR 3 per mL) % Total Protein 100 101 101 100 101 103 Recovered by RP-UPLC Non- % Main Peak Purity 96.6 NR NR 96.5 NR 96.7 reduced % LMW Species 3.0 NR NR 3.1 NR 2.9 MCE % HMW Species 0.5 NR NR 0.4 NR 0.5 Reduced % Purity 94.7 NR NR 94.8 NR 95.3 MCE % LMW Species 1.9 NR NR 1.9 NR 1.6 % NGHC 1.5 NR NR 1.6 NR 1.4 Purity % HMW species 0.8 0.8 0.7 0.8 0.8 0.8 by % Main peak purity 98.7 98.7 98.6 98.6 98.7 98.6 SE-UPLC % LMW species 0.5 0.6 0.6 0.6 0.6 0.6 Charge % Region 1 24.1 24.2 23.3 24.2 23.6 23.6 Variant % Region 2 55.6 55.7 56.4 55.5 58.5 58.6 Analysis by % Region 3 20.3 20.1 20.3 20.3 17.9 17.8 CEX-UPLC Charge % Region 1 40.6 NR NR 42.1 NR 40.7 Variant % Region 2 52.8 NR NR 51.2 NR 51.4 Analysis by % Region 3 6.6 NR NR 6.7 NR 7.9 iCIEF CEX, cation exchange; DS, drug substance; FDG, Formulation Development group; HMW, high molecular weight; iCIEF, imaged capillary isoelectric focusing; LMW, low molecular weight; MCE, microchip capillary electrophoresis; MFI, Micro-Flow Imaging; NR, not required; OD, optical density; RH, relative humidity; RP, reversed-phase; SE, size exclusion; UPLC, ultra- performance liquid chromatography
Conclusions

(112) The results from the long-term storage, accelerated, and stress stability studies of the garetosmab DP support the clinical use of this product. garetosmab DP can withstand short exposures to room temperature without compromising physical or chemical stability. Garetosmab DP will be stored at 2 C. to 8 C. and exposure to temperatures greater than 2 C. to 8 C. will be limited.

Example 4: Robustness Studies

(113) Normal variation in the composition of garetosmab DP may occur during manufacturing, including variations in the concentration of garetosmab, the concentration of the excipients (histidine, arginine, sucrose, or polysorbate 20), and/or the pH of the formulation. Because variations in any of these formulation factors could potentially impact the stability or quality of the DP, formulation robustness studies were conducted to assess the impact of such variations, within defined ranges.

(114) Two DOE studies were used to evaluate the effect of each individual formulation factor as well as the influence of interactions between factors on the formulation stability:

(115) Preliminary robustness study-DOE study with accelerated and stress stability assessment to identify the key formulation factors that may impact garetosmab DP stability.

(116) Final robustness studya comprehensive DOE study evaluating the key formulation factors identified from the preliminary robustness study, with stress, accelerated, and long-term shelf-life stability to evaluate garetosmab formulation robustness.

(117) The nominal composition of the garetosmab commercial formulation consists of 60 mg/mL Garetosmab, 10 mM histidine, 5% (w/v) sucrose, 70 mM arginine-HCl, 0.05% (w/v) polysorbate 20, at pH 6.3.

(118) The purpose of this preliminary robustness study was to examine main effects and the combined effects of several factors (interactions and quadratics) on the stability of garetosmab and identify factors that should be included in a comprehensive robustness study (main effects are the formulation factors, interactions describe interactions between two different factors, and quadratics describe interactions where a factor interacts with itself). All main effects were examined in this study. A subset of interactions and quadratics were chosen to be examined based on a risk assessment informed by prior experience with garetosmab. Based on the risk assessment a 6-factor D-optimal DOE study was developed to characterize and explore the excipient design space. A 24-run study was developed which considered main effects, and the interactions and quadratics that were defined in the risk assessment. The design was created, evaluated and confirmed in JMP12.1 to be properly powered and able to cover the design space with good estimation capability. The preliminary robustness study design is described in Table, Table, and Table.

(119) TABLE-US-00020 TABLE 20 Factors tested in the garetosmab preliminary robustness study Variation Formulation factor Target level Range tested from Target Garetosmab 60 mg/ml 54-66 mg/mL 10% Concentration Sucrose Concentration 5% 4-6% 20% Arginine Concentration 70 mM 56-84 mM 20% Histidine Concentration 10 mM 8-12 mM 20% pH 6.3 6.0-6.6 0.3 pH units Polysorbate 20 0.05% 0.025-0.075% 50% concentration

(120) TABLE-US-00021 TABLE 21 Formulations assessed in the garetosmab preliminary robustness study Formulation Protein, Histidine, Sucrose, Arginine, Polysorbate # Lot # mg/mL mM pH % (w/v) mM 20, % (w/v) F1 L18-2712 66 8 6.6 6 56 0.025 F2 L18-2713 54 8 6.6 6 84 0.075 F3 L18-2714 66 10 6.6 6 70 0.075 F4 L18-2715 54 8 6.0 4 84 0.025 F5 L18-2716 54 10 6.6 4 84 0.025 F6 L18-2717 66 8 6.0 6 84 0.075 F7 L18-2718 66 12 6.6 4 56 0.075 F8 L18-2719 66 8 6.6 4 84 0.025 F9 L18-2720 66 8 6.0 4 56 0.075 F10 L18-2721 54 12 6.3 4 84 0.025 F11 L18-2722 54 10 6.3 6 56 0.075 F12 L18-2723 66 10 6.0 4 70 0.025 F13 L18-2724 54 8 6.6 4 56 0.075 F14 L18-2725 54 12 6.6 4 70 0.075 F15 L18-2726 66 12 6.6 6 84 0.075 F16 L18-2727 54 12 6.0 6 84 0.075 F17 L18-2728 54 12 6.6 6 56 0.025 F18 L18-2729 54 12 6.0 4 56 0.075 F19 L18-2730 66 8 6.3 4 70 0.075 F20 L18-2731 66 12 6.0 4 84 0.025 F21 L18-2732 54 8 6.0 6 56 0.025 F22 L18-2733 54 8 6.0 6 70 0.025 F23 L18-2734 66 12 6.0 6 56 0.025 F24 L18-2735 66 12 6.3 6 70 0.025

(121) TABLE-US-00022 TABLE 22 Storage conditions and sampling intervals for garetosmab preliminary robustness study Incubation Temperature Sampling intervals 25 C. 1, 3, 6 months 45 C. 7, 14, 21, 28 days t = 0 0 (days)
Results

(122) In the preliminary garetosmab robustness study, the stability of garetosmab as a function of varying formulation was assessed at both 25 C. and 45 C. However, the factors chosen for the final robustness study were based on the rates of degradation determined at 45 C. only. If the rate of change of a response had p0.05 for a specific factor (including main effects, interactions and quadratics), that factor was considered statistically significant and would be considered for the final robustness study. Table shows a summary of the results of the DOE analysis indicating the statistically significant responses and associated terms. The responses considered in the DOE analysis were the rate of change per day in HMW, LMW, and monomer by SE-UPLC, and the rate of change per day in acidic species, main peak, and basic species by CEX-UPLC and icIEF. Other responses, including visual appearance, turbidity by OD 405 nm, pH, protein concentration (recovery) and sub-visible particles by MFI, were measured but were considered pass/fail or for information and not used in the DOE analysis.

(123) TABLE-US-00023 TABLE 23 Statistically significant responses, associated factors, rates and P-values. Impact to the rate Response Term per day.sup.a p-value.sup.b Acidic rate 45 C. per day pH 0.116 0.000 Main rate 45 C. per day pH 0.079 0.000 Basic rate 45 C. per day pH 0.037 0.000 icIEF basic 45 C. per day pH 0.025 0.002 Acidic rate 45 C. per day Histidine*pH 0.015 0.003 Monomer rate 45 C. per day Sucrose 0.005 0.003 HMW rate 45 C. per day garetosmab 0.004 0.004 HMW rate 45 C. per day Sucrose 0.004 0.004 Monomer rate 45 C. per day garetosmab 0.004 0.004 HMW rate 45 C. per day pH 0.004 0.004 Monomer rate 45 C. per day pH 0.004 0.009 Acidic rate 45 C. per day garetosmab*pH 0.010 0.011 icIEF acidic 45 C. per day pH 0.055 0.018 icIEF basic 45 C. per day Histidine*Histidine 0.033 0.025 Acidic rate 45 C. per day Arginine 0.008 0.031 Monomer rate 45 C. per day Arginine 0.003 0.037 icIEF basic 45 C. per day Arginine*Arginine 0.026 0.041 Highlighted in bold are the statistically significant, non-main effect terms based on stress stability testing at 45 C. .sup.aRates are derived from scaled estimates reported in JMP. The reported rates are 2-times the scaled estimates, as the scaled estimates are half-estimates. .sup.bp-values 0.05 are considered significant in this study.

(124) Results of visual inspection, turbidity by OD 405 nm, pH, protein recovery and sub-visible particles by MFI were: all samples passed visual inspection; no meaningful increases in OD 405 nm were observed for any sample; no changes in protein concentrations were observed. All concentration measurements were within 5% of the t=0 values; and some fluctuations in particle concentrations by MFI were observed as well as some increasing trends. Some trends were statistically significant but those that were significant were not practically meaningful.

(125) Conclusions

(126) The results of the DOE analysis indicated that the following non-main effect factors had a statistically significant effect on garetosmab stability under thermal stress conditions (incubation at 45 C. for 28 days). [Histidine]*pH [garetosmab]*pH [Histidine]*[Histidine] [Arginine]*[Arginine] These interactions and quadratics were included in the final robustness study along with all main effects. A detailed summary of the preliminary robustness study including data from incubation at 45 C. and 25 C. is discussed in report EXP-9 Jul. 2019-0096 garetosmab Pre-PAR Study. Garetosmab final robustness study design

(127) The formulation factor ranges tested in this study were defined to be wider than or equal to the ranges that were anticipated to occur if one considers both contributions from manufacturing variability and assay variability. The formulation parameters in this robustness study include garetosmab concentration (+10% which is the specification limit), buffer and stabilizer concentrations (+20%), surfactant concentration (+50%), and pH (+0.3 units which is the specification limit) (Table).

(128) To evaluate the impact of the key formulation factors identified from the preliminary robustness study on the storage and stress stability of the garetosmab formulation, a 6-factor D-optimal DOE design was executed to characterize and explore the excipient design space. A 14-run study (Table) was designed which considered all main effects, and the secondary interactions and quadratics identified as statistically significant in the preliminary robustness study. The design was created, evaluated and confirmed in JMP12.1 to be sufficiently powered and able to cover the design space with good estimation capability. In addition to the test formulations, one formulation with all factors at the nominal levels was included as a control but excluded from the DOE analysis. 10 mL type 1 glass vials were filled with 5.5 mL of formulation, which is representative of the commercial DP presentation. Each formulation was assessed for long-term storage stability at 2 C. to 8 C., accelerated stability at 25 C./60% RH and stress conditions; 40 C./75% RH, and agitation and freezing and thawing stress (storage and stress conditions are summarized in Table 26: Analysis Plan for garetosmab

(129) TABLE-US-00024 Assay Time Points Purpose Visual appearance All Color change, precipitation, particles Turbidity, Precipitation OD @ 405 nm pH pH changes RP-HPLC Protein concentration and recovery SE-HPLC Chemical stability, high and low MW species CEX-HPLC Chemical stability, charge variants, deamidation icIEF 0, 3, 6, 12, Chemical stability, charge 18, 24, 36, variants, deamidation 48 and 60 month 5 C. MCE-SDS 120 minutes Chemical stability, high and low (R and NR) agitation MW species MFI 8 freeze/thaw Particles HIAC 1, 2 months Particles 40 C./75% RH 3, 6 months 25 C./60% RH CAD-UPLC 0, 3, 6, 12, Polysorbate 20 Concentration 24, 36, 48 Bio-Assay and 60 month Potency/Biological activity). 5 C.

(130) All formulations were characterized and assessed for physical and chemical properties and stability, including visual inspection, pH, turbidity, protein concentration and recovery, purity with respect to molecular weight forms (assessed by SE-UPLC and microchip capillary electrophoresis (MCE)), and charge variants (assessed by CEX-UPLC and image capillary iso-electric focusing (icIEF)), and subvisible particulate analysis (assessed by light obscuration (HIAC) and MFI), as summarized in Table 26.

(131) TABLE-US-00025 TABLE 24 Formulations assessed in the garetosmab final robustness study Protein, Histidine, Sucrose, Arginine, Polysorbate Formulation # Lot # mg/mL mM pH % (w/y) mM 20, % (w/v) F1 L18-3972 66 8 6 4 56 0.025 F2 L18-3973 54 12 6 6 56 0.025 F3 L18-3974 66 8 6.6 6 70 0.075 F4 L18-3975 66 10 6 6 84 0.075 F5 L18-3976 54 8 6.6 4 84 0.025 F6 L18-3977 66 12 6 4 56 0.075 F7 L18-3978 54 10 6 4 70 0.025 F8 L18-3979 54 10 6.6 6 56 0.025 F9 L18-3980 54 12 6.6 4 70 0.075 F10 L18-3981 54 8 6 6 56 0.075 F11 L18-3982 66 8 6 6 70 0.025 F12 L18-3983 66 10 6.6 4 56 0.075 F13 L18-3984 54 8 6 4 84 0.075 F14 L18-3985 66 12 6.6 6 84 0.025 F15.sup.a L18-3986 60 10 6.3 5 70 0.050 .sup.aFormulation 15 was a control formulation where all components were included at the nominal levels of the commercial formulation. This formulation was not included in any of the DOE analyses but was used as a relative measure of the stability of the test formulations.

(132) TABLE-US-00026 TABLE 25 Storage conditions and sampling intervals for garetosmab final robustness study Storage/Stress Conditions Sampling Intervals Agitation (vortex) 30, 60 and 120 minutes Freeze/Thaw (30 C.) 4 and 8 5 C. 1, 3, 6, 9, 12, 18, 24, 36, 48, 60 months 25 C./60% RH 1, 2, 3, 6 months 40 C./75% RH 0.5, 1 and 2 months T = 0 0 (days)

(133) TABLE-US-00027 TABLE 26 Analysis Plan for garetosmab Assay Time Points Purpose Visual appearance All Color change, precipitation, particles Turbidity, Precipitation OD @ 405 nm pH pH changes RP-HPLC Protein concentration and recovery SE-HPLC Chemical stability, high and low MW species CEX-HPLC Chemical stability, charge variants, deamidation icIEF 0, 3, 6, 12, Chemical stability, charge 18, 24, 36, variants, deamidation 48 and 60 month 5 C. MCE-SDS Chemical stability, high and (R and NR) low MW species MFI 120 minutes Particles agitation HIAC 8 freeze/thaw Particles 1, 2 months 40 C./75% RH 3, 6 months 25 C./60% RH CAD-UPLC 0, 3, 6, 12, Polysorbate 20 Concentration 24, 36, 48 Bio-Assay and 60 month Potency/Biological activity 5 C.
Results (Stress temperature 40 C./75% RH)

(134) Garetosmab samples in the formulations listed in Table 24 were incubated at 40 C./75% RH for 2 months. The responses that were considered most important for the DOE analysis were formation of molecular weight variants by SE-UPLC and MCE, and formation of charge variants by CEX-UPLC and icIEF. Additional factors including visual inspection, pH, turbidity, protein concentration and recovery, and particulate levels were measured but were considered pass/fail or for information and not used in the DOE analysis. The factors that led to statistically significant changes in the measured responses are listed in Table. Although several factors had statistically significant impacts to the responses, the effects were small, resulting in relatively small changes in response to variations in the factors under this stress condition. The factor that had the largest effect was pH on the rate of charge variant formation by CEX-UPLC. Although statistically significant, the effect was small. The rate of formation of acidic species varied by 3.8% per month when the pH varied from 6.0-6.6. Overall, under the stress condition tested, the variations in the formulation had little impact to the stability of garetosmab. The variation in the rates is illustrated in FIG. 2. In all cases the spread relative to the control is not meaningful with respect to the overall stability of the formulation.

(135) TABLE-US-00028 TABLE 27 Statistically significant responses from the final robustness study for garetosmab formulations incubated at 40 C./75% RH for 2 months. Impact to the rate Response.sup.a Factor per month.sup.b p-value.sup.c HMW garetosmab 0.058 0.0011 HMW pH 0.052 0.0022 HMW Sucrose 0.040 0.0081 HMW Polysorbate 20 0.028 0.0357 Acidic CEX pH 3.771 <0.0001 Acidic CEX Arginine 0.459 0.0230 Acidic CEX Histidine*pH 0.850 0.0008 Main Peak CEX pH 2.492 <0.0001 Basic CEX pH 1.250 <.0001 Basic CEX Histidine*pH 0.654 0.0145 Acidic icIEF pH 2.334 <0.0001 Acidic icIEF Histidine*pH 1.146 0.0042 Main Peak icIEF garetosmab 0.476 0.0374 Main Peak icIEF pH 1.804 <0.0001 Main Peak icIEF Histidine*pH 0.783 0.0102 Basic icIEF garetosmab 0.244 0.0429 Basic icIEF pH 0.524 0.0014 Basic icIEF Arginine 0.311 0.0376 Basic icIEF Histidine*pH 0.344 0.0251 Purity reduced MCE garetosmab 0.333 0.0245 Purity reduced MCE pH 0.369 0.0159 Purity reduced MCE Sucrose 0.379 0.0137 LMW reduced MCE garetosmab 0.246 0.0465 LMW reduced MCE pH 0.343 0.0108 .sup.aReported as rate of formation or loss of the species monitored. .sup.bRates are derived from scaled estimates reported in JMP. The reported rates are 2-times the scaled estimates, as the scaled estimates are half-estimates. .sup.cp-values 0.05 were considered statistically significant.
Results (accelerated temperature 25 C./60% RH)

(136) Garetosmab samples in the formulations listed in Table were incubated at 25 C./60% RH for up to 6 months. The responses that were considered most important for the DOE analysis were formation of molecular weight variants by SE-UPLC and MCE, and formation of charge variants by CEX-UPLC and icIEF. Additional factors including visual inspection, pH, turbidity, protein concentration and recovery, and particulate levels were measured but were considered pass/fail or for information and not used in the DOE analysis. The factors that led to significant changes in the measured responses are listed in Table. Although several factors had statistically significant impacts to the responses, the effects were small, resulting in less than a 1% variation in the rate per month due to varying the factors, under this accelerated condition. Under the accelerated condition tested, the variations in the formulation had little impact to the stability of garetosmab. The variation in the rates is illustrated in FIG. In all cases the spread relative to the control is not meaningful with respect to the overall stability of the formulation.

(137) TABLE-US-00029 TABLE 28 Statistically significant responses from the final robustness study for garetosmab formulations incubated at 25 C./60% RH for 6 months. Impact to the rate Response.sup.a Factor per month.sup.b p-value.sup.c HMW garetosmab 0.007 0.0011 HMW pH 0.004 0.0212 HMW Sucrose 0.005 0.0067 Acidic CEX Histidine 0.089 0.0415 Acidic CEX pH 0.730 <0.0001 Acidic CEX Histidine*pH 0.120 0.0103 Main Peak CEX pH 0.526 <0.0001 Basic CEX Histidine 0.040 0.0272 Basic CEX pH 0.210 <0.0001 Basic CEX Histidine*pH 0.052 0.0096 Acidic icIEF Histidine 0.198 0.0267 Acidic icIEF pH 0.577 <0.0001 Acidic icIEF garetosmab*pH 0.162 0.0283 Acidic icIEF Histidine*pH 0.404 0.0007 Main Peak icIEF Histidine 0.169 0.0255 Main Peak icIEF pH 0.446 <0.0001 Main Peak icIEF garetosmab*pH 0.121 0.0458 Main Peak icIEF Histidine*pH 0.247 0.0044 Basic icIEF pH 0.139 0.0064 Basic icIEF Histidine*pH 0.157 0.0079 Purity reduced MCE pH 0.092 0.0142 Purity reduced MCE garetosmab*pH 0.080 0.0298 LMW reduced MCE garetosmab 0.042 0.0191 LMW reduced MCE pH 0.067 0.0034 LMW reduced MCE garetosmab*pH 0.042 0.0191 LMW reduced MCE Histidine*pH 0.081 0.0029 LMW reduced MCE Histidine*Histidine 0.106 0.0112 LMW non-reduced MCE Histidine*Histidine 0.142 0.0396 LMW non-reduced MCE Arginine*Arginine 0.153 0.0313 .sup.aReported as rate of formation or loss of the species monitored. .sup.bRates are derived from scaled estimates reported in JMP. The reported rates are 2-times the scaled estimates, as the scaled estimates are half-estimates. .sup.cp-values 0.05 were considered statistically significant.
Results (Stress Conditions Agitation and Freezing and Thawing)

(138) The stability of the garetosmab formulations listed in Table 24 were assessed after 4 or 8 cycles of freezing and thawing, or after 30, 60 or 120 minutes of agitation by vortexing. The quality attributes assessed were formation of molecular weight variants by SE-UPLC and MCE, formation of charge variants by CEX-UPLC and icIEF, visual inspection, pH, turbidity, protein concentration and recovery, and particulate levels. FIG. and FIG. show summaries of the impacts of varying the components of the formulation, in accordance with the DOE design, relative to the control formulation where all components of the formulation were nominal, after 8 cycles of freezing and thawing or 120 minutes of agitation by vortexing (indicated on the graphs as delta control). These results indicate that varying the formulation composition has no meaningful impact to the stability of garetosmab, relative to the control formulation, under the stress conditions employed.

(139) Results (Long-Term Storage Temperature 2-8 C.)

(140) Garetosmab samples, prepared in accordance with the DOE design, in the formulations listed in Table 24 were stored at 2-8 C. Currently, 24 months of long-term stability data for the garetosmab robustness study are available. The effects of varying garetosmab concentration, pH, histidine concentration, arginine concentration, sucrose concentration and polysorbate 20 concentration on the long-term stability of garetosmab were examined. The quality attributes assessed were formation of molecular weight variants by SE-UPLC and MCE, formation of charge variants by CEX-UPLC and icIEF, visual inspection, pH, turbidity, protein concentration and recovery, and particulate levels. FIG.-7 show a summary of the impact of varying the components of the formulation, in accordance with the DOE design, relative to the control formulation where all components of the formulation were nominal. These results indicate that after 12 or 24 months of storage at 5 C., varying the formulations within the ranges tested resulted in no meaningful impact to the stability or quality of garetosmab. No precipitate or visible particulate was detected by either visual inspection or turbidity measurements (OD at 405 nm). No meaningful changes in protein recovery were observed (RP-UPLC). The pH of the formulations was stable. No appreciable increases in subvisible particulates were observed by HIAC, and no appreciable differences were observed in the subvisible particulate counts relative to the control formulation: for subvisible particulates measured by HIAC, all values were below the acceptable limits set by USP <788>; subvisible particles were also measured by MFI. Particle counts were variable but no meaningful changes in subvisible particles were observed relative to the control or between formulations for 10 m or 25 m particles. A trend of increasing 2-10 m particle counts is observed with time, but the differences are not considered appreciable.

(141) Statistical analysis of the results indicate that the differences among the formulations is primarily due to random variation and not due to variation in the factors (FIGS. 6-7); relative to the control formulation, no meaningful differences were observed in the levels of HMW species, LMW species or Native garetosmab as determined by SE-UPLC or MCE; and relative to the control formulation, no meaningful differences were observed in the levels of acidic or basic charge variants as determined by CEX-UPLC or icIEF.

(142) The results from this study demonstrated that varying the formulation factors (garctosmab concentration, pH, histidine concentration, arginine concentration, sucrose concentration and polysorbate 20 concentration) within the studied ranges have no appreciable impact on the garetosmab long-term stability. The 60 mg/mL garetosmab formulation is robust with respect to all the quality attributes within the tested formulation composition range. Garetosmab Formulation Robustness Summary

(143) Formulation robustness studies were conducted to evaluate the effect of variations in formulation parameters on the garetosmab formulation stability. A DOE study that evaluated long-term storage, accelerated and stress stability demonstrated that variation in the formulation parameters, within the range studied, did not appreciably affect garctosmab quality and stability.

(144) Specifically, the 60 mg/mL proposed commercial garetosmab formulation is robust against a 10% variation in protein concentration, a 20% variation in sucrose, arginine and/or histidine concentration, a 50% variation in polysorbate 20 concentration, and/or a 0.3 pH unit variation. Overall, the results from the 60 mg/mL garetosmab robustness study support that the variation in the composition of the garetosmab formulation within the ranges studied will not adversely impact the stability or quality of the garetosmab DP under the recommended storage conditions (2-8 C.).

(145) Conclusions

(146) Based on the results from the formulation development studies that were presented, as well as the clinical experience, the commercial garetosmab formulation for IV infusion was developed, which contains the following components: 60 mg/mL Garetosmab, 10 mM L-histidine, 5% (w/v) sucrose, 70 mM L-arginine HCl, 0.05% (w/v) polysorbate 20 and pH 6.3. This commercial IV formulation meets the goals defined for formulation development. The developed formulation is a liquid formulation in glass vials with a concentration of garetosmab sufficient to deliver a dose of 10 mg/kg garetosmab by intravenous (IV) infusion. The garetosmab DP is 60 mg/mL and is manufactured with a 5 mL withdrawable volume providing 300 mg per vial. The formulation is a near iso-osmolar formulation that is compatible with 0.9% Sodium Chloride Injection or 5% Dextrose Injection for IV infusion. The formulation is compatible with and stable in type 1 clear glass vials and standard serum stopper as the primary packaging system. The formulation is a sterile DP that supports long-term stability with a shelf-life of 24 months or longer at 2-8 C. No meaningful changes were observed in any garetosmab quality attributes when stored at 2-8 C. for up to 12 months, 18 months or 24 months. The formulation is a robust formulation that minimizes formation of garetosmab high molecular weight (HMW) species, minimizes changes in the relative distribution of garetosmab charge variant species, maintains subvisible particles at a safe level, and maintains the biological activity when subjected to handling and thermal stresses. The formulation is a formulation that is easily converted for use in subcutaneous (SC) administration. The garetosmab formulated drug substance is 200 mg/mL.

Example 5: Overages

(147) There are no overages included in the formula; however, a slight overfill was included to compensate for the normal variations in fill volume encountered during an automated fill finish process and to ensure that the correct volume can be withdrawn from the vial. Clinical DP was manufactured with a 5.44 mL minimum fill volume. An overfill of 0.44 mL was contained in each vial, which is sufficient for an accurate withdrawal of 5.0 mL (300 mg) of DP from the vial.

(148) The overage was not designed to compensate for losses during manufacture, degradation during manufacture, degradation during storage (shelf life), or to extend the expiration dating period. These overages were intended to enable the accurate withdrawal and administration of 5.0 mL DP (e.g., 300 mg of garetosmab).

Example 6: Methods Used To Assess Stability

(149) The research stability of garetosmab DP was assessed using different assays. Color and appearance were assessed by visual inspection. Turbidity measured by increase in optical density (OD) at 405 nm. Particulate matter analysis was determined by light obscuration (HIAC). Particulate matter analysis was assessed by Micro-Flow Imaging (MFI). Protein concentration was assessed by reversed-phase ultra-performance liquid chromatography (RP-UPLC). Purity of each individual DP was assessed by using the following assays: size-exclusion ultra-performance liquid chromatography (SE-UPLC); reduced and non-reduced microchip capillary electrophoresis (MCE).

(150) Charge variant analysis was determined using the following assays: Cation exchange UPLC (CEX-UPLC); and imaged capillary isoelectric focusing (iCIEF). Charge variants are reported as percent Region 1, Region 2, and Region 3. Region 1 corresponds to acidic species which elute before the Main Peak, Region 2 corresponds to the Main Peak, and Region 3 corresponds to basic species which elute after the Main Peak.

(151) The Potency was assessed by use of a bioassay. The relative potency of each sample was determined by bioassay and is defined as: (IC50 reference sample/IC50 test sample)100%. The measured potency of storage stability samples must be within 50-150% of the measured potency of the reference standard.

(152) TABLE-US-00030 INFORMALSEQUENCELISTING SEQIDNO.:1 GGSFSSHF SEQIDNO.:2 ILYTGGT SEQIDNO.:3 ARARSGITFTGIIVPGSFDI SEQIDNO.:4 QSVSSSY SEQIDNO.:5 GAS SEQIDNO.:6 QQYGSSPWT SEQIDNO:7 QVQLQESGPGLVKPSETLSLTCTVSGGSFSSHFWSWIRQP PGKGLEWIGYILYTGGTSFNPSLKSRVSMSVGTSKNQFSL KLSSVTAADTAVYYCARARSGITFTGIIVPGSFDIWGQGT MVTVSS SEQIDNO:8 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQK PGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGSSPWTFGQGTKVEIK