STRUCTURE-BASED PEPTIDE INHIBITORS OF ALPHA-SYNUCLEIN AGGREGATION
20230069905 · 2023-03-09
Assignee
Inventors
- David S. Eisenberg (Los Angeles, CA)
- Smriti Sangwan (Los Angeles, CA, US)
- Lin Jiang (Santa Monica, CA, US)
Cpc classification
C07K7/02
CHEMISTRY; METALLURGY
G01N2800/2835
PHYSICS
C07K2319/10
CHEMISTRY; METALLURGY
C07K14/4711
CHEMISTRY; METALLURGY
International classification
C07K7/02
CHEMISTRY; METALLURGY
Abstract
This invention relates to inhibitory peptides which bind to α-synuclein molecules and inhibit α-synuclein amyloidogenic aggregation, α-synuclein cytotoxicity, and spread of α-synuclein. Methods of making and using the inhibitory peptides (e.g. to treat subjects having conditions or diseases that are mediated by α-synuclein, such as Parkinson's disease, dementia with Lewy bodies, or MSA) are described.
Claims
1. A composition of matter comprising at least one inhibitory peptide that inhibits α-synuclein (SEQ ID NO: 1) aggregation by binding to residues 68-78 of α-synuclein; wherein: (a) the inhibitory peptide comprises the sequence: GAVVWGVTAVKK (SEQ ID NO: 3); or RAVVTGVTAVAE (SEQ ID NO: 4); and at least one of the amino acids in the inhibitory peptide comprises a non-naturally occurring amino acid; and/or the inhibitory peptide is coupled to a heterologous peptide tag.
2. The composition of claim 1, wherein the inhibitory peptide comprises the sequence: TABLE-US-00007 (SEQ ID NO: 5) GAVVWGVTAVKKKKK; (SEQ ID NO: 6) GAVVWGVTAVKKGRKKRRQRRRPQ; or (SEQ ID NO: 7) YGRKKRRQRRRAVVTGVTAVAE.
3. The composition of claim 1, wherein the non-naturally occurring amino acid comprises at least one of: a D-amino acid; or an amino acid comprising a N-methyl group moiety.
4. The composition of claim 1, wherein the heterologous peptide tag comprises: an amino acid sequence that increases peptide solubility; an amino acid sequence that facilitates monitoring of the peptide; and/or an amino acid sequence that facilitates peptide entry into a mammalian cell.
5. The composition of claim 4, wherein the heterologous peptide tag comprises: a plurality of arginine residues; a plurality of lysine amino acids; and/or an amino acid sequence TAT.
6. The composition of claim 1, wherein the inhibitory peptide is from 6 to 30 amino acids in length.
7. The composition of claim 1, wherein the composition comprises a plurality of inhibitory peptides.
8. A pharmaceutical composition comprising a peptide of claim 1, and a pharmaceutically acceptable carrier including a peptide stabilizing excipient.
9. A complex comprising α-synuclein and a peptide composition of claim 1.
10-20. (canceled)
Description
DESCRIPTION OF THE DRAWINGS
[0015] The patent or application file contains at least one drawing executed in color.
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
DETAILED DESCRIPTION OF THE INVENTION
[0023] Unless otherwise defined, all terms of art, notations and other scientific terms or terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art. Many of the techniques and procedures described or referenced herein are well understood and commonly employed using conventional methodology by those skilled in the art. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes. In the description of the preferred embodiment, reference may be made to the accompanying drawings which form a part hereof, and in which is shown by way of illustration a specific embodiment in which the invention may be practiced. It is to be understood that other embodiments may be utilized and structural changes may be made without departing from the scope of the present invention.
[0024] α-synuclein, a 140 amino acid protein is found in amyloid deposits in neuronal cells in disease conditions. A causative link between α-syn amyloid formation and disease progression is supported by the findings that gene duplications and familial mutations that increase amyloid load also cause early-onset PD, and more than 90% sporadic PD patients stain positive for α-syn deposits. The invention disclosed herein provides a structure-based approach to halt α-syn aggregation. We hypothesized that the atomic structures of NACore and PreNAC are preserved in α-syn amyloid seeds and recruit the endogenous protein into a zipper conformation. Using the atomic structure of NACore, we developed inhibitors that hinder fibril formation and tested their efficacy in vitro and in cell culture. The same procedure can be used to develop inhibitors based on PreNAC. The inhibitors are optimized to cap the ends of the fibril, preventing further addition of monomers. We used the software Rosetta to design peptide sequences that interact favorably with the NACore segment. The energy function used by Rosetta takes into account electrostatic interactions, hydrogen bonding, Van der Waal s forces, among other terms to assess binding energy. Once a specific residue has been shown to produce favorable binding in a certain position of the designed peptide, it can be fixed and prevented from further design, while the rest of the sequence is further refined. We performed this process of fixing and redesign iteratively until an optimal set of sequences was identified. This rational design process allowed for computationally sampling of orders of magnitude more inhibitor sequences than what was experimentally feasible to test.
[0025] We carried out screens for crystals of peptide segments within the NAC domain and adjacent regions, seeking structural information on the molecular basis of aggregation and toxicity of α-syn. Using the ZipperDB algorithm .sup.55, crystallizable amyloid-forming segments in the NAC domain were identified. In particular, we identified and concentrated on a central segment of α-syn, residues 68-78, which is referred to herein as NACore because of its important role in both the aggregation and cytotoxicity of α-syn, NACore is the fibril-forming core of the 35 residue NAC (Non Amyloid-β Component) domain (residues 61-95) of full, 140 residue α-synuclein. In some studies, we utilized a sub-fragment of NACore, comprised of residues 69-77. In other studies we crystallized and determined the structure of residues 47-56 of α-synuclein termed PreNAC which forms another steric zipper. The identified segments were chemically synthesized and crystallized and their three-dimensional structures were determined by micro-crystallography and micro-electron diffraction (MicroED).
[0026] To find the most effective inhibitors, nearly 100 different designs were tested empirically with sequential rounds of optimization on the inhibitor design. For example, we observed that the location of the tag on N or C terminus can affect its efficiency. Additionally, the type of modification added can also affect its efficacy. In our case, only a Trp substitution at Thr72 was effective whereas Arg substitution was not. Although the computational approach is not powerful enough to identify one successful design, it can narrow our search for candidate inhibitors, which can then be refined through rational design.
[0027] The efficiency of capping inhibitors in preventing seeding was tested using a cell-based assay. In this system, transfection of nanomolar amounts of α-syn seeds caused endogenous protein aggregation. The aggregates display amyloidogenic properties—binding to amyloid-specific small molecules, faithfully transferred upon cell division and remarkable specificity (Sanders D W, et al. (2014) Neuron 82(6):1271-1288). For example, α-syn fibrils can only seed α-syn protein into aggregates. Notably, in this system we do not observe acute cell death upon formation of aggregates with only a mild slowing of cell proliferation. Our inhibitors prevented puncta formation in this system with a single administration of inhibitors effective for 2-3 days.
[0028] Seeding, in the context of amyloid disease, is the sequential transfer of pathologic protein aggregates along connected tissues. This process contributes to progression and severity of neurodegenerative diseases. To date, there are no therapeutics that specifically target seeding, in part, due to lack of information of the structural properties of pathological seeds. The present application relates, e.g., to the design, synthesis and functional characterization of peptides that bind specifically to α-synuclein (α-syn) aggregates and block, inhibit and/or diminish α-syn aggregation and/or α-syn cytotoxicity. The peptide inhibitors specifically “cap” the growing aggregates of α-synuclein. In some embodiments, the peptides are fused to cell penetrating peptides that enhance their delivery into cells.
[0029] Apart from the spontaneous aggregation of intracellular α-syn into amyloid fibrils, a second phenomenon that contributes to disease progression is the prion-like spread of α-syn aggregates (Goedert M (2015). Science 349(6248):1255555-1-1255555-9). Braak staging has shown that pathology gradually spreads over time through connected brain regions, and cell culture and animal models show that small amounts of α-syn aggregates can act as seeds and induce aggregation of the native protein (see, e.g. Braak H, et al. (2003) Neurobiol Aging 24(2):197-211; Braak et al. (2009) Adv Anat Embryol Cell Biol 201:1-119; Masuda-Suzukake M, et al. (2013) Brain 136(4):1128-1138; Desplats P, et al. (2009) Proc Natl Acad Sci USA 106(31):13010-13015; Luk K C, et al. (2009) Proc Natl Acad Sci 106(47):20051-20056). Although distinct from canonical prions that can be transmitted from person to person, this phenomenon of ‘seeding’ seems the driver of disease progression.
[0030] Patient-extracted fibrils are observed to differ in seeding capacity and display strain-like characteristics. In vitro the PD patient extracted fibrils caused dramatic increase in α-syn aggregation, and in cell culture model the seeded samples increased puncta formation. Notably, unlike previous reports where patient derived α-syn filaments seeds in cell culture, in our assays we did not observe seeding in cell culture (Prusiner S B, et al. (2015) Proc Natl Acad Sci 112(38):E5308-E5317; and Woerman A L, et al. (2015) Proc Natl Acad Sci 112(35):E4949-E4958). Previous reports utilized substantia nigra tissues whereas we used frontal and temporal tissues, which might differ in seeding potency. Indeed in previous reports, fibrils extracted from different brain regions have been shown to differ in seeding capacity reminiscent of different strains (Prusiner S B, et al. (2015) Proc Natl Acad Sci 112(38):E5308-E5317). Furthermore, the different inhibitors varied in efficiency against different seeds. For example, S61 was effective against seeds A and B only whereas S71 was effective against seeds B and D. Recently, an NMR structure of full length α-syn fibrils was reported in which the NACore segment was not found in an extended zipper conformation although the segment 68-78 is found in the core of the fibril (Tuttle Md., et al. (2016) Nat Struct Mol Biol 23(5):409-415). Or it may be that the inhibitors described therein can bind to the conformation of NACore in the NMR structure. Also it is conceivable that the NMR structure and the steric zipper structure are different polymorphs. In the absence of a diagnostic method to identify different polymorphs in human subjects, theoretically a cocktail of different inhibitors targeting different polymorphs could be useful.
[0031] We used a combination of computational methods and rational design to develop a line of inhibitors targeted at preventing the spread of α-syn aggregates. Our approach was only made possible by the determination of the atomic structure of the core of α-syn amyloid fibrils, and this approach can be adopted for other diseases where seeding plays a role in disease progression. The inhibitors prevent aggregation of α-synuclein in vitro and in cell culture models. The inhibitors also show efficacy in preventing seeding by patient-derived α-synuclein fibrils both in vitro and in cell culture models. Our results provide evidence that pathological seeds of α-syn contain steric zippers and suggest a therapeutic approach targeted at the spread and progression that may be applicable for PD and related synucleinopathies. Similarly our inhibitors may be applicable for a diagnostic approach for PD and related synucleinopathies.
[0032] We hypothesized that mutations, overexpression or other cellular factors can destabilize the native α-synuclein structure, exposing an adhesive, “steric-zipper” segment, proposed as the basic building block of amyloid aggregates .sup.18, 19. We therefore generated high-resolution views of the amyloid spines of α-synuclein aggregates. We then applied the Rosetta-based method .sup.36 to design inhibitors which specifically “cap” the growing aggregates of α-synuclein and thus disrupt and inhibit further α-synuclein aggregation, using the α-synuclein 69-77 structure or the α-synuclein 68-78 structure as a template.
[0033] We utilized the atomic structure of NACore [68-GAVVTGVTAVA-78] (SEQ ID NO: 46) as a template and using computational and structure-based approaches designed peptidic inhibitors. The atomic structure of NACore revealed a pair of self-complementary β-sheets forming a steric zipper (Sawaya M R, et al. (2007) Nature 447(7143):453-457). The inhibitors are predicted by Rossetta-based computational modeling to bind the steric zipper interface and ‘cap’ the fibrils. We identified 3 candidate inhibitors; S37, S61 and S71 that bind favorably with one or both ends of the zipper (
[0034] In order to prevent the self-aggregation of our designed inhibitors, we used the shorter segment along with one or more modifications. S37 has a W mutation at Thr72 and an additional poly-lysine tag at the C-terminus to induce charge-charge repulsion. It is predicted to bind both tips of the steric zipper fibril. S61 and S62 retain the same inhibitor sequence as S37 but instead of poly-lysine tag, a TAT tag is added to aid solubility and prevent self-aggregation. S71 has a methylated glycine at Gly73 that weakens hydrogen bonding along the β-sheet and an additional TAT tag for solubility and cell penetration.
[0035] We tested the efficacy of the inhibitors in an in vitro aggregation assay. Recombinantly purified α-syn was aggregated in the presence of the inhibitors and monitored by measuring fluorescence of Thioflavin T, an amyloid binding dye. All three inhibitors prevented aggregation with a significant reduction in ThT fluorescence (
[0036] We tested the efficacy of the inhibitors in preventing aggregation in a cell culture model. For these assays, we utilized two HEK293T cells that stably express YFP-labeled full-length WT α-syn and A53T α-syn (Sanders D W, et al. (2014) Neuron 82(6):1271-1288). In this model, lipofectamine-mediated transfection of recombinant fibrils leads to aggregation of the endogenous YFP-labeled protein that are seen as fluorescent puncta. Additionally, these puncta increase in size and number over time. This proliferation of aggregates over time is indicative of a ‘seeding’ phenomenon whereby a small amount of amyloid fibrils induces aggregation of the endogenous protein. First we tested the parent peptide segment, NACore to check its effect on seeding. α-syn was aggregated in the presence of molar excess of NACore (
[0037] We tested the efficacy of the inhibitors to prevent seeding in the cell culture model (
[0038] We extracted insoluble protein aggregates from frozen autopsy PD brain tissues. We obtained tissues from 4 different subjects including the substantia nigra and frontal regions of one subject and temporal and frontal regions of other subjects. Using previously described protocols (Goedert et al. (1992) Neuron 8(1):159-168) that included precipitation with the ionic detergent sarkosyl, we extracted insoluble protein aggregates (
[0039] We tested the effect of the different inhibitors in preventing α-syn aggregation in the presence of PD extracted seeds. S71 and S62 were most effective showing efficacy against all seeds as measured by ThT fluorescence assay (
[0040] We tested the efficacy of the inhibitors in preventing seeding by PD fibrils in cell culture. α-syn aggregates formed in the presence of PD fibrils were transfected in WT HEK cells along with the different inhibitors (
[0041] The disclosure immediately above describes work with a number of working embodiments of the invention. The invention disclosed herein provides such inhibitory peptides; pharmaceutical compositions comprising inhibitory peptides of the invention and a pharmaceutically acceptable carrier; methods of using the inhibitory peptides to block, inhibit and/or prevent α-synuclein aggregation and/or α-synuclein cytotoxicity, comprising contacting an α-synuclein molecule (e.g. a monomer, small aggregate, oligomer, or fibril) with an effective amount of a peptide inhibitor of the invention, or administering to a subject an effective amount of a peptide inhibitor of the invention; and computer-related embodiments, such as a method for designing and obtaining inhibitory peptides or small molecules based on the structures described herein.
[0042] Advantages of the inhibitory peptides of the invention include: (1) Synthetic peptides are not expensive. (2) Cell penetration and protein stability are not challenging thanks to their composition and small size. In addition, the peptides can be fused to cell penetrating peptides that enhance their delivery into cells. (3) They are unexpectedly stable: they are not proteolyzed and exhibit a sufficiently long half-life to function in vivo (e.g. in a body). (4) Peptide inhibitors are specific for their targets, and therefore present fewer opportunities for side effects than, e.g., small molecules, which may bind to many targets.
[0043] The invention disclosed herein has a number of embodiments. One embodiment of the invention is a composition of matter comprising at least one inhibitory peptide that inhibits α-synuclein (SEQ ID NO: 1) aggregation by binding to residues 68-78 of α-synuclein. As disclosed in the Examples below, working embodiments of these peptides include S37, S62 and S71 as shown in Table 1 below:
TABLE-US-00001 Inhibitor Sequence S37 GAVVWGVTAVKKKKK S62 GAVVWGVTAVKKGRKKRRQRRRPQ S71 YGRKKRRQRRRAVVT{N-me-Gly}VTAVAE
[0044] In the table N-me-Gly stands for Glycine with a methylated amino group. Bold type gives the inhibitor sequence. Unbold type shows tags, either solubilizing tags or linkers.
[0045] In typical embodiments of the invention, the inhibitory peptide comprises the sequence GAVVWGVTAVKK (SEQ ID NO: 3) or RAVVTGVTAVAE (SEQ ID NO: 4). Optionally the inhibitory peptide comprises the sequence GAVVWGVTAVKKKKK (SEQ ID NO: .sup.5), GAVVWGVTAVKKGRKKRRQRRRPQ (SEQ ID NO: 6); or
[0046] YGRKKRRQRRRAVVTGVTAVAE (SEQ ID NO: 7). In certain embodiments of the invention, the composition comprises a plurality of inhibitory peptides. Typically, the inhibitory peptide(s) is/are from 6 to 30 amino acids in length. Active variants of any of these inhibitory peptides are also included. Inhibitory peptides having the preceding sequences, including the active variants, are sometimes referred to herein as “inhibitory peptides of the invention.”
[0047] In the inhibitory peptide compositions of the invention, at least one of the amino acids in the inhibitory peptide comprises a non-naturally occurring amino acid (e.g. a D-amino acid or an amino acid comprising a N-methyl group moiety); and/or the inhibitory peptide is coupled to a heterologous peptide tag. Such heterologous peptide tags include amino acid sequences that increase peptide solubility in vivo or in vitro (e.g. a plurality of arginine residues); or amino acid sequences that facilitate monitoring or manipulation of the peptide in vivo or in vitro (a plurality of lysine or histidine amino acids); or amino acid sequences that facilitate peptide entry into a mammalian cell (e.g. a cell penetrating peptide sequence). Another aspect of the invention is a pharmaceutical composition comprising an inhibitory peptide of the invention and a pharmaceutically acceptable carrier. Such pharmaceutical compositions are sometimes referred to herein as “pharmaceutical compositions of the invention.” Optionally the peptide compositions disclosed herein include a pharmaceutically acceptable carrier and a peptide stabilizing excipient.
[0048] Another embodiment of the invention is an expression vector encoding an inhibitory peptide that inhibits α-synuclein aggregation by binding to residues 68-78 of α-synuclein. Optionally, the expression vector is one used to deliver polypeptides to mammalian cells such as a lentivirus. In this context, another embodiment of the invention is a method of delivering a DNA encoding an inhibitory peptide that inhibits α-synuclein aggregation in a mammalian cell (e.g. an ex vivo or in vivo cell) by contact the mammalian cell with a vector that transduces the cell so that he DNA is expressed in the cell.
[0049] Another embodiment is kit comprising a peptide inhibits α-synuclein (SEQ ID NO: 1) aggregation by binding to residues 68-78 of α-synuclein or an expression vector encoding such a peptide. Embodiments of the invention also include a method of making a peptide disclosed herein by synthesizing it chemically or producing it recombinantly. Yet another embodiment of the invention is a complex comprising α-synuclein and a peptide that inhibits α-synuclein aggregation by binding to residues 68-78 of α-synuclein.
[0050] Another embodiment is a peptide designed on the structure of PreNAC (residues 47-56 of α-synuclein: GVVHGVTTVA) to inhibit fibril formation of α-synuclein.
[0051] Yet another embodiment of the invention is a method for reducing or inhibiting α-synuclein (SEQ ID NO: 1) aggregation, comprising contacting α-synuclein amyloid fibrils with an inhibitory peptide disclosed herein in an amount sufficient to reduce or inhibit α-synuclein aggregation. Optionally in this method, the α-synuclein amyloid fibrils are within an in vivo environment. Alternatively in this method, the α-synuclein amyloid fibrils are within an in vitro environment. A related embodiment of the invention is a method of modulating the size or rate of growth of a α-synuclein amyloid fibril, comprising contacting the fibril with an amount of at least one inhibitory peptide that inhibits α-synuclein (SEQ ID NO: 1) aggregation by binding to residues 68-78 of α-synuclein in an environment where the inhibitory peptide contacts residues 68-78 of α-synuclein so that the contacted α-synuclein amyloid fibril exhibits a modulated size or rate of growth.
[0052] The peptide inhibitors disclosed herein can be used as a therapy to halt the spread of Parkinson's disease within the brain. Alternatively, the peptide inhibitors disclosed herein can be used as a diagnostic probe to recognize pathological aggregated seeds of the protein, α-synuclein in diseases such as Parkinson's disease, dementia with Lewy bodies and multiple system atrophy. In this context, embodiments of the invention include methods of observing aggregated seeds of the protein, α-synuclein in a biological sample, comprising contacting the biological sample with a peptide that binds to residues 68-78 of α-synuclein, and then observing if the peptide binds to aggregated seeds of the protein, α-synuclein, if present in that biological sample. Typically in these methods, a heterologous peptide tag is coupled to the inhibitory peptide in order to facilitate observation of the peptide. Optionally in these methods, the biological sample is from an individual suspected of suffering from Parkinson's disease, dementia with Lewy bodies or multiple system atrophy.
[0053] As used herein, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. For example, in the preceding case, the pharmaceutical composition may comprise one or more inhibitory peptide molecules of the invention, which can be the same or different.
[0054] Another aspect of the invention is a complex comprising an α-synuclein molecule (e.g. a monomer, small aggregate, oligomer, or fibril of α-synuclein) and an inhibitory peptide of the invention. They may be bound to, conjugated with, or otherwise associated with each other. The α-synuclein and the inhibitory peptide may be covalently or non-covalently linked.
[0055] Other aspects of the invention include a polynucleotide encoding an inhibitory peptide of the invention; an expression vector comprising the polynucleotide; a cell transfected with the polynucleotide or the expression vector; and a method for making the peptide, comprising expressing it in the transfected cell, cultivating the cell and harvesting the peptide thus generated.
[0056] Another aspect of the invention is a method for inhibiting (preventing, stopping) aggregation of an α-synuclein molecule (e.g. a monomer, small aggregate, oligomer, or fibril of α-synuclein), comprising contacting the α-synuclein molecule with an effective amount of an inhibitory peptide or pharmaceutical composition of the invention. The α-synuclein molecule can be in solution or in a cell, which is in culture or in a subject. In one embodiment, the contacting of an α-synuclein molecule which is a monomer, oligomer or small aggregate prevents aggregation (oligomerization, further oligomerization, and/or fibril formation) of the α-synuclein molecule. In another embodiment, the contacting of an aggregated form of α-synuclein or a fibril prevents further aggregation (fibrillization) of the aggregated form or the fibril.
[0057] In one embodiment of this method, the α-synuclein protein molecule which is contacted is in a subject having a disease or condition which is mediated by the presence of fibrillated α-synuclein (sometimes referred to herein as an α-synuclein-mediated disease or condition, or a synucleinopathy) such as, e.g., Parkinson's disease (PD), Lewy body dementia and multiple system atrophy. α-synuclein pathologies are also found in other related neurodegenerative diseases, such as, e.g., both sporadic and familial Alzheimer's disease.
[0058] Another aspect of the invention is a method for treating a subject having an α-syn-mediated disease or condition, such as, e.g., Parkinson's disease, Lewy body dementia, or multi system atrophy, comprising administering to the subject an effective amount of an inhibitory peptide or pharmaceutical composition of the invention. The treatment can result in the blockage (prevention) or inhibition of α-synuclein aggregation and/or α-synuclein cytotoxicity in the subject, and spread of pathology (seeding).
[0059] Another aspect of the invention is a computer-implemented method for identifying a peptide that inhibits α-synuclein aggregation and/or α-synuclein cytotoxicity, as described herein. Another aspect of the invention is a kit comprising an inhibitory peptide of the invention, optionally packaged in a container. Another aspect of the invention is a method for making an inhibitory peptide of the invention, comprising synthesizing it chemically or producing it recombinantly.
[0060] Yet another embodiment of the invention is a method of observing the presence or absence of α-synuclein amyloid fibrils in a biological sample comprising combining a biological sample with a peptide that binds to residues 68-78 of α-synuclein, allowing the peptide to bind to α-synuclein amyloid fibrils that may be present in the biological sample, and then monitoring this combination for the presence of complexes formed between α-synuclein amyloid fibrils and the peptide; wherein the presence of said complexes show the presence of α-synuclein amyloid fibrils in the biological sample. Optionally in this method, the presence of complexes formed between α-synuclein amyloid fibrils and the peptide is monitored using a detectable label that is coupled to the peptide (e.g. a heterologous peptide tag). In illustrative embodiments of the invention, the peptide comprises the sequence GAVVWGVTAVKK (SEQ ID NO: 3) or RAVVTGVTAVAE (SEQ ID NO: 4). Typically, the method is performed on a biological sample obtained from an individual suspected of suffering from Parkinson's disease. Such embodiments of the invention can be used, for example, in diagnostic methods designed to observe the presence or status of PD, for example to detect disease beginnings before clinical symptoms, and to follow the effectiveness (or lack of effectiveness), of a therapeutic treatment.
[0061] Peptide inhibitors of the invention bind specifically (selectively, preferentially) to α-synuclein rather than to unintended proteins. The protein to which the peptide inhibitor binds may be, e.g., a monomer, small aggregate, oligomer, or fibril. For example, the binding can be 2 times, 5 times, 10 times, 100 times or 200 times stronger, or no binding at all can be detected to an unintended target. Conventional methods can be used to determine the specificity of binding, such as e.g. competitive binding assays or other suitable analytic methods.
[0062] Active variants of the inhibitory peptides described above are also included. An “active variant” is a variant which retains at least one of the properties of the inhibitory peptides described herein (e.g., the ability to bind to α-synuclein and/or to block, inhibit or prevent α-synuclein fibrillation (aggregation) and/or α-synuclein cytotoxicity). Fibrilization, as used herein, refers to the formation of fiber or fibrils, such as amyloid fibrils.
[0063] Suitable active variants include peptidomimetic compounds (any compound containing non-peptidic structural elements that is capable of mimicking the biochemical and/or biological action(s) of a natural mimicked peptide, including, for example, those designed to mimic the structure and/or binding activity (such as, for example, hydrogen bonds and hydrophobic packing interactions) of the peptides according to the methods disclosed herein). Inhibitory peptides of the invention, including active variants thereof, are sometimes referred to herein as “peptidic compounds” or “compounds.”
[0064] In one embodiment, active variants of the inhibitory peptides are shortened by 1-3 (e.g., 1, 2 or 3) amino acids at either the N-terminus, the C-terminus, or both of the starting inhibitory peptide. In another embodiment, the active variants are lengthened (extended) by 1, 2, 3 or 4 amino acids at the C-terminal end of the starting inhibitory peptide, e.g. with amino acid residues at the position in which they occur in α-synuclein.
[0065] A variety of other types of active variants are included. In some embodiments, amino acids other than the ones noted above are substituted. These amino acids can help protect the peptide inhibitors against proteolysis or otherwise stabilize the peptides, and/or contribute to desirable pharmacodynamic properties in other ways. In some embodiments, the non-natural amino acids allow an inhibitor to bind more tightly to the target because the side chains optimize hydrogen bonding and/or apolar interactions with it. In addition, non-natural amino acids offer the opportunity of introducing detectable markers, such as strongly fluorescent markers which can be used, e.g., to measure values such as inhibition constants. Also included are peptide mimetics, such as, e.g., peptoids, beta amino acids, N-ethylated amino acids, and small molecule mimetics.
[0066] In one embodiment, non-natural amino acids are substituted for amino acids in the sequence. More than 100 non-natural amino acids are commercially available. These include, for example,
TABLE-US-00002 Non-natural amino acids which can substitute for LEU: L-cyclohexylglycine 161321 - 36 - 4 L-phenylglycine 102410 - 65 - 1 4-hydroxy-D-phenylglycine 178119-93-2 L-α-t-butylglycine 132684 - 60 - 7 cyclopentyl-Gly-OH 220497 - 61 - 0\ L-2-indanylglycine 205526 - 39 - 2 Non-natural amino acids which can substitute for THR: Thr(tBu)-OH 71989-35-0 (RS)-2-amino-3-hydroxy-3- 105504 - 72 - 1 methylbutanoic acid Non-natural amino acids which can substitute for ILE: allo-Ile-OH 251316-98-0 N-Me-allo-Ile-OH 136092-80-3 Homoleu-OH 180414-94-2 Non-natural amino acids which can substitute for ARG: Nω-nitro-L-arginine 58111-94-7 L-citrulline 133174 - 15 - 9 Non-natural amino acids which can substitute for TYR: 3-amino-L-tyrosine 726181-70-0 3-nitro-L-tyrosine 136590 - 09 - 5 3-methoxy-L-tyrosine 3-iodo-L-tyrosine 134486 - 00 - 3 3-chloro-L-tyrosine 478183-58-3 3,5-dibrimo-L-tyrosine 201484-26-6 Non-natural amino acids which can substitute for LYS: Lys(retro-Abz-)-OH 159322-59-5 Lys(Mca)-OH 386213-32-7 (Nδ-4-methyltrityl)-L- 343770-23-0 ornithine N-α--N-ε-(d-Biotin)-L- 146987 - 10 - 2 lysine
[0067] In another embodiment, one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 or 17) of the L-amino acids are substituted with a D amino acid.
[0068] In another embodiment, one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 or 17)N-methylated residues are included in the peptide.
[0069] An inhibitory peptide of the invention can comprise, e.g., L-amino acids, D-amino acids, non-natural amino acids, or combinations thereof.
[0070] Active variants include molecules comprising various tags at the N-terminus or the C-terminus of the peptide. For example, an inhibitory peptide of the invention can comprise as tags at its N-terminus and/or at its C-terminus: 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more Lysine residues; 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more Arginine residues; 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more Glutamate residues; 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more Aspartate residues; combinations of these amino acid residues; or other polar tags that will be evident to a skilled worker. Other active variants include mutations of the α-synuclein sequence which increase affinity of the inhibitory peptides for the α-synuclein.
[0071] In one embodiment, the inhibitor is a small molecule which has been designed by the methods described by Jiang et al. .sup.63 (which is incorporated herein by reference, particularly with regard to this method), using the atomic structure of the fiber forming segment of α-synuclein described herein as the basis for designing the inhibitor. Suitable small molecules that can be identified by this method of Jiang et al. will be evident to a skilled worker.
[0072] In one embodiment of the invention, a peptide of the invention is modified so that 1, 2 or 3 of its amino acids are substituted with an amino acid having a non-naturally occurring side chain, such as the non-natural amino acids discussed above, or with an amino acid having a side chain modified by cross-linking (e.g., through the epsilon amino group of a Lys residue) of a small molecule which has been designed by Jiang et al. .sup.63. Some representative fiber-binding molecules are shown below. These active variants not only cap growing aggregates of α-synuclein but also, via the modified side chains, may bind to (clamp against) the sides of the steric zipper, thereby enhancing the inhibitory activity of the peptide.
[0073] Fiber-binding compounds designed by Jiang et al. .sup.63 include:
##STR00001## ##STR00002## ##STR00003##
[0074] In one embodiment of the invention, an inhibitory peptide of the invention is isolated or purified, using conventional techniques such as the methods described herein. By “isolated” is meant separated from components with which it is normally associated, e.g., components present after the peptide is synthesized. An isolated peptide can be a cleavage product of a protein which contains the peptide sequence. A “purified” inhibitory peptide can be, e.g., greater than 90%, 95%, 98% or 99% pure.
[0075] In one embodiment, to enhance the cell permeability of an inhibitory peptide of the invention, the peptide is fused to any of a variety of cell penetrating peptides (CPPs). CPPs typically have an amino acid composition that either contains a high relative abundance of positively charged amino acids such as lysine or arginine or has sequences that contain an alternating pattern of polar/charged amino acids and non-polar, hydrophobic amino acids. These two types of structures are referred to as polycationic or amphipathic, respectively. A third class of CPP's are the hydrophobic peptides, containing only apolar residues, with low net charge or have hydrophobic amino acid groups that are crucial for cellular uptake. Some typical CPP's that can be fused to an inhibitory peptide of the invention are provided in Table 2.
TABLE-US-00003 TABLE 2 Name Sequence Reference - original or review poly ARG nR where 4 < n < 17 (e.g., n = 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16) (SEQ ID NO: 8) Wender, P.A., Mitchell, D.J., Pattabiraman, K., Pelkey, E.T., Steinman, L., and Rothbard, J.B. (2000). The design, synthesis, and evaluation of molecules that enable or enhance cellular uptake: peptoid molecular transporters. Proc. Natl. Acad. Sci. U. S. A. 97, 13003-8. polyLYS nK where 4 < K < 17 (e.g., K = 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16) D-polyARG nR where 4 < n < 17 (e.g., n = 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16) D-polyLYSnK where 4 < K < 17 (e.g., K = 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16) SynB1 RGGRLSYSRRRFSTSTGR (SEQ ID NO: 9) SynB3 RRLSYSRRRF (SEQ ID NO: 10) Penetratin RQIKIWFQNRRMKWKK (SEQ ID NO: 11) Derossi, D., Joliot, A.H., Chassaing, G., and Prochiantz, A. (1994). The third helix of the Antennapedia homeodomain translocates through biological mem-branes. J. Biol. Chem. 269, 10444-50. Pen Arg RQIRIWFQNRRMRWRR (SEQ ID NO: 12) PenLys KQIKIWFQNKKMKWKK (SEQ ID NO: 13) TatP59W GRKKRRQRRRPWQ (SEQ ID NO: 14) Tat (48-60) GRKKRRQRRRPPQ (SEQ ID NO: 15) Vives, E., Brodin, P., and Lebleu, B. (1997). A truncated HIV-1 Tat protein basic domain rapidly translocates through the plasma membrane and accumulates in the cell nucleus. J. Biol. Chem. 272, 16010-7. R9-Tat GRRRRRRRRRPPQ (SEQ ID NO: 16) Futaki, S. (2002) Arginine-rich peptides: potential for intracellular delivery of macromolecules and the mystery of the translocation mechanisms. Int. J. Pharm. 245, 1-7. Tat YGRKKRRQRRR (SEQ ID NO: 17) Vives, E., Brodin, P., and Lebleu, B. (1997). A truncated HIV-1 Tat protein basic domain rapidly translocates through the plasma membrane and accumulates in the cell nucleus. J. Biol. Chem. 272, 16010-7. D-Tat GRKKRRQRRRPPQ (SEQ ID NO: 18) Futaki, S. (2002) Arginine-rich peptides: potential for intracellular delivery of macromolecules and the mystery of the translocation mechanisms. Int. J. Pharm. 245, 1-7. BMVGag(7-25) KMTRAQRRAAARRNRWTAR (SEQ ID NO: 19) Futaki, S. (2002) Arginine-rich peptides: potential for intracellular delivery of macromolecules and the mystery of the translocation mechanisms. Int. J. Pharm. 245, 151-7. FHVCoat(35-49) RRRRNRTRRNRRRVR (SEQ ID NO: 20) Futaki, S. (2002) Arginine-rich peptides: potential for intracellular delivery of macromolecules and the mystery of the translocation mechanisms. Int. J. Pharm. 245, 1-7. HTL V-II Rex(4-16) TRRQRTRRARRNR (SEQ ID NO: 21) Futaki, S. (2002) Arginine-rich peptides: potential for intracellular delivery of macromolecules and the mystery of the translocation mechanisms. Int. J. Pharm. 245, 1-7. P22N-(14-30) NAKTRRHERRRKLAIER (SEQ ID NO: 22) pVEC LLIILRRRIRKQAHAHSK (SEQ ID NO: 23) Elmquist, A., Lindgren, M., Bartfai, T., and Langel, Ü. (2001). VE-cadherin-derived cell-penetrating peptide, pVEC, with carrier functions. Exp. Cell Res. 269, 237-44. Transportan GWTLNSAGYLLGKINLKALAALAKKIL (SEQ ID NO: 24) Pooga, M., Hällbrink, M., Zorko, M., and Langel, Ü. (1998). Cell penetration by transportan. FASEB J. 12, 67-77. TP10 AGYLLGKINLKALAALAKKIL (SEQ ID NO: 25) Soomets, U., Lindgren, M., Gallet, X., Hällbrink, M., Elmquist, A., Balaspiri, L., Zorko, M., Pooga, M., Brasseur, R., and Langel, Ü. (2000). Dele-tion analogues of transportan. Biochim. Biophys. Acta 1467, 165-76. PTD-4 PIRRRKKLRRLK (SEQ ID NO: 26) PTD-5 RRQRRTSKLMKR (SEQ ID NO: 27) Pep-1 ac-KETWWETWWTEWSQPKKKRKV-cya (SEQ ID NO: 28) Pep-2 ac-KETWFETWFTEWSQPKKKRKV-cya (SEQ ID NO: 29) Morris, M.C., Chaloin, L., Choob, M., Archdeacon, J., Heitz, F. and Divita, G. (2004). Combination of a new generation of PNAs with a peptide-based carrier enables efficient targeting of cell cycle progression. Gene Ther 11: 757-764. Pep-3 ac-KWFETWFTEWPKKRK-cya (SEQ ID NO: 30) Morris, M.C., Gros, E., Aldrian-Herrada, G., Choob, M., Archdeacon, J., Heitz, F. et al. (2007). A non-covalent peptide-based carrier for in vivo delivery of DNA mimics. Nucleic Acids Res 35: e49. E N(1-22) MDAQTRRRERRAEKQAQWKAAN (SEQ ID NO: 31) B 21 N-(12-29) TAKTRYKARRAELIAERR (SEQ ID NO: 32) U2AF(142-153) SQMTRQARRLYV (SEQ ID NO: 33) PRP6(129-144) TRRNKRNRIQEQLNRK (SEQ ID NO: 34) MAP KLALKLALKLALALKLA (SEQ ID NO: 35) SBP MGLGLHLLVLAAALQGAWSQPKKKRKV (SEQ ID NO: 36) FBP GALFLGWLGAAGSTMGAWSQPKKKRKV (SEQ ID NO: 37) MPG ac-GALFLGFLGAAGSTMGAWSQPKKKRKV-cya (SEQ ID NO: 38) Morris, M.C., Vidal, P., Chaloin, L., Heitz, F. and Divita, G. (1997). A new peptide vector for efficient delivery of oligonucleotides into mammalian cells. Nucleic Acids Res 25: 2730-2736. MPG(ΔNLS) ac- GALFLGFLGAAGSTMGAWSQPKSKRKV-cya (SEQ ID NO: 39) REV(34-50) TRQARRNRRRRWRERQR (SEQ ID NO: 40) Futaki, S. (2002) Arginine-rich peptides: potential for intracellular delivery of macromolecules and the mystery of the translocation mechanisms. Int. J. Pharm. 245, 1-7. ACPPs from Jiang et al., PNAS 2004 - lower case indicates D-aa. The symbol “_” in some of these sequences indicates a position at which any of a variety of art- recognized protease cleavage sites can be inserted: EEEEEDDDDK_AXRRRRRRRRRXC (SEQ ID NO: 41) EEEEEDDDDK_ARRRRRRRRRXC (SEQ ID NO: 42) EDDDDK_AXRRRRRRRRRXC (SEQ ID NO: 43) EEDDDDK_ARXRRXRRXRRXRRXC (SEQ ID NO: 44) DDDDDDK_ARRRRRRRRRXC (SEQ ID NO: 45)
[0076] In another embodiment, the CPP is polyD(.sub.1-16).
[0077] In general, it is advisable that the length of the CPP is rather short, e.g. less than about 30 amino acids, in order to improve stability and pharmacodynamic properties once the molecule enters a cell.
[0078] In some embodiments, the CPP is directly attached (fused) to a peptide of the invention. In other embodiments, it is desirable to separate the highly charged CPP from the inhibitor peptide with a linker, to allow the inhibitor to retain its activity. Any of a variety of linkers can be used. The size of the linker can range, e.g., from 1-7 or even more amino acids (e.g., 1, 2, 3, 4, 5, 6 or 7 amino acids).For example, the linker can be QVTNVG at the N-terminus and QKTVEG at the C-terminus or a truncated version thereof having 1, 2, 3, 4 or 5 of the contiguous amino acids N-terminal to to the inhibitory peptide.
[0079] In embodiments of the invention, the inhibitory peptide is detectably labeled. Labeled peptides can be used, e.g., to better understand the mechanism of action and/or the cellular location of the inhibitory peptide. Suitable labels which enable detection (e.g., provide a detectable signal, or can be detected) are conventional and well-known to those of skill in the art. Suitable detectable labels include, e.g., radioactive active agents, fluorescent labels, and the like. Methods for attaching such labels to a protein, or assays for detecting their presence and/or amount, are conventional and well-known.
[0080] An inhibitory peptide of the invention can be synthesized (e.g., chemically or by recombinant expression in a suitable host cell) by any of a variety of art-recognized methods. In order to generate sufficient quantities of an inhibitory peptide for use in a method of the invention, a practitioner can, for example, using conventional techniques, generate nucleic acid (e.g., DNA) encoding the peptide and insert it into an expression vector, in which the sequence is under the control of an expression control sequence such as a promoter or an enhancer, which can then direct the synthesis of the peptide. For example, one can (a) synthesize the DNA de novo, with suitable linkers at the ends to clone it into the vector; (b) clone the entire DNA sequence into the vector; or (c) starting with overlapping oligonucleotides, join them by conventional PCR-based gene synthesis methods and insert the resulting DNA into the vector. Suitable expression vectors (e.g., plasmid vectors, viral, including phage, vectors, artificial vectors, yeast vectors, eukaryiotic vectors, etc.) will be evident to skilled workers, as will methods for making the vectors, inserting sequences of interest, expressing the proteins encoded by the nucleic acid, and isolating or purifying the expressed proteins.
[0081] Another aspect of the invention is a pharmaceutical composition comprising one or more of the inhibitory peptides and a pharmaceutically acceptable carrier. The components of the pharmaceutical composition may be detectably labeled, e.g. with a radioactive or fluorescent label, or with a label, for example one that is suitable for detection by positron emission spectroscopy (PET) or magnetic resonance imaging (MRI). For example, peptides of the invention can be coupled to a detectable label selected from the group consisting of a radioactive label, a radio-opaque label, a fluorescent dye, a fluorescent protein, a colorimetric label, and the like. In some embodiments, the inhibitory peptide is present in an effective amount for the desired purpose.
[0082] “Pharmaceutically acceptable” means that which is useful in preparing a pharmaceutical composition that is generally safe, non-toxic, and neither biologically nor otherwise undesirable and includes that which is acceptable for veterinary as well as human pharmaceutical use. For example, “pharmaceutically acceptable salts” of a compound means salts that are pharmaceutically acceptable, as defined herein, and that possess the desired pharmacological activity of the parent compound.
[0083] Another aspect of the invention is a polynucleotide encoding an inhibitory peptide of the invention. In embodiments of the invention, the polynucleotide is operably linked to a regulatory control sequence (e.g., a promoter or an enhancer) to facilitate production of the encoded protein following introduction (e.g. by transfection) into a suitable cell. Other embodiments include a cell comprising the expression vector; and a method of making an inhibitory peptide of the invention comprising cultivating the cell and harvesting the peptide thus generated.
[0084] As used throughout this application, “about” means plus or minus 5% of a value.
[0085] Another aspect of the invention is a kit for carrying out any of the methods described herein. The kit may comprise a suitable amount of an inhibitory peptide of the invention; reagents for generating the peptide; reagents for assays to measure their functions or activities; or the like. Kits of the invention may comprise instructions for performing a method. Other optional elements of a kit of the invention include suitable buffers, media components, or the like; a computer or computer-readable medium providing the structural representation of a crystal structure described herein; containers; or packaging materials. Reagents for performing suitable controls may also be included. The reagents of the kit may be in containers in which the reagents are stable, e.g., in lyophilized form or stabilized liquids. The reagents may also be in single use form, e.g., in single reaction form for administering to a subject.
[0086] Characterization of candidate inhibitory peptides of the invention can be carried out by any of a variety of conventional methods. For example, the peptides can be assayed for the ability to reduce or inhibit α-synuclein aggregation or cytotoxicity or cell-to-cell spread. The assays can be carried out in vitro or in vivo. Suitable assays will be evident to a skilled worker; some suitable assays are described herein.
[0087] One aspect of the invention is a method for reducing or inhibiting α-synuclein aggregation, comprising contacting α-synuclein protofilaments with an effective amount of one or more of the inhibitory peptides of the invention. Such a method can be carried out in solution or in a cell (e.g. cells in culture or in a subject).
[0088] Another aspect of the invention is a method for treating a subject having a disease or condition which is mediated by the presence of fibrillated α-synuclein (sometimes referred to herein as an α-synuclein-mediated disease or condition), comprising administering to the subject an effective amount of an inhibitory peptide or pharmaceutical composition of the invention. Among such diseases or conditions are, e.g., Parkinson's disease (PD), Lewy body dementia, or multiple system atrophy. Another aspect of the invention is a method to prevent the onset of such diseases or conditions (e.g., PD), or to treat a subject in the early stages of such diseases or conditions, or that is developing such a disease or condition, in order to prevent or inhibit development of the condition or disease.
[0089] An inhibitory peptide or pharmaceutical composition of the invention is sometimes referred to herein as an “inhibitor.”
[0090] An “effective amount” of an inhibitor of the invention is an amount that can elicit a measurable amount of a desired outcome, e.g. inhibition of α-synuclein aggregation or cytotoxicity; for a diagnostic assay, an amount that can detect a target of interest, such as an α-synuclein aggregate; or in a method of treatment, an amount that can reduce or ameliorate, by a measurable amount, a symptom of the disease or condition that is being treated.
[0091] A “subject” can be any subject (patient) having aggregated (fibrillated) α-synuclein molecules associated with a condition or disease which can be treated by a method of the present invention. In one embodiment of the invention, the subject has PD. Typical subjects include vertebrates, such as mammals, including laboratory animals, dogs, cats, non-human primates and humans.
[0092] The inhibitors of the invention can be formulated as pharmaceutical compositions in a variety of forms adapted to the chosen route of administration, for example, orally, nasally, intraperitoneally, or parenterally, by intravenous, intramuscular, topical or subcutaneous routes, or by injection into tissue.
[0093] Suitable oral forms for administering the inhibitors include lozenges, troches, tablets, capsules, effervescent tablets, orally disintegrating tablets, floating tablets designed to increase gastric retention times, buccal patches, and sublingual tablets.
[0094] The inhibitors of the invention may be systemically administered, e.g., orally, in combination with a pharmaceutically acceptable vehicle such as an inert diluent or an assimilable edible carrier, or by inhalation or insufflation. They may be enclosed in coated or uncoated hard or soft shell gelatin capsules, may be compressed into tablets, or may be incorporated directly with the food of the patient's diet. For oral therapeutic administration, the compounds may be combined with one or more excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like. For compositions suitable for administration to humans, the term “excipient” is meant to include, but is not limited to, those ingredients described in Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins, 21st ed. (2006) (hereinafter Remington's).
[0095] The inhibitors may be combined with a fine inert powdered carrier and inhaled by the subject or insufflated. Such compositions and preparations should contain at least 0.1% compounds. The percentage of the compositions and preparations may, of course, be varied and may conveniently be between about 2% to about 60% of the weight of a given unit dosage form.
[0096] The tablets, troches, pills, capsules, and the like may also contain the following: binders such as gum tragacanth, acacia, corn starch or gelatin; excipients such as dicalcium phosphate; a disintegrating agent such as corn starch, potato starch, alginic acid and the like; a lubricant such as magnesium stearate; and a sweetening agent such as sucrose, fructose, lactose or aspartame or a flavoring agent such as peppermint, oil of wintergreen, or cherry flavoring may be added. When the unit dosage form is a capsule, it may contain, in addition to materials of the above type, a liquid carrier, such as a vegetable oil or a polyethylene glycol. A syrup or elixir may contain the active compound, sucrose or fructose as a sweetening agent, methyl and propylparabens as preservatives, a dye and flavoring such as cherry or orange flavor.
[0097] Various other materials may be present as coatings or to otherwise modify the physical form of the solid unit dosage form. For instance, tablets, pills, or capsules may be coated with gelatin, wax, shellac or sugar and the like. Of course, any material used in preparing any unit dosage form should be pharmaceutically acceptable and substantially non-toxic in the amounts employed.
[0098] In addition, the inhibitors may be incorporated into sustained-release preparations and devices. For example, the inhibitors may be incorporated into time release capsules, time release tablets, and time release pills. In some embodiments, the composition is administered using a dosage form selected from the group consisting of effervescent tablets, orally disintegrating tablets, floating tablets designed to increase gastric retention times, buccal patches, and sublingual tablets.
[0099] The inhibitors may also be administered intravenously or intraperitoneally by infusion or injection. Solutions of the inhibitors can be prepared in water, optionally mixed with a nontoxic surfactant. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, triacetin, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations can contain a preservative to prevent the growth of microorganisms.
[0100] The pharmaceutical dosage forms suitable for injection or infusion can include sterile aqueous solutions or dispersions or sterile powders comprising the compounds which are adapted for the extemporaneous preparation of sterile injectable or infusible solutions or dispersions, optionally encapsulated in liposomes. In all cases, the ultimate dosage form should be sterile, fluid and stable under the conditions of manufacture and storage. The liquid carrier or vehicle can be a solvent or liquid dispersion medium comprising, for example, water, ethanol, a polyol (for example, glycerol, propylene glycol, liquid polyethylene glycols, and the like), vegetable oils, nontoxic glyceryl esters, and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the formation of liposomes, by the maintenance of the required particle size in the case of dispersions or by the use of surfactants.
[0101] Sterile injectable solutions are prepared by incorporating the compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filter sterilization. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze drying techniques, which yield a powder of the active ingredient plus any additional desired ingredient present in the previously sterile-filtered solutions.
[0102] For topical administration, the compounds may be applied in pure form. However, it will generally be desirable to administer them to the skin as compositions or formulations, in combination with a dermatologically acceptable carrier, which may be a solid or a liquid.
[0103] Useful solid carriers include finely divided solids such as talc, clay, microcrystalline cellulose, silica, alumina and the like. Other solid carriers include conventional nontoxic polymeric nanoparticles or microparticles. Useful liquid carriers include water, alcohols or glycols or water/alcohol/glycol blends, in which the compounds can be dissolved or dispersed at effective levels, optionally with the aid of non-toxic surfactants. Adjuvants such as fragrances and additional antimicrobial agents can be added to optimize the properties for a given use. The resultant liquid compositions can be applied from absorbent pads, used to impregnate bandages and other dressings, or sprayed onto the affected area using pump-type or aerosol sprayers.
[0104] Useful dosages of the peptides or pharmaceutical compositions of the invention can be determined by comparing their in vitro activity, and in vivo activity in animal models. Methods for the extrapolation of effective dosages in mice, and other animals, to humans are known to the art.
[0105] For example, the concentration of the compounds in a liquid composition, such as a lotion, can be from about 0.1-25% by weight, or from about 0.5-10% by weight. The concentration in a semi-solid or solid composition such as a gel or a powder can be about 0.1-5% by weight, or about 0.5-2.5% by weight.
[0106] Effective dosages and routes of administration of agents of the invention are conventional. The exact amount (effective dose) of the agent will vary from subject to subject, depending on, for example, the species, age, weight and general or clinical condition of the subject, the severity or mechanism of any disorder being treated, the particular agent or vehicle used, the method and scheduling of administration, and the like. A therapeutically effective dose can be determined empirically, by conventional procedures known to those of skill in the art. See, e.g, The Pharmacological Basis of Therapeutics, Goodman and Gilman, eds., Macmillan Publishing Co., New York. For example, an, effective dose can be estimated initially either in cell culture assays or in suitable animal models. The animal model may also be used to determine the appropriate concentration ranges and routes of administration. Such information can then be used to determine useful doses and routes for administration in humans. A therapeutic dose can also be selected by analogy to dosages for comparable therapeutic agents.
[0107] The particular mode of administration and the dosage regimen will be selected by the attending clinician, taking into account the particulars of the case (e.g., the subject, the disease, the disease state involved, and whether the treatment is prophylactic). Treatment may involve daily or multi-daily doses of compound(s) over a period of a few days to months, or even years.
[0108] In general, however, a suitable dose will be in the range of from about 0.001 to about 100 mg/kg, e.g., from about 0.01 to about 100 mg/kg of body weight per day, such as above about 0.1 mg per kilogram, or in a range of from about 1 to about 10 mg per kilogram body weight of the recipient per day. For example, a suitable dose may be about 1 mg/kg, 5 mg/kg, 10 mg/kg, 20 mg/kg, or 30 mg/kg of body weight per day.
[0109] The inhibitors are conveniently administered in unit dosage form; for example, containing 0.05 to 10000 mg, 0.5 to 10000 mg, 5 to 1000 mg, or about 100 mg of active ingredient per unit dosage form. In some embodiments, the dosage unit contains about 0.1 mg, about 0.5 mg, about 1 mg, about 10 mg, about 25 mg, about 50 mg, about 75 mg, or about 100 mg, of active ingredient.
EXAMPLES
Example I—the Toxic Core of α-Synuclein of Parkinson's Disease: Structure from Invisible Crystals
[0110] We carried out screens for crystals of peptide segments within the NAC domain and adjacent regions, seeking structural information on the molecular basis of aggregation and toxicity of α-syn.
[0111] Extensive crystal screens of two segments, NACore, residues .sup.68GAVVTGVTAVA.sup.78 (SEQ ID NO:46), and PreNAC, .sup.47GVVHGVTTVA.sup.56 (SEQ ID NO:47), seemingly produced non-crystalline, amorphous aggregates. But on examination by electron microscopy, we found the aggregates to be clusters of elongated nanocrystals only 50-300 nm in cross section and thus invisible by conventional light microcopy. We confirmed well-ordered crystallinity of NACore at both the SACLA and LCLS free electron lasers. We also found that a 9-residue fragment within the NACore, which we term SubNACore, .sup.69AVVTGVTAV.sup.77 (SEQ ID NO:48), yielded crystals 1,000-10,000 times larger in volume than the NACore nanocrystals. We were therefore able to apply synchrotron methods.sup.18,19 to these larger crystals to determine the structure of the amyloid-like fibrils. Although this 9-residue fragment is missing only two residues compared with NACore, it is not as toxic.sup.20, offering insight described below, into the toxicity of α-syn.
[0112] To determine the structure of the invisible crystals of NACore and PreNAC, we turned to MicroED .sup.21. In MicroED an extremely low dose electron beam is directed on a nanocrystal within a transmission electron microscope under cryogenic conditions, yielding diffraction patterns. At the wavelength used in our experiments at 200 keV is very small (0.025 Å) the Ewald sphere is essentially flat yielding diffraction patterns that closely resemble a 2D slice through 3D reciprocal space. As the crystal is continuously rotated in the beam, a series of such diffraction patterns is collected .sup.5. Scaling together diffraction data collected from multiple crystals produces a full 3D diffraction dataset. MicroED has been successfully applied to the well-known structures of hen egg-white lysozyme .sup.6,5, bovine liver catalase.sup.22 and Ca2+-ATPase.sup.23. But NACore and PreNAC are the first previously unknown structures determined by MicroED.
[0113] For NACore and PreNAC, we collected electron diffraction patterns from nano-crystals that lay preferentially oriented, flat on the surface of a holey carbon Quantifoil grid, in a frozen-hydrated state. Grids were first screened for appropriately sized crystals, and candidate crystals screened for diffraction. We used crystals showing strong diffraction for data collection by continuous unidirectional rotation about a fixed axis, acquiring a series of diffraction frames at fixed time intervals.sup.5. The needle-shaped crystals typically exceeded the length needed for diffraction; those that were unbent and 100 to 300 nm wide produced the best diffraction patterns. Data from multiple crystals were integrated, scaled and merged together.
[0114] The multi-crystal NACore and PreNAC datasets were phased by molecular replacement, using the atomic model of SubNACore and an ideal beta strand model, respectively, as probes. Diffraction phases calculated from the SubNACore probe structure and NACore structure factors yielded a difference density map, which clearly reveals the positions of the missing residues, after subsequent refinement, two water molecules, and several hydrogen atoms. Full models of NACore and PreNAC were refined against the MicroED data, producing structures at 1.4 Å resolution with acceptable R-factors. Electron scattering factors were used in the refinement calculations .sup.24.
[0115] The structure of the NACore peptide chain is a nearly fully extended β-strand. These NACore strands stack in-register into β-sheets, as had been predicted by site-directed spin labeling .sup.25,26. The sheets are paired, as is usual in amyloid spines, and the pairs of sheets form typical steric-zipper protofilaments, previously seen as the spines in many amyloid-like fibrils formed from short segments of fibril-forming proteins. The unusual features of this steric zipper are that the 11-residue width of the zipper is longer than we have previously observed, and each pair of sheets contains two water molecules, each associated with a threonine sidechain, within the interface instead of being completely dry. Also, in our crystals of NACore, each sheet forms two snug interfaces: Interface A with 268 Å2 of buried accessible surface area per chain, is more extensive and presumably stronger than Interface B (167 Å2), because the terminal residues of the chains in opposing sheets bend towards each other. The structure of PreNAC reveals a peptide chain that forms a β-strand kinked at residue glycine 51. These strands are arranged into pairs of β-sheets that like the NACore structure interdigitate to form steric zipper protofilaments (
[0116] The relevance of the structure of NACore to fibrils of full length α-syn is established by the resemblance of their diffraction patterns. Specifically, the fiber diffraction pattern of aligned fibrils of full-length and N-terminally acetylated.sup.27 α-syn protein display the same principal peaks as the diffraction of aligned NACore nanocrystals. All three fibrils display the strong reflection at 2.4 Å in their diffraction patterns. This reflection arises in NACore because one β-sheet of the steric zipper is translated along the fiber axis with respect to the other β-sheet by 2.4 Å, one half the 4.8 Å spacing between β-strands, permitting the two sheets to interdigitate tightly together. All three share a strong 4.6 Å reflection, which in NACore results from both the stacking of β-strands and the staggering between adjacent β-sheets of the steric zipper, while a shared reflection at near 8.2 Å likely arises from the distance between the adjacent pairs of β-sheets that make up the α-syn fibril. This comparison of fiber diffraction patterns strongly suggests that the structure of NACore is similar to the spine of our toxic fibrils of full α-syn.
[0117] The combined structures of NACore and PreNAC allow us to construct a speculative model for much of the ordered segments of the A53T early onset mutant α-syn. Experimental support of this model comes from the agreement of its simulated fiber diffraction with the measured diffraction patterns of α-syn and N-acetyl α-syn fibrils as well as aligned NACore nanocrystals. Above we noted that the weaker Interface B of NACore mimics a hypothetical interaction of PreNAC with NACore. In fact, the interacting sidechains in the weaker NACore Interface B (G73, T75, and V77) are identical to the sidechains (G51, T53, V55) interacting in the hypothetical interface of PreNAC with NACore.
[0118] The identity and structure of the cytotoxic amyloid formed by α-syn remains a subject of intensive research .sup.17,28,29,30,31,32. The weight of evidence over the past decade has tilted scientific opinion from the fully developed amyloid fibrils found in Lewy bodies as the toxic entities to smaller, transient amyloid oligomers. Yet recently, quantitative arguments have been put forward in favor of fibrils .sup.33. Without wishing to be bound by any particular mechanism, it is suggested that our experiments of the cytotoxicity of NACore on neuroblastoma cells are consistent with the view that fibrils are toxic: we find that NACore shaken and aggregated for 72 hours displays abundant fibrils, is more toxic than freshly dissolved NACore and is comparably toxic to similarly aggregated full α-syn. We also find greater cytotoxicity of NACore than SubNACore, which is shorter by two residues. This is consistent with the more rapid fibril formation of NACore than of SubNACore. These observations do not rule out the formation of a non-fibrillar, oligomeric assembly, present, but invisible, in our aggregated samples of NACore and α-syn. Of course, NACore is merely a fragment of full length α-syn, and lacks most of the membrane-binding motifs of the N-terminus of the protein which have been implicated in membrane disruption .sup.34,35. Yet it is clear that NACore is the minimum entity that recapitulates all the features of full length α-syn aggregation and toxicity.
[0119] The miniscule size of NACore is typical of amyloid crystals and also of various other biological crystals of interest. For amyloid crystals, our speculation is that the tiny size is a consequence of the natural twist of β-sheets that form the protofilaments of the fibrils. The crystal lattice restrains the twist, creating a strain in these crystals, which increases as crystals grow. Eventually this strain prevents further addition of β-strands, limiting the thickness of the needle crystals. In our experience, longer segments (for example, 11 residues compared to 9 residues) limit crystal growth even more; in the case of 11-residue NACore and 10-residue PreNAC, the strain produces nanocrystals, invisible by optical microscopy. These crystals are too small for mounting and conventional synchrotron data collection, but are ideally suited for analysis by MicroED. Our structures of NACore and PreNAC demonstrate that
[0120] MicroED is capable of determining new and accurate structures of biological material at atomic resolution. This finding paves the path for applications of MicroED to other biological substances of importance, for which only nanocrystals can be grown. In our particular application, we have been able to learn the atomic arrangement of the core of the crucial NAC domain. This opens opportunities for structure-based design of inhibitors of amyloid formation of α-syn .sup.36.
Methods
Crystallization
[0121] Microcrystals of SubNACore, .sup.69AVVTGVTAV.sup.77 (SEQ ID NO:48), were grown from synthetic peptide purchased from CS Bio. Crystals were grown at room temperature by hanging drop vaporization. Lyophilized peptide was dissolved in water at 2.9 mg/ml concentration in 48 mM lithium hydroxide. Peptide was mixed in a 2:1 ratio with reservoir containing 0.9 M ammonium phosphate, and 0.1M sodium acetate pH 4.6.
[0122] Nanocrystals of NACore, .sup.68GAVVTGVTAV.sup.78 (SEQ ID NO:46), were grown from synthetic peptide purchased from CS Bio. Ten batches of synthesized peptide (CSBio) at a concentration of 1 mg/ml in sterile water were shaken at 37° C. on a Torrey Pines orbital mixing plate at speed setting 9, overnight. The insoluble material was washed in 30% (w/v) glycerol then stored in water at room temperature before diffraction. The sample contained a mixture of fibrils and crystals.
Nanocrystals of PreNAC, .sup.47GVVHGVTTVA.sup.56 (SEQ ID NO:47), were grown from synthetic peptide purchased from InnoPep. Crystallization trials of synthesized peptide were prepared in batch. Peptide was weighed and dissolved in sterile-filtered 50 mM phosphate buffer pH 7.0 with 0.1% DMSO at a concentration of 5 mg/ml. This solution was shaken at 37° C. on a Torrey Pines orbital mixing plate at speed setting 9, overnight.
Data Collection and Processing
[0123] X-ray diffraction data from microcrystals of SubNACore were collected using synchrotron radiation at the Advanced Photon Source, Northeast Collaborative Access Team microfocus beamline 24-ID-E. The beamline was equipped with an ADSC Quantum 315 CCD detector. Data from a single crystal were collected in 5° wedges at a wavelength of 0.9791 Å using a 5 μm beam diameter. We used data from three different sections along the needle axis. The crystals were cryo-cooled (100 K) for data collection. Data were processed and reduced using Denzo/Scalepack from the HKL suite of programs.sup.37.
[0124] X-ray diffraction data from nanocrystals of NACore were collected using XFEL radiation at the CXI instrument (Coherent X-ray Imaging) at the Linear Coherent Light Source (LCLS)-SLAC. The photon energy of the X-ray pulses was 8.52 keV (1.45 Å). Each 40 fs pulse contained up to 6×1011 photons at the sample position taking into account a beamline transmission of 60%. The diameter of the beam was approximately 1 μm. We used a concentration of approximately 25 μl of pelleted material suspended in 1 mL water. The sample was injected into the XFEL beam using a liquid jet injector and a gas dynamic virtual nozzle.sup.38. The micro jet width was approximately 4 μm and the flow rate was 40 μl/min. The sample caused noticeable sputtering of the liquid jet. XFEL data were processed using cctbx.xfel .sup.39,40.
[0125] Electron diffraction data from nanocrystals of NACore and PreNAC were collected using MicroED techniques.sup.5,6. These nanocrystals typically clump together. To break up the clumps, an approximately 100 μL volume of nanocrystals was placed in a sonication bath for 30 minutes. Nanocrystals were deposited onto a quantifoil holey-carbon EM grid in a 2-3p1 drop after appropriate dilution, which optimized for crystal density on the grid. All grids were then blotted and vitrified by plunging into liquid ethane using a Vitrobot Mark IV (FEI), then transferring to liquid nitrogen for storage. Frozen hydrated grids were transferred to a cryo-TEM using a Gatan 626 cryo-holder. Diffraction patterns and crystal images were collected using an FEG-equipped FEI Tecnai F20 TEM operating at 200 kV and recorded using a bottom mount TVIPS F416 CMOS camera with a sensor size of 4000 squared pixels, each 15.6 μm in size per square dimension. Diffraction patterns were recorded by operating the detector in rolling shutter mode with 2×2 pixel binning, producing a final image 2000 squared pixels in size. Individual image frames were taken with exposure times of 3-4 seconds per image, using a selected area aperture with an illuminating spot size of approximately one micron. This geometry equates to an electron dose of less than 0.1 e−/Å2 per second. During each exposure, crystals were continuously rotated within the beam at a rate of 0.3° per second, corresponding to 1.2° wedge per frame. Diffraction data were collected from several crystals each oriented differently with respect to the rotation axis. These data sets each spanned wedges of reciprocal space ranging from 40° to 80°.
[0126] Calibration of the sample to detector distance was accomplished using a polycrystalline gold standard and by referencing the prominent reflections in the electron diffraction experiment with the corresponding reflections in the XFEL data. Calibration of the x/y locations of the 64-tile CSPAD detector was performed by cctbx.xfel by refining the optically measured tile positions against a thermolysin data set.sup.39.
[0127] To gain compatibility with conventional X-ray data processing programs, the diffraction images were converted from tiff or TVIPS format to the SMV crystallographic format. We used XDS to index the diffraction images.sup.41, and XSCALE for merging and scaling together data sets originating from different crystals. For NACore, data from four crystals were merged, while for PreNAC, data from three crystals were merged to assemble the final data sets.
Structure Determination
[0128] The molecular replacement solution for SubNACore was obtained using the program Phaser 42. The search model consisted of a geometrically ideal β-strand composed of nine alanine residues. Crystallographic refinements were performed with the program REFMAC .sup.43. The molecular replacement solution for NACore was obtained using the program Phaser 42. The search model consisted of the SubNACore structure determined previously. Crystallographic refinements were performed with the program Phenix .sup.44. The molecular replacement solution for PreNAC was obtained using the program Phaser .sup.42. The search model consisted of a geometrically ideal β-strand composed of six residues with sequence GVTTVA. Crystallographic refinements were performed with the program Phenix .sup.44.
[0129] Model building for all segments was performed using COOT .sup.45. The coordinates of the final models and the structure factors have been deposited in the Protein Data Bank with PDB code 4RIK for SubNACore, 4RIL for NACore, and 4ZNN for PreNAC. The structures were illustrated using Pymol .sup.46.
α-synuclein
[0130] The human wild type α-syn construct was previously characterized.sup.47 (pRK172, ampicillin, T7 promoter) with sequence:
TABLE-US-00004 (SEQ ID NO: 1) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA.
α-synuclein Purification
[0131] Full length α-syn was purified according to published protocols.sup.31. The α-syn construct was transformed into E. coli expression cell line BL21 (DE3) gold (Agilent Technologies, Santa Clara, Calif.) for wild type α-syn protein expression. A single colony was incubated into 100 mL LB Miller broth (Fisher Scientific, Pittsburgh, Pa.) supplemented with 100 μg/mL ampicillin (Fisher Scientific, Pittsburgh, Pa.) and grown overnight at 37° C. One liter of LB Miller supplemented with 100 μg/mL ampicillin in 2 L shaker flasks was incubated with 10 mL of overnight culture and grown at 37° C. until the culture reached an OD600 ˜0.6-0.8 as measured by a BioPhotometer UV/VIS Photometer (Eppendorf, Westbury, N.Y.). IPTG (Isopropyl β-D-1-thiogalactopyranoside) was added to a final concentration of 0.5 mM, and grown for 4-6 hours at 30° C. Cells were harvested by centrifugation at 5,500×g for 10 minutes at 4° C. The cell pellet was frozen and stored at −80° C.
[0132] The cell pellet was thawed on ice and resuspended in lysis buffer (100 mM Tris-HCl pH 8.0, 500 mM NaCl, 1 mM EDTA pH 8.0) and lysed by sonication. Crude cell lysate was clarified by centrifugation at 15,000×g for 30 minutes at 4° C. The clarified cell lysate was boiled and cell debris was removed by centrifugation. Protein in the supernatant was precipitated in acid at pH 3.5 through addition of HCl by titration to protein solution on ice while stirring then centrifuged for an additional 15,000×g for 30 minutes at 4° C. Supernatant was dialyzed against buffer A (20 mM Tris-HCl, pH 8.0). After dialysis the solution was filtered through a 0.45 μm syringe (Corning, N.Y. 14831) before loading onto a 20 mL HiPrep Q HP 16/10 column (GE Healthcare, Piscataway, N.J.). The Q-HP column was washed with five column volumes of buffer A and protein eluted using a linear gradient to 100% in five column volumes of buffer B (20 mM Tris-HCl, 1M NaCl, pH 8.0). Protein eluted at around 50-70% buffer B; peak fractions were pooled. Pooled samples were concentrated approximately tenfold using Amicon Ultra-15 centrifugal filters. Approximately 5 ml of the concentrated sample was loaded onto a HiPrep 26/60 Sephacryl S-75 HR column equilibrated with filtration buffer (25 mM sodium phosphate, 100 mM NaCl, pH 7.5). Peak fractions were pooled from the gel filtration column and dialyzed against 5 mM Tris-HCl, pH 7.5, concentrated to 3 mg/ml. These were filtered through a 0.2 μm pore size filter (Corning, N.Y. 14831) and stored at 4° C.
[0133] Recombinantly expressed full-length α-syn with an N-terminal acetylation was prepared and purified in the following way based on a protocol by Der-Sarkissian et al.sup.25
The α-syn plasmid was co-expressed with a heterodimeric protein acetylation complex from S. pombe to acetylate the N-terminus (pACYC-DUET, chloramphenicol, T7 promoter).sup.48. The two vectors were co-transformed into E. coli BL21 (DE3) using media containing both ampicillin and chloramphenicol. Cell cultures were grown in TB media containing ampicillin and chloramphenicol and induced to express α-syn with 0.5 mM IPTG overnight at 25° C. Cells were harvested by centrifugation, the cell pellet then resuspended in lysis buffer (100 mM Tris-HCl pH 8.0, 500 mM NaCl, 1 mM EDTA pH 8.0, and 1 mM phenylmethylsulfonyl fluoride) and cells lysed using an Emulsiflex homogenizer (Avestin). The lysate was boiled and debris removed by centrifugation. A protein fraction was also removed by precipitation at low pH on ice followed by centrifugation. The remaining supernatant was pH adjusted by titration and dialyzed against Buffer A (20 mM Tris-HCl, pH 8.0, 1 mM DTT, 1 mM EDTA, pH 8.0). The resulting protein solution was loaded onto a 5 mL Q-Sepharose FF column (GE Healthcare) equilibrated with Buffer A and eluted against a linear gradient of Buffer B (1M NaCl, 20 mM Tris-HCl, pH 8.0, 1 mM DTT, 1 mM EDTA, pH 8.0). Fractions containing α-syn were identified using SDS-PAGE, collected, concentrated and further purified by size exclusion (Sephacryl S-100 16/60, GE Healthcare) in 20 mM Tris pH 8.0, 100 mM NaCl, 1 mM DTT, 1 mM EDTA. Purity of fractions was assessed by SDS-PAGE.
[0134] Acetylated protein was characterized by LC-MS27,.sup.49. Expected average mass: 14460.1 Da for alpha-synuclein and 14502.1 for acetylated alpha-synuclein. Observed average mass: 14464.0 Da for alpha-synuclein and 14506.0 for acetylated alpha-synuclein. The shift of 4 Da between observed and expected average masses is due to instrumental error.
Inhibitor Synthesis
[0135] Inhibitors were commercially obtained from Genscript Inc. at greater than 98% purity and solubilized in 100% DMSO at 10 mM concentration. Solubilized inhibitors were filtered with 0.1 μM filter and stored at −20° C. in 20 μL aliquots until further use.
Thioflavin T Assays
[0136] Fibril formation assays were performed with 50 μM protein concentration in conditions identical to those used for aggregating proteins for seeding assay, but with the addition of ThT. All assays were carried out in black Nunc 96-well optical bottom plates (Thermo Scientific). Plates were agitated at 600 rpm in 3-mm rotation diameter in a Varioskan microplate reader (Thermo) at 37° C. Fluorescence measurements were recorded every 30 mins using λ.sub.ex=444 nm, λ.sub.em=482 nm, with an integration time of 200 μs.
Aggregation Assays
[0137] Purified α-synuclein was dialyzed in 0.1 M sodium sulfate, 25 mM sodium phosphate and aggregated by shaking in Torrey Pine shakers at 50 μM at 37° C. at speed 9 for 5-6 days.
Extraction of Sarkosyl Insoluble Protein Filaments from PD Human Brain Tissues
[0138] Human frozen brain tissues were obtained from UCLA Brain Tumor Translational Resource (BTTR). Sarkosyl insoluble protein was extracted using previously described protocols. Briefly, frozen tissue was homogenized in ice cold PBS using a dounce homogenizer at 200 mg/mL. The homogenate was then diluted in buffer A (10 mM Tris 7.4, 800 mM NaCl, 1 mM EGTA, 10% Sucrose) to 50 mg/mL in total volume of 1 mL and centrifuged at 20,700 g for 20 min at 4° C. The supernatant was collected in an ultracentrifuge tube and pellet was resuspended in 0.5 mL buffer A followed by centrifugation at 20,700 g for 20 mins at 4° C. The supernatants pooled together. 150 μl 10% sarkosyl (w/v) in Millipore water was then added and incubated for 1 h at room temperature on flat rotating shaker at 700 rpm. The solution was then centrifuged at 100,000 g for 1 h at 4° C. using SW 55 Rotor (Beckman Coulter). The supernatanat was discarded and pellet was washed with 5 mL Buffer A and centrifuged at 100,000 g for 20 mins at 4° C. The pellet was resuspended in 100 μl 50 mM Tris Ph 7.4
HEK 293T Cell Culture
[0139] HEK293T cells that stably express YFP labeled WT α-syn and A53T α-syn were a generous gift from Dr. Marc Diamond. Cells were grown in Dulbecco's modified Eagle's medium (Gibco) supplemented with 10% fetal bovine serum (HyClone), 1% penicillin/streptomycin (Gibco), and 1% glutamax (Gibco) in a humidified incubator in 37° C., 5% CO2.
Seeding in HEK293T Cells
[0140] 10,000 cells in 90 μL media were plated in 96 well black wall plate (Cat #3660) and allowed to adhere overnight. α-syn was transfected at a final monomer concentration of 125 nM. Lipofectamine 2000 was diluted in OptiMEM media (2.5+17.5 μL) and incubated at room temperature for 5 mins. Protein aggregates were diluted in OptiMEM media (1:20) and sonicated in a water bath sonicator for 3 mins at low pulse. Diluted lipofectamine and protein samples were then mixed 1:1 and incubated at room temperature for 20 mins and thereafter 10 μL was added to each well. All samples are added in triplicates and experiments were repeated a minimum of two times. For co-transfection of α-syn fibrils with inhibitors, the fibrils and inhibitors were diluted in OptiMEM and incubated for 3 hours followed by sonication.
Measurement of Intracellular Puncta in Cells
[0141] Puncta formation and cell growth was measured using Celigo Imaging Cell Cytometer allowing for unbiased measurement. Wells were imaged using fluorescent GFP channel and confluence was measured using Celigo analysis software. Images of entire well were taken and particles counted by ImageJ by particle analysis. Same settings were used to analyze wells of one plate at all days. Total particles counted in each well were normalized against the confluence and reported as particles per well.
Fibril Formation and Detection
[0142] Purified α-syn in 50 mM Tris, 150 mM KCl pH 7.5 was shaken at a concentration of 500 μM at 37° C. in Torey Pine shaker. To form the fibrillar samples of SubNACore and NACore, lyophilized peptides were dissolved to a final concentration of 500 μM in 5 mM lithium hydroxide, 20 mM sodium phosphate pH 7.5 and 0.1 M NaCl All samples were shaken at 37° C. in a Torey Pine shaker for 72 hours. Freshly dissolved samples were prepared by dissolving lyophilized peptides immediately prior to addition to cells for assays.
[0143] Turbidity measurements were used to compare NACore and SubNACore aggregation. Peptide samples were freshly dissolved to 1.6 mM in a sample buffer with 5 mM LiOH and 1% DMSO and then filtered through a PVDF filter (Millipore, 0.1 μm). Measurements were performed using a black NUNC 96 well plate with 2004, of sample/well (3-4 replicates per sample). The plate was agitated at 37° C., with a 3 mm rotation diameter, at 300 rpm in a Varioskan microplate reader (Thermo). Absorbance readings were recorded every 3-15 minutes at 340 nm.
Negative Stain Transmission Electron Microscopy
[0144] Cytotxicity samples were evaluated for presence of fibrils by electron microscopy. Briefly, 5 μL samples were spotted directly on freshly glow-discharged carbon-coated electron microscopy grids (Ted Pella, Redding, Calif.). After 4 min incubation, grids were rinsed twice with 5-4, distilled water and stained with 2% uranyl acetate for 1 min. Specimens were examined on an FEI T12 electron microscope.
Fibril Diffraction
[0145] Fibrils formed from purified α-syn with and without N-terminal acetylation were concentrated by centrifugation, washed, and oriented while drying between two glass capillaries. Likewise, NACore nanocrystals were also concentrated, washed, and allowed to orient while drying between two glass capillaries. Aligned fibrils or nanocrystals were mounted onto a cryopin for diffraction using 1.54 Å x-rays produced by a Rigaku rotating anode generator equipped with an HTC imaging plate and a built in X-Stream cryocooling device. All patterns were collected at a distance of 180 mm and analyzed using the Adxv software package.
Cytotoxicity Assays
[0146] Adherent PC12 cells were cultured in ATCC-formulated RPMI 1640 medium (ATCC; cat. #30-2001) supplemented with 10% horse serum and 5% fetal bovine serum and plated at 10,000 per well to a final volume of 90 μl. All MTT assays were performed with Cell Titer 96 aqueous non-radioactive cell proliferation kit (MTT, Promega cat #4100). Cells were cultured in 96-well plates for 20h at 37° C. in 5% CO2 prior to addition of samples (Costar cat. #3596). 10 μL of sample was added to each well containing 90 μL medium and incubated for 24h at 37° C. in 5% CO2. Then, 15 μL dye solution (Promega cat #4102) was added into each well, followed by incubation for 4h at 37° C. in 5% CO2. This was followed by the addition of 100 μl solubilization Solution/Stop Mix (Promega cat #4101) to each well. After 12h incubation at room temperature, the absorbance was measured at 570 nm. Background absorbance was recorded at 700 nm. The data was normalized with cells treated with 1% (w/v) SDS to 0% reduction, and cells treated with sample buffer to 100% reduction.
[0147] Lactose dehydrogenase assays were done using CytoTox-ONE™ Homogeneous Membrane Integrity, (Promega, cat #G7890) as per manufacturers instructions. Briefly, cells were plated in 96 well black-wall, clear bottom (Fisher Cat #07-200-588) tissue culture plates at 10,000 cells per well to a final volume of 90 μL. Cells were incubated for an additional 20h at 37° C. in 5% CO2 prior to addition of samples. Next, 10 μl of sample was added to each well following which the cells were incubated for another 24 hours. 100 μl of reagent was added to each well and incubated for 15 mins at room temperature. The addition of 50 μL of stop solution stopped the reaction. Fluorescence was measured using excitation and emission wavelengths of 560 nm and 590 nm, respectively. Data was normalized using cells treated with buffer as 0% release and 0.1% triton X-100 as 100% release.
[0148] The atomic coordinates of the structure of NACore: GAVVTGVTAVA (SEQ ID NO:46) below are in Table 3. The atomic coordinates of PreNAC below are in Table 4.
[0149] The atomic structure of NACore reveals an amyloid fibril formed from a self-complementary pair of β-sheets, tightly mating to form a steric zipper. By Rossetta-based computational modeling, each of the inhibitors was designed to bind to the tip of the steric zipper and thus ‘cap’ the fibrils, preventing further molecules of alpha-synuclein to add to the fibrils. We designed 3 candidate inhibitors; S37, S61 and S71 that bind favorably to one or both ends of the zipper. The computed binding energies and shape complementarity of each of the three inhibitors with the fibril are also favorable for binding. Each of the inhibitors retains most residues of the native sequence of NACore but also contain one or more modified residues. Rodriquez et al. showed that a smaller 9-residue segment within NACore [69-77] aggregates slower than NACore and the structure is similar to NACore. In order to prevent the self-aggregation of our designed inhibitors, we used the shorter segment along with one or more modifications. S37 has a W mutation at Thr72 and an additional poly-lysine tag at the C-terminus to induce charge-charge repulsion. It is predicted to bind both tips of the steric zipper fibril (i.e. top and bottom). S61 and S62 retain the same inhibitor sequence as S37 but instead of poly-lysine tag, a TAT tag is added to aid solubility and prevent self-aggregation. S71 has a methylated glycine at Gly73 that weakens hydrogen bonding along the β-sheet and an additional TAT tag for solubility and cell penetration.
Example II: Computational Design
[0150] Based on the atomic structure of a fiber forming segment of α-synuclein, we designed a series of inhibitors that inhibit aggregation. We designed peptidic inhibitors to specifically “cap” the growing aggregates of α-synuclein. Using the ZipperDB algorithm (Goldschmidt et al..sup.55), the crystallizable amyloid-forming segments in the NAC domain were identified. This domain has been reported to be necessary and sufficient for aggregation and toxicity of α-synuclein (Bodies et al. .sup.20). The identified segments (α-synuclein segments comprised of residues 69-77 and residues 68-78) were chemically synthesized and crystallized; their three-dimensional structures were determined by micro-crystallography and micro-electron diffraction (MicroED). We then applied a Rosetta-based method (Sievers et al. .sup.36) in their steps to design inhibitors that disrupt α-synuclein aggregation, using the α-synuclein 69-77 structure or the α-synuclein 68-78 structure as a template. Putative inhibitors were identified and selected for experimental characterization.
Example III—Second Round of Design—Rational, Sequence-Based Design
[0151] In another round of design, we started from several alpha-synuclein amyloidogenic segments: 47-56, 68-78 and 84-94. N-methylation was introduced at two separate residues in the native amino acid sequence. In these N-methyl amino acids, an additional methyl group replaces the amine hydrogen. Thus it blocks the hydrogen bond and prevents the addition of peptide monomers on its growing end. In addition to N-methylation, additional polar/charged amino acid extensions from native alpha-synuclein sequence were considered to improve the overall solubility of the peptide inhibitor.
TABLE-US-00005 TABLE 3 TITLE ELECTRON DIFFRACTION STRUCTURE OF THE PARKINSON'S DISEASE TOXIC CORE TITLE 2 OF ALPHA-SYNUCLEIN AMYLOID, GAVVTGVTAVA COMPND MOL_ID: 1; COMPND 2 MOLECULE: ALPHA-SYNUCLEIN; COMPND 3 CHAIN: A; COMPND 4 SYNONYM: NON-A BETA COMPONENT OF AD AMYLOID, NON-A4 COMPONENT OF COMPND 5 AMYLOID PRECURSOR, NACP; COMPND 6 ENGINEERED: YES SOURCE MOL_ID: 1; SOURCE 2 SYNTHETIC: YES; SOURCE 3 ORGANISM_SCIENTIFIC: HOMO SAPIENS; SOURCE 4 ORGANISM_COMMON: HUMAN; SOURCE 5 ORGANISM_TAXID: 9606; SOURCE 6 OTHER_DETAILS: SYNTHETIC PEPTIDE GAVVTGVTAVA CORRESPONDING TO SOURCE 7 SEGMENT 68-78 OF HUMAN ALPHA-SYNUCLEIN KEYWDS AMYLOID, ALPHA-SYNUCLEIN, PARKINSON'S DISEASE, TOXIC CORE, NACORE, KEYWDS 2 LIPID BINDING PROTEIN EXPDTA ELECTRON CRYSTALLOGRAPHY AUTHOR J. A. RODRIGUEZ, M. IVANOVA, M. R. SAWAYA, D. CASCIO, F. REYES, D. SHI, L. JOHNSON, AUTHOR 2 E. GUENTHER, S. SANGWAN, J. HATTNE, B. NANNENGA, A. S. BREWSTER, AUTHOR 3 M. MESSERSCHMIDT, S. BOUTET, N. K. SAUTER, T. GONEN, D. S. EISENBERG JRNL AUTH J. A. RODRIGUEZ, M. IVANOVA, M. R. SAWAYA, D. CASCIO, F. REYES, D. SHI, JRNL AUTH 2 L. JOHNSON, E. GUENTHER, S. SANGWAN, J. HATTNE, B. NANNENGA, JRNL AUTH 3 A. S. BREWSTER, M. MESSERSCHMIDT, S. BOUTET, N. K. SAUTER, T. GONEN, JRNL AUTH 4 D. S. EISENBERG JRNL TITL MICROED STRUCTURE OF THE TOXIC CORE OF ALPHA-SYNUCLEIN JRNL TITL 2 AMYLOID, THE PROTEIN ASSOCIATED WITH THE DEVELOPMENT OF JRNL TITL 3 PARKINSONS DISEASE JRNL REF TO BE PUBLISHED JRNL REFN REMARK 2 REMARK 2 RESOLUTION. 1.43 ANGSTROMS. REMARK 3 REMARK 3 REFINEMENT. REMARK 3 PROGRAM: BUSTER REMARK 3 AUTHORS: BRICOGNE, BLANC, BRANDL, FLENSBURG, KELLER, REMARK 3: PACIOREK, ROVERSI, SMART, VONRHEIN, WOMACK, REMARK 3: MATTHEWS, TEN EYCK, TRONRUD REMARK 3 REMARK 3 DATA USED IN REFINEMENT. REMARK 3 RESOLUTION RANGE HIGH (ANGSTROMS): 1.43 REMARK 3 RESOLUTION RANGE LOW (ANGSTROMS): 16.43 REMARK 3 DATA CUTOFF (SIGMA (F)): 0.000 REMARK 3 COMPLETENESS FOR RANGE (%): 87.9 REMARK 3 NUMBER OF REFLECTIONS: 1073 REMARK 3 REMARK 3 FIT TO DATA USED IN REFINEMENT. REMARK 3 CROSS-VALIDATION METHOD: THROUGHOUT REMARK 3 FREE R VALUE TEST SET SELECTION: RANDOM REMARK 3 R VALUE (WORKING + TEST SET): 0.251 REMARK 3 R VALUE (WORKING SET): 0.248 REMARK 3 FREE R VALUE: 0.275 REMARK 3 FREE R VALUE TEST SET SIZE (%): 11.840 REMARK 3 FREE R VALUE TEST SET COUNT: 127 REMARK 3 ESTIMATED ERROR OF FREE R VALUE: NULL REMARK 3 REMARK 3 FIT IN THE HIGHEST RESOLUTION BIN. REMARK 3 TOTAL NUMBER OF BINS USED: 5 REMARK 3 BIN RESOLUTION RANGE HIGH (ANGSTROMS): 1.43 REMARK 3 BIN RESOLUTION RANGE LOW (ANGSTROMS): 1.60 REMARK 3 BIN COMPLETENESS (WORKING + TEST ) (%): 87.88 REMARK 3 REFLECTIONS IN BIN (WORKING + TEST SET): 286 REMARK 3 BIN R VALUE (WORKING + TEST SET): 0.2642 1 REMARK 3 REFLECTIONS IN BIN (WORKING SET): 245 REMARK 3 BIN R VALUE (WORKING SET): 0.2532 REMARK 3 BIN FREE R VALUE: 0.3310 REMARK 3 BIN FREE R VALUE TEST SET SIZE (%): 14.34 REMARK 3 BIN FREE R VALUE TEST SET COUNT: 41 REMARK 3 ESTIMATED ERROR OF BIN FREE R VALUE: NULL REMARK 3 REMARK 3 NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT. REMARK 3 PROTEIN ATOMS: 66 REMARK 3 NUCLEIC ACID ATOMS: 0 REMARK 3 HETEROGEN ATOMS: 0 REMARK 3 SOLVENT ATOMS: 2 REMARK 3 REMARK 3 B VALUES. REMARK 3 FROM WILSON PLOT (A**2): 10.33 REMARK 3 MEAN B VALUE (OVERALL, A**2): 12.75 REMARK 3 OVERALL ANISOTROPIC B VALUE. REMARK 3 B11 (A**2): −3.98760 REMARK 3 B22 (A**2): 3.49080 REMARK 3 B33 (A**2): 0.49680 REMARK 3 B12 (A**2): 0.00000 REMARK 3 B13 (A**2): −1.55090 REMARK 3 B23 (A**2): 0.00000 REMARK 3 REMARK 3 ESTIMATED COORDINATE ERROR. REMARK 3 ESD FROM LUZZATI PLOT (A): 0.305 REMARK 3 DPI (BLOW EQ-10) BASED ON R VALUE (A): NULL REMARK 3 DPI (BLOW EQ-9) BASED ON FREE R VALUE (A): NULL REMARK 3 DPI ( CRUICKSHANK) BASED ON R VALUE (A): 0.108 REMARK 3 DPI (CRUICKSHANK) BASED ON FREE R VALUE (A): NULL REMARK 3 REMARK 3 REFERENCES: BLOW, D. (2002) ACTA CRYST D58, 792-797 REMARK 3 CRUICKSHANK, D. W. J. (1999) ACTA CRYST D55, 583-601 REMARK 3 REMARK 3 CORRELATION COEFFICIENTS. REMARK 3 CORRELATION COEFFICIENT FO-FC: 0.913 REMARK 3 CORRELATION COEFFICIENT FO-FC FREE: 0.900 REMARK 3 REMARK 3 NUMBER OF GEOMETRIC FUNCTION TERMS DEFINED: 15 REMARK 3 TERM COUNT WEIGHT FUNCTION. REMARK 3 BOND LENGTHS: 65; 2.000; HARMONIC REMARK 3 BOND ANGLES: 90; 2.000; HARMONIC REMARK 3 TORSION ANGLES: 16; 2.000; SINUSOIDAL REMARK 3 TRIGONAL CARBON PLANES: 1; 2.000; HARMONIC REMARK 3 GENERAL PLANES: 10; 5.000; HARMONIC REMARK 3 ISOTROPIC THERMAL FACTORS: 65; 20.000; HARMONIC REMARK 3 BAD NON-BONDED CONTACTS: NULL; NULL; NULL REMARK 3 IMPROPER TORSIONS: NULL; NULL; NULL REMARK 3 PSEUDOROTATION ANGLES: NULL; NULL; NULL REMARK 3 CHIRAL IMPROPER TORSION: 11; 5.000; SEMIHARMONIC REMARK 3 SUM OF OCCUPANCIES: NULL; NULL; NULL REMARK 3 UTILITY DISTANCES: NULL; NULL; NULL REMARK 3 UTILITY ANGLES: NULL; NULL; NULL REMARK 3 UTILITY TORSION: NULL; NULL; NULL REMARK 3 IDEAL-DIST CONTACT TERM: 76; 4.000; SEMIHARMONIC REMARK 3 REMARK 3 RMS DEVIATIONS FROM IDEAL VALUES. REMARK 3 BOND LENGTHS (A): 0.010 REMARK 3 BOND ANGLES (DEGREES): 1.65 REMARK 3 PEPTIDE OMEGA TORSION ANGLES (DEGREES): 4.08 REMARK 3 OTHER TORSION ANGLES (DEGREES): 6.49 REMARK 3 REMARK 3 TLS DETAILS REMARK 3 NUMBER OF TLS GROUPS: NULL 2 REMARK 3 REMARK 3 OTHER REFINEMENT REMARKS: NULL REMARK 4 REMARK 4 4RIL COMPLIES WITH FORMAT V. 3.30, 13-JUL-11 REMARK 100 REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 09-OCT-14. REMARK 100 THE RCSB ID CODE IS RCSB087390. REMARK 240 REMARK 240 EXPERIMENTAL DETAILS REMARK 240 RECONSTRUCTION METHOD: NULL REMARK 240 SAMPLE TYPE: NULL REMARK 240 SPECIMEN TYPE: NULL REMARK 240 DATA ACQUISITION REMARK 240 DATE OF DATA COLLECTION: 28-AUG-14 REMARK 240 TEMPERATURE (KELVIN): 100.0 REMARK 240 PH: NULL REMARK 240 NUMBER OF CRYSTALS USED: 4 REMARK 240 MICROSCOPE MODEL: TECNAI F20 TEM REMARK 240 DETECTOR TYPE: TVIPS F416 CMOS CAMERA REMARK 240 ACCELERATION VOLTAGE (KV): NULL REMARK 240 NUMBER OF UNIQUE REFLECTIONS: 1073 REMARK 240 RESOLUTION RANGE HIGH (A): 1.430 REMARK 240 RESOLUTION RANGE LOW (A): 16.430 REMARK 240 DATA SCALING SOFTWARE: XSCALE REMARK 240 COMPLETENESS FOR RANGE (%): 89.9 REMARK 240 DATA REDUNDANCY: 4.400 REMARK 240 IN THE HIGHEST RESOLUTION SHELL REMARK 240 HIGHEST RESOLUTION SHELL, RANGE HIGH (A): 1.43 REMARK 240 HIGHEST RESOLUTION SHELL, RANGE LOW (A): 1.60 REMARK 240 COMPLETENESS FOR SHELL (%): 82.5 REMARK 240 DATA REDUNDANCY IN SHELL: 4.40 REMARK 240 R MERGE FOR SHELL (I): 0.56500 REMARK 240 METHOD USED TO DETERMINE THE STRUCTURE: MOLECULAR REPLACEMENT REMARK 240 SOFTWARE USED: PHASER REMARK 240 STARTING MODEL: 4RIK REMARK 290 REMARK 290 CRYSTALLOGRAPHIC SYMMETRY REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: C 1 2 1 REMARK 290 REMARK 290 SYMOP SYMMETRY REMARK 290 NNNMMM OPERATOR REMARK 290 1555 X, Y, Z REMARK 290 2555 −X, Y, −Z REMARK 290 3555 X + 1/2, Y + 1/2, Z REMARK 290 4555 −X + 1/2, Y + 1/2, −Z REMARK 290 REMARK 290 WHERE NNN −> OPERATOR NUMBER REMARK 290 MMM −> TRANSLATION VECTOR REMARK 290 REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY REMARK 290 RELATED MOLECULES. REMARK 290 SMTRY1 1 1.000000 0.000000 0.000000 0.00000 REMARK 290 SMTRY2 1 0.000000 1.000000 0.000000 0.00000 REMARK 290 SMTRY3 1 0.000000 0.000000 1.000000 0.00000 REMARK 290 SMTRY1 2 −1.000000 0.000000 0.000000 0.00000 REMARK 290 SMTRY2 2 0.000000 1.000000 0.000000 0.00000 REMARK 290 SMTRY3 2 0.000000 0.000000 −1.000000 0.00000 REMARK 290 SMTRY1 3 1.000000 0.000000 0.000000 35.40500 REMARK 290 SMTRY2 3 0.000000 1.000000 0.000000 2.41000 REMARK 290 SMTRY3 3 0.000000 0.000000 1.000000 0.00000 REMARK 290 SMTRY1 4 −1.000000 0.000000 0.000000 35.40500 REMARK 290 SMTRY2 4 0.000000 1.000000 0.000000 2.41000 3 REMARK 290 SMTRY3 4 0.000000 0.000000 1.000000 0.00000 REMARK 290 REMARK 290 REMARK: NULL REMARK 300 REMARK 300 BIOMOLECULE: 1, 2 REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON REMARK 300 BURIED SURFACE AREA. REMARK 300 REMARK: THE BIOLOGICAL UNIT IS A PAIR OF BETA-SHEETS. ONE SHEET IS REMARK 300 COMPOSED OF CHAIN A AND UNIT CELL TRANSLATIONS ALONG THE B REMARK 300 DIMENSION. THE OTHER SHEET IS COMPOSED OF THE SYMMETRY MATE − X + 1/2, REMARK 300 Y + 1/2, −Z, AND UNIT CELL TRANSLATIONS ALONG B. REMARK 350 REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS REMARK 350 GIVEN BELOW. BOTH NON-CRYSTALLOGRAPHIC AND REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN. REMARK 350 REMARK 350 BIOMOLECULE: 1 REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: TETRAMERIC REMARK 350 APPLY THE FOLLOWING TO CHAINS: A REMARK 350 BIOMT1 1 1.000000 0.000000 0.000000 0.00000 REMARK 350 BIOMT2 1 0.000000 1.000000 0.000000 0.00000 REMARK 350 BIOMT3 1 0.000000 0.000000 1.000000 0.00000 REMARK 350 BIOMT1 2 1.000000 0.000000 0.000000 0.00000 REMARK 350 BIOMT2 2 0.000000 1.000000 0.000000 4.82000 REMARK 350 BIOMT3 2 0.000000 0.000000 1.000000 0.00000 REMARK 350 BIOMT1 3 −1.000000 0.000000 0.000000 35.40500 REMARK 350 BIOMT2 3 0.000000 1.000000 0.000000 2.41000 REMARK 350 BIOMT3 3 0.000000 0.000000 −1.000000 0.00000 REMARK 350 BIOMT1 4 −1.000000 0.000000 0.000000 35.40500 REMARK 350 BIOMT2 4 0.000000 1.000000 0.000000 7.23000 REMARK 350 BIOMT3 4 0.000000 0.000000 −1.000000 0.00000 REMARK 350 REMARK 350 BIOMOLECULE: 2 REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: MONOMERIC REMARK 350 APPLY THE FOLLOWING TO CHAINS: A REMARK 350 BIOMT1 1 1.000000 0.000000 0.000000 0.00000 REMARK 350 BIOMT2 1 0.000000 1.000000 0.000000 0.00000 REMARK 350 BIOMT3 1 0.000000 0.000000 1.000000 0.00000 DBREF 4 RIL A 1 11 UNP P37840 SYUA_HUMAN 68 78 SEQRES 1 A 11 GLY ALA VAL VAL THR GLY VAL THR ALA VAL ALA FORMUL 2 HOH *2 (H2 O) CRYST1 70.810 4.820 16.790 90.00 105.68 90.00 C 1 2 1 4 ORIGX1 1.000000 0.000000 0.000000 0.00000 ORIGX2 0.000000 1.000000 0.000000 0.00000 ORIGX3 0.000000 0.000000 1.000000 0.00000 SCALE1 0.014122 0.000000 0.003964 0.00000 SCALE2 0.000000 0.207469 0.000000 0.00000 SCALE3 0.000000 0.000000 0.061861 0.00000 ATOM 1 N GLY A 1 −1.664 2.302 6.349 1.00 23.58 N ATOM 2 CA GLY A 1 −1.194 2.605 5.007 1.00 23.02 C ATOM 3 C GLY A 1 0.105 1.901 4.702 1.00 21.89 C ATOM 4 O GLY A 1 0.121 0.676 4.579 1.00 20.14 O ATOM 5 N ALA A 2 1.197 2.666 4.558 1.00 16.28 N ATOM 6 CA ALA A 2 2.509 2.094 4.221 1.00 15.41 C ATOM 7 C ALA A 2 3.664 2.731 5.005 1.00 12.05 C ATOM 8 O ALA A 2 3.668 3.942 5.227 1.00 10.77 O ATOM 9 CB ALA A 2 2.764 2.186 2.712 1.00 15.67 C ATOM 10 N VAL A 3 4.640 1.905 5.417 1.00 5.98 N ATOM 11 CA VAL A 3 5.852 2.304 6.129 1.00 3.93 C ATOM 12 C VAL A 3 7.023 1.700 5.344 1.00 5.93 C 4 ATOM 13 O VAL A 3 7.217 0.485 5.388 1.00 6.66 O ATOM 14 CB VAL A 3 5.856 1.891 7.629 1.00 7.66 C ATOM 15 CG1 VAL A 3 7.148 2.337 8.330 1.00 6.70 C ATOM 16 CG2 VAL A 3 4.661 2.494 8.333 1.00 6.73 C ATOM 17 N VAL A 4 7.702 2.522 4.533 1.00 3.26 N ATOM 18 CA VAL A 4 8.782 2.087 3.638 1.00 4.61 C ATOM 19 C VAL A 4 10.065 2.743 4.088 1.00 4.32 C ATOM 20 O VAL A 4 10.149 3.973 4.071 1.00 3.00 O ATOM 21 CB VAL A 4 8.458 2.457 2.171 1.00 8.53 C ATOM 22 CGI VAL A 4 9.486 1.874 1.188 1.00 9.58 C ATOM 23 CG2 VAL A 4 7.041 2.046 1.790 1.00 9.20 C ATOM 24 N THR A 5 11.066 1.952 4.438 1.00 3.32 N ATOM 25 CA THR A 5 12.360 2.426 4.896 1.00 3.88 C ATOM 26 C THR A 5 13.504 1.769 4.092 1.00 5.43 C ATOM 27 O THR A 5 13.567 0.539 4.039 1.00 6.20 O ATOM 28 CB THR A 5 12.540 2.051 6.351 1.00 6.84 C ATOM 29 OG1 THR A 5 11.414 2.503 7.130 1.00 9.13 O ATOM 30 CG2 THR A 5 13.891 2.524 6.943 1.00 10.98 C ATOM 31 N GLY A 6 14.417 2.588 3.546 1.00 6.04 N ATOM 32 CA GLY A 6 15.571 2.100 2.793 1.00 6.46 C ATOM 33 C GLY A 6 16.874 2.688 3.292 1.00 7.38 C ATOM 34 O GLY A 6 16.959 3.896 3.501 1.00 6.32 O ATOM 35 N VAL A 7 17.913 1.864 3.436 1.00 4.11 N ATOM 36 CA VAL A 7 19.223 2.311 3.884 1.00 5.04 C ATOM 37 C VAL A 7 20.243 1.730 2.870 1.00 4.68 C ATOM 38 O VAL A 7 20.244 0.519 2.678 1.00 5.69 O ATOM 39 CB VAL A 7 19.532 1.802 5.294 1.00 9.15 C ATOM 40 CGI VAL A 7 21.007 1.991 5.629 1.00 9.39 C ATOM 41 CG2 VAL A 7 18.606 2.431 6.367 1.00 9.75 C ATOM 42 N THR A 8 21.105 2.570 2.279 1.00 3.68 N ATOM 43 CA THR A 8 22.201 2.169 1.357 1.00 4.35 C ATOM 44 C THR A 8 23.468 2.783 1.930 1.00 6.01 C ATOM 45 O THR A 8 23.530 4.005 2.031 1.00 6.48 O ATOM 46 CB THR A 8 21.874 2.496 −0.083 1.00 12.43 C ATOM 47 OG1 THR A 8 20.601 1.921 −0.394 1.00 14.76 O ATOM 48 CG2 THR A 8 22.929 1.954 −1.075 1.00 13.32 C ATOM 49 N ALA A 9 24.453 1.977 2.339 1.00 7.04 N ATOM 50 CA ALA A 9 25.628 2.542 2.994 1.00 9.57 C ATOM 51 C ALA A 9 26.967 1.849 2.849 1.00 11.59 C ATOM 52 O ALA A 9 27.052 0.628 2.756 1.00 8.18 O ATOM 53 CB ALA A 9 25.328 2.729 4.478 1.00 10.30 C ATOM 54 N VAL A 10 28.017 2.646 2.956 1.00 10.58 N ATOM 55 CA VAL A 10 29.405 2.206 3.043 1.00 12.39 C ATOM 56 C VAL A 10 29.896 2.880 4.314 1.00 18.51 C ATOM 57 O VAL A 10 30.171 4.075 4.301 1.00 16.08 O ATOM 58 CB VAL A 10 30.273 2.561 1.816 1.00 17.83 C ATOM 59 CGI VAL A 10 31.744 2.243 2.085 1.00 18.89 C ATOM 60 CG2 VAL A 10 29.778 1.831 0.567 1.00 17.39 C ATOM 61 N ALA A 11 29.916 2.136 5.427 1.00 17.81 N ATOM 62 CA ALA A 11 30.340 2.647 6.726 1.00 23.47 C ATOM 63 C ALA A 11 31.643 1.988 7.097 1.00 51.68 C ATOM 64 O ALA A 11 31.622 0.916 7.734 1.00 58.63 O ATOM 65 CB ALA A 11 29.289 2.350 7.778 1.00 24.49 C ATOM 66 OXT ALA A 11 32.691 2.485 6.653 1.00 74.50 O TER 67 ALA A 11 HETATM 68 O HOH A 101 9.830 4.990 7.085 1.00 11.92 O HETATM 69 O HOH A 102 18.548 3.873 0.260 1.00 20.36 O MASTER 203 0 0 0 0 0 0 6 68 1 0 1 END 5
[0152] The atomic coordinates of the structure of PreNAC: GVVHGVTTVA (SEQ ID NO:47) below in Table 4
TABLE-US-00006 TABLE 4 HEADER ---- 27-APR-15 xxxx COMPND --- REMARK 3 REMARK 3 REFINEMENT. REMARK 3 PROGRAM: REFMAC 5.8.0073 REMARK 3 AUTHORS: MURSHUDOV, SKUBAK, LEBEDEV, PANNU, REMARK 3 STEINER, NICHOLLS, WINN, LONG, VAGIN REMARK 3 REMARK 3 REFINEMENT TARGET: MAXIMUM LIKELIHOOD REMARK 3 REMARK 3 DATA USED IN REFINEMENT. REMARK 3 RESOLUTION RANGE HIGH (ANGSTROMS): 1.41 REMARK 3 RESOLUTION RANGE LOW (ANGSTROMS): 32.94 REMARK 3 DATA CUTOFF (SIGMA (F)): NONE REMARK 3 COMPLETENESS FOR RANGE (%): 86.73 REMARK 3 NUMBER OF REFLECTIONS: 1006 REMARK 3 REMARK 3 FIT TO DATA USED IN REFINEMENT. REMARK 3 CROSS-VALIDATION METHOD: THROUGHOUT REMARK 3 FREE R VALUE TEST SET SELECTION: RANDOM REMARK 3 R VALUE (WORKING + TEST SET): 0.26104 REMARK 3 R VALUE (WORKING SET): 0.25243 REMARK 3 FREE R VALUE: 0.33523 REMARK 3 FREE R VALUE TEST SET SIZE (%): 10.0 REMARK 3 FREE R VALUE TEST SET COUNT: 112 REMARK 3 REMARK 3 FIT IN THE HIGHEST RESOLUTION BIN. REMARK 3 TOTAL NUMBER OF BINS USED: 20 REMARK 3 BIN RESOLUTION RANGE HIGH: 1.409 REMARK 3 BIN RESOLUTION RANGE LOW: 1.446 REMARK 3 REFLECTION IN BIN (WORKING SET): 49 REMARK 3 BIN COMPLETENESS (WORKING + TEST ) (%): 51.43 REMARK 3 BIN R VALUE (WORKING SET): 0.388 REMARK 3 BIN FREE R VALUE SET COUNT: 5 REMARK 3 BIN FREE R VALUE: 0.528 REMARK 3 REMARK 3 NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT. REMARK 3 ALL ATOMS: 68 REMARK 3 REMARK 3 B VALUES. REMARK 3 FROM WILSON PLOT (A**2): NULL REMARK 3 MEAN B VALUE (OVERALL, A**2): 19.367 REMARK 3 OVERALL ANISOTROPIC B VALUE. REMARK 3 B11 (A**2): −0.23 REMARK 3 B22 (A**2): −0.23 REMARK 3 B33 (A**2): 0.49 REMARK 3 B12 (A**2): 0.00 REMARK 3 B13 (A**2): −0.30 REMARK 3 B23 (A**2): −0.00 REMARK 3 REMARK 3 ESTIMATED OVERALL COORDINATE ERROR. REMARK 3 ESU BASED ON R VALUE (A): 0.118 REMARK 3 ESU BASED ON FREE R VALUE (A): 0.133 REMARK 3 ESU BASED ON MAXIMUM LIKELIHOOD (A): 0.155 REMARK 3 ESU FOR B VALUES BASED ON MAXIMUM LIKELIHOOD (A**2): 4.934 REMARK 3 REMARK 3 CORRELATION COEFFICIENTS. REMARK 3 CORRELATION COEFFICIENT FO-FC: 0.950 REMARK 3 CORRELATION COEFFICIENT FO-FC FREE: 0.895 REMARK 3 REMARK 3 RMS DEVIATIONS FROM IDEAL VALUES COUNT RMS WEIGHT REMARK 3 BOND LENGTHS REFINED ATOMS (A): 66; 0.017; 0.019 REMARK 3 BOND LENGTHS OTHERS (A): 69; 0.010; 0.020 REMARK 3 BOND ANGLES REFINED ATOMS (DEGREES): 91; 1.876; 1.905 1 REMARK 3 BOND ANGLES OTHERS (DEGREES): 155; 0.648; 3.000 REMARK 3 TORSION ANGLES, PERIOD 1 (DEGREES): 9; 5.684; 5.000 REMARK 3 TORSION ANGLES, PERIOD 2 (DEGREES): 1; 75.981; 20.000 REMARK 3 TORSION ANGLES, PERIOD 3 (DEGREES): 7; 7.001; 15.000 REMARK 3 CHIRAL-CENTER RESTRAINTS (A**3): 14; 0.098; 0.200 REMARK 3 GENERAL PLANES REFINED ATOMS (A): 73; 0.005; 0.020 REMARK 3 GENERAL PLANES OTHERS (A): 13; 0.001; 0.020 REMARK 3 REMARK 3 ISOTROPIC THERMAL FACTOR RESTRAINTS. COUNT RMS WEIGHT REMARK 3 MAIN-CHAIN BOND REFINED ATOMS (A**2): 39; 6.545; 1.715 REMARK 3 MAIN-CHAIN BOND OTHER ATOMS (A**2): 38; 3.948; 1.607 REMARK 3 MAIN-CHAIN ANGLE REFINED ATOMS (A**2): 41; 8.395; 2.554 REMARK 3 MAIN-CHAIN ANGLE OTHER ATOMS (A**2): 42; 8.555; 2.605 REMARK 3 SIDE-CHAIN BOND REFINED ATOMS (A**2): 27; 5.989; 2.165 REMARK 3 SIDE-CHAIN BOND OTHER ATOMS (A**2): 27; 5.243; 2.077 REMARK 3 SIDE-CHAIN ANGLE OTHER ATOMS (A**2): 44; 8.091; 3.056 REMARK 3 LONG RANGE B REFINED ATOMS (A**2): 54; 9.624; 14.765 REMARK 3 LONG RANGE B OTHER ATOMS (A**2) 55; 11.399; 15.221 REMARK 3 REMARK 3 NCS RESTRAINTS STATISTICS REMARK 3 NUMBER OF NCS GROUPS: NULL REMARK 3 REMARK 3 TWIN DETAILS REMARK 3 NUMBER OF TWIN DOMAINS: NULL REMARK 3 REMARK 3 REMARK 3 TLS DETAILS REMARK 3 NUMBER OF TLS GROUPS: NULL REMARK 3 REMARK 3 REMARK 3 BULK SOLVENT MODELLING. REMARK 3 METHOD USED: MASK REMARK 3 PARAMETERS FOR MASK CALCULATION REMARK 3 VDW PROBE RADIUS: 1.20 REMARK 3 ION PROBE RADIUS: 0.80 REMARK 3 SHRINKAGE RADIUS: 0.80 REMARK 3 REMARK 3 OTHER REFINEMENT REMARKS: REMARK 3 HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS REMARK 3 U VALUES: REFINED INDIVIDUALLY REMARK 3 CRYST1 17.930 4.710 33.030 90.00 94.33 90.00 P 1 21 1 SCALE1 0.055772 0.000000 0.004219 0.00000 SCALE2 −0.000000 0.212314 0.000000 0.00000 SCALE3 0.000000 −0.000000 0.030362 0.00000 ATOM 1 N GLY A 47 −7.911 −0.639 18.278 1.00 20.19 N ATOM 2 CA GLY A 47 −6.901 0.239 18.839 1.00 16.21 C ATOM 3 C GLY A 47 −5.632 −0.528 19.111 1.00 16.40 C ATOM 4 O GLY A 47 −5.600 −1.727 19.011 1.00 22.51 O ATOM 5 N VAL A 48 −4.568 0.169 19.444 1.00 17.59 N ATOM 6 CA VAL A 48 −3.313 −0.460 19.729 1.00 15.77 C ATOM 7 CB VAL A 48 −2.269 −0.088 18.637 1.00 17.32 C ATOM 8 CGI VAL A 48 −0.855 −0.462 19.056 1.00 17.64 C ATOM 9 CG2 VAL A 48 −2.659 −0.731 17.326 1.00 18.74 C ATOM 10 C VAL A 48 −2.906 0.080 21.062 1.00 13.82 C ATOM 11 O VAL A 48 −3.040 1.262 21.327 1.00 18.65 O ATOM 12 N VAL A 49 −2.365 −0.782 21.895 1.00 16.57 N ATOM 13 CA VAL A 49 −1.779 −0.342 23.136 1.00 16.11 C ATOM 14 CB VAL A 49 −2.592 −0.887 24.317 1.00 16.48 C ATOM 15 CGI VAL A 49 −1.861 −0.622 25.628 1.00 20.39 C ATOM 16 CG2 VAL A 49 −4.002 −0.324 24.303 1.00 20.73 C ATOM 17 C VAL A 49 −0.366 −0.882 23.250 1.00 13.58 C ATOM 18 O VAL A 49 −0.178 −2.043 23.137 1.00 20.25 O ATOM 19 N HIS A 50 0.614 −0.063 23.557 1.00 16.22 N 2 ATOM 20 CA HIS A 50 2.002 −0.524 23.593 1.00 15.91 C ATOM 21 CB HIS A 50 2.612 −0.176 22.220 1.00 18.19 C ATOM 22 CG HIS A 50 4.036 −0.543 22.024 1.00 23.24 C ATOM 23 ND1 HIS A 50 4.728 −1.390 22.851 1.00 32.41 N ATOM 24 CE1 HIS A 50 5.964 −1.539 22.399 1.00 29.90 C ATOM 25 NE2 HIS A 50 6.088 −0.839 21.291 1.00 34.03 N ATOM 26 CD2 HIS A 50 4.892 −0.215 21.028 1.00 33.27 C ATOM 27 C HIS A 50 2.680 0.171 24.736 1.00 14.51 C ATOM 28 O HIS A 50 2.686 1.396 24.776 1.00 21.97 O ATOM 29 N GLY A 51 3.213 −0.580 25.689 1.00 15.69 N ATOM 30 CA GLY A 51 3.877 0.021 26.829 1.00 11.67 C ATOM 31 C GLY A 51 2.957 0.800 27.740 1.00 12.93 C ATOM 32 O GLY A 51 2.967 2.022 27.786 1.00 20.51 O ATOM 33 N VAL A 52 2.174 0.081 28.498 1.00 15.10 N ATOM 34 CA VAL A 52 1.315 0.692 29.514 1.00 14.31 C ATOM 35 CB VAL A 52 −0.162 0.399 29.278 1.00 14.02 C ATOM 36 CG1 VAL A 52 −1.002 0.803 30.489 1.00 16.11 C ATOM 37 CG2 VAL A 52 −0.626 1.146 28.077 1.00 15.58 C ATOM 38 C VAL A 52 1.778 0.094 30.802 1.00 13.92 C ATOM 39 O VAL A 52 1.742 −1.133 30.969 1.00 20.14 O ATOM 40 N THR A 53 2.253 0.954 31.698 1.00 17.96 N ATOM 41 CA THR A 53 2.886 0.481 32.943 1.00 18.30 C ATOM 42 CB THR A 53 4.381 0.885 33.010 1.00 20.92 C ATOM 43 OG1 THR A 53 5.064 0.409 31.840 1.00 29.94 O ATOM 44 CG2 THR A 53 5.063 0.255 34.175 1.00 22.40 C ATOM 45 C THR A 53 2.116 1.037 34.132 1.00 14.85 C ATOM 46 O THR A 53 1.778 2.193 34.103 1.00 21.57 O ATOM 47 N THR A 54 1.840 0.202 35.151 1.00 15.66 N ATOM 48 CA THR A 54 1.239 0.607 36.427 1.00 14.08 C ATOM 49 CB THR A 54 −0.184 0.059 36.602 1.00 18.69 C ATOM 50 OG1 THR A 54 −1.031 0.491 35.534 1.00 35.75 O ATOM 51 CG2 THR A 54 −0.768 0.525 37.872 1.00 23.36 C ATOM 52 C THR A 54 2.061 −0.047 37.500 1.00 12.83 C ATOM 53 O THR A 54 2.023 −1.258 37.626 1.00 22.40 O ATOM 54 N VAL A 55 2.821 0.725 38.262 1.00 14.38 N ATOM 55 CA VAL A 55 3.639 0.203 39.339 1.00 13.58 C ATOM 56 CB VAL A 55 5.099 0.641 39.138 1.00 15.65 C ATOM 57 CG1 VAL A 55 5.915 0.347 40.358 1.00 16.16 C ATOM 58 CG2 VAL A 55 5.696 −0.078 37.939 1.00 17.66 C ATOM 59 C VAL A 55 3.100 0.756 40.673 1.00 14.57 C ATOM 60 O VAL A 55 2.916 1.968 40.780 1.00 16.23 O ATOM 61 N ALA A 56 2.809 −0.130 41.639 1.00 17.51 N ATOM 62 CA ALA A 56 2.466 0.268 43.022 1.00 26.29 C ATOM 63 CB ALA A 56 1.113 −0.279 43.465 1.00 21.51 C ATOM 64 C ALA A 56 3.547 −0.222 43.971 1.00 38.92 C ATOM 65 O ALA A 56 3.757 −1.425 44.111 1.00 69.25 O ATOM 66 OXT ALA A 56 4.249 0.549 44.634 1.00 54.03 O HETATM 67 O HOH B 1 4.715 2.482 29.991 1.00 27.67 O HETATM 68 O HOH B 2 −1.034 3.065 33.500 1.00 32.66 O 3
REFERENCES
[0153] 1. Biere, A. L. et al. Parkinson's disease-associated alpha-synuclein is more fibrillogenic than beta- and gamma-synuclein and cannot cross-seed its homologs. J. Biol. Chem. 275, 34574-34579 (2000). [0154] 2. Giasson, B. I., Murray, I. V. J., Trojanowski, J. Q. & Lee, V. M.-Y. A Hydrophobic Stretch of 12 Amino Acid Residues in the Middle of α-Synuclein Is Essential for Filament Assembly. J. Biol. Chem. 276, 2380-2386 (2001). [0155] 3. Du, H.-N. et al. A peptide motif consisting of glycine, alanine, and valine is required for the fibrillization and cytotoxicity of human alpha-synuclein. Biochemistry (Mosc.) 42, 8870-8878 (2003). [0156] 4. Periquet, M., Fulga, T., Myllykangas, L., Schlossmacher, M. G. & Feany, M. B. Aggregated α-Synuclein Mediates Dopaminergic Neurotoxicity In Vivo. J. Neurosci. 27, 3338-3346 (2007). [0157] 5. Nannenga, B. L., Shi, D., Leslie, A. G. W. & Gonen, T. High-resolution structure determination by continuous-rotation data collection in MicroED. Nat. Methods 11, 927-930 (2014). [0158] 6. Shi, D., Nannenga, B. L., Iadanza, M. G. & Gonen, T. Three-dimensional electron crystallography of protein microcrystals. eLife 2, e01345 (2013). [0159] 7. Spillantini, M. G. et al. Alpha-synuclein in Lewy bodies. Nature 388, 839-840 (1997). [0160] 8. Goedert, M., Spillantini, M. G., Del Tredici, K. & Braak, H. 100 years of Lewy pathology. Nat. Rev. Neurol. 9, 13-24 (2013). [0161] 9. Polymeropoulos, M. H. et al. Mutation in the alpha-synuclein gene identified in families with Parkinson's disease. Science 276, 2045-2047 (1997). [0162] 10. Krüger, R. et al. Ala30Pro mutation in the gene encoding alpha-synuclein in Parkinson's disease. Nat. Genet. 18, 106-108 (1998). [0163] 11. Zarranz, J. J. et al. The new mutation, E46K, of alpha-synuclein causes Parkinson and Lewy body dementia. Ann. Neurol. 55, 164-173 (2004). [0164] 12. Ibáñez, P. et al. Causal relation between alpha-synuclein gene duplication and familial Parkinson's disease. Lancet 364, 1169-1171 (2004). [0165] 13. Singleton, A. B. et al. alpha-Synuclein locus triplication causes Parkinson's disease. Science 302,841 (2003). [0166] 14. Uéda, K. et al. Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease. Proc. Natl. Acad. Sci. U.S.A 90, 11282-11286 (1993). [0167] 15. Han, H., Weinreb, P. H. & Lansbury, P. T. The core Alzheimer's peptide NAC forms amyloid fibrils which seed and are seeded by beta-amyloid: is NAC a common trigger or target in neurodegenerative disease? Chem. Biol. 2, 163-169 (1995). [0168] 16. El-Agnaf, O. M. et al. Aggregates from mutant and wild-type alpha-synuclein proteins and NAC peptide induce apoptotic cell death in human neuroblastoma cells by formation of beta-sheet and amyloid-like filaments. FEBS Lett. 440, 71-75 (1998). [0169] 17. Conway, K. A., Harper, J. D. & Lansbury, P. T. Accelerated in vitro fibril formation by a mutant alpha-synuclein linked to early-onset Parkinson disease. Nat. Med. 4, 1318-1320 (1998). [0170] 18. Nelson, R. et al. Structure of the cross-beta spine of amyloid-like fibrils. Nature 435, 773-778 (2005). [0171] 19. Sawaya, M. R. et al. Atomic structures of amyloid cross-beta spines reveal varied steric zippers. Nature 447, 453-457 (2007). [0172] 20. Bodies, A. M., Guthrie, D. J., Greer, B. & Irvine, G. B. Identification of the region of non-Abeta component (NAC) of Alzheimer's disease amyloid responsible for its aggregation and toxicity. J. Neurochem. 78, 384-395 (2001). [0173] 21. Nannenga, B. L. & Gonen, T. Protein structure determination by MicroED. Curr. Opin. Struct. Biol. 27C, 24-31 (2014). [0174] 22. Nannenga, B. L. eLife (2014). Structure of catalase determined by MicroED. 2014; 3:e03600 [0175] 23. Yonekura, K., Kato, K., Ogasawara, M., Tomita, M. & Toyoshima, C. Electron crystallography of ultrathin 3D protein crystals: atomic model with charges. Proc. Natl. Acad. Sci. U.S.A 112, 3368-3373 (2015). [0176] 24. Doyle, P. A. & Turner, P. S. Relativistic Hartree-Fock X-ray and electron scattering factors. Acta Crystallogr. Sect. A 24, 390-397 (1968). [0177] 25. Der-Sarkissian, A., Jao, C. C., Chen, J. & Langen, R. Structural organization of alpha-synuclein fibrils studied by site-directed spin labeling. J. Biol. Chem. 278, 37530-37535 (2003). [0178] 26. Chen, M., Margittai, M., Chen, J. & Langen, R. Investigation of alpha-synuclein fibril structure by site-directed spin labeling. J. Biol. Chem. 282, 24970-24979 (2007). [0179] 27. Sarafian, T. A. et al. Impairment of mitochondria in adult mouse brain overexpressing predominantly full-length, N-terminally acetylated human α-synuclein. PloS One 8, e63557 (2013). [0180] 28. Caughey, B. & Lansbury, P. T. Protofibrils, pores, fibrils, and neurodegeneration: separating the responsible protein aggregates from the innocent bystanders. Annu. Rev. Neurosci. 26, 267-298 (2003). [0181] 29. Danzer, K. M., Schnack, C., Sutcliffe, A., Hengerer, B. & Gillardon, F. Functional protein kinase arrays reveal inhibition of p-21-activated kinase 4 by alpha-synuclein oligomers. J. Neurochem. 103, 2401-2407 (2007). [0182] 30. Karpinar, D. P. et al. Pre-fibrillar alpha-synuclein variants with impaired beta-structure increase neurotoxicity in Parkinson's disease models. EMBO J. 28, 3256-3268 (2009). [0183] 31. Winner, B. et al. In vivo demonstration that alpha-synuclein oligomers are toxic. Proc. Natl. Acad. Sci. U.S.A 108, 4194-4199 (2011). [0184] 32. Chen, S. W. et al. Structural characterization of toxic oligomers that are kinetically trapped during α-synuclein fibril formation. Proc. Natl. Acad. Sci. U.S.A 112, E1994-2003 (2015). [0185] 33. Bousset, L. et al. Structural and functional characterization of two alpha-synuclein strains. Nat. Commun. 4, 2575 (2013). [0186] 34. Auluck, P. K., Caraveo, G. & Lindquist, S. α-Synuclein: membrane interactions and toxicity in Parkinson's disease. Annu. Rev. Cell Dev. Biol. 26, 211-233 (2010). [0187] 35. Lee, J. C., Langen, R., Hummel, P. A., Gray, H. B. & Winkler, J. R. Alpha-synuclein structures from fluorescence energy-transfer kinetics: implications for the role of the protein in Parkinson's disease. Proc. Natl. Acad. Sci. U.S.A 101, 16466-36. Sievers, S. A. et al. Structure-based design of non-natural amino-acid inhibitors of amyloid fibril formation. Nature 475, 96-100 (2011). [0188] 37. Otwinowski, Z. & Minor, W. in Methods in Enzymology (ed. Charles W. Carter, J.) Volume 276, 307-326 (Academic Press, 1997). [0189] 38. Weierstall, U., Spence, J. C. H. & Doak, R. B. Injector for scattering measurements on fully solvated biospecies. Rev. Sci. Instrum. 83, 035108 (2012). [0190] 39. Hattne, J. et al. Accurate macromolecular structures using minimal measurements from X-ray free-electron lasers. Nat. Methods 11, 545-548 (2014). [0191] 40. Sauter, N. K., Hattne, J., Grosse-Kunstleve, R. W. & Echols, N. New Python-based methods for data processing. Acta Crystallogr. D Biol. Crystallogr. 69, 1274-1282 (2013). [0192] 41. Kabsch, W. XDS. Acta Crystallogr. D Biol. Crystallogr. 66, 125-132 (2010). [0193] 42. McCoy, A. J. et al. Phaser crystallographic software. J. Appl. Crystallogr. 40, 658-674 (2007). [0194] 43. Murshudov, G. N., Vagin, A. A. & Dodson, E. J. Refinement of macromolecular structures by the maximum-likelihood method. Acta Crystallogr. D Biol. Crystallogr. 53, 240-255 (1997). [0195] 44. Afonine, P. V. et al. Towards automated crystallographic structure refinement with phenix.refine. Acta Crystallogr. D Biol. Crystallogr. 68, 352-367 (2012). [0196] 45. Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. Features and development of Coot. Acta Crystallogr. D Biol. Crystallogr. 66, 486-501 (2010). [0197] 46. Delano, W. The PyMOL Molecular Graphics System. (Schrödinger LLC). at <http://www.pymol.org>47. Jakes, R., Spillantini, M. G. & Goedert, M. Identification of two distinct synucleins from human brain. FEBS Lett. 345, 27-32 (1994). [0198] 48. Johnson, M., Coulton, A. T., Geeves, M. A. & Mulvihill, D. P. Targeted amino-terminal acetylation of recombinant proteins in E. coli. PloS One 5, e15801 (2010). [0199] 49. Whitelegge, J. P., Zhang, H., Aguilera, R., Taylor, R. M. & Cramer, W. A. Full subunit coverage liquid chromatography electrospray ionization mass spectrometry (LCMS+) of an oligomeric membrane protein: cytochrome b(6)f complex from spinach and the cyanobacterium Mastigocladus laminosus. Mol. Cell. Proteomics MCP 1, 816-827 (2002). [0200] 50. Rao, J. N., Jao, C. C., Hegde, B. G., Langen, R. & Ulmer, T. S. A combinatorial NMR and EPR approach for evaluating the structural ensemble of partially folded proteins. J. Am. Chem. Soc. 132, 8657-8668 (2010). [0201] 51. Brunger, A. T. Version 1.2 of the Crystallography and NMR system. Nat. Protoc. 2, 2728-2733 (2007). [0202] 52. Fabiola, F., Bertram, R., Korostelev, A. & Chapman, M. S. An improved hydrogen bond potential: impact on medium resolution protein structures. Protein Sci. Publ. Protein Soc. 11, 1415-1423 (2002). [0203] 53. Comellas, G. et al. Structured regions of α-synuclein fibrils include the early-onset Parkinson's disease mutation sites. J. Mol. Biol. 411, 881-895 (2011). [0204] 54. Vilar, M. et al. The fold of alpha-synuclein fibrils. Proc. Natl. Acad. Sci. U.S.A. 105, 8637-8642 (2008). [0205] 55. Goldschmidt, L., Teng, P. K., Riek, R. & Eisenberg, D. Identifying the amylome, proteins capable of forming amyloid-like fibrils. Proc. Natl. Acad. Sci. 107, 3487-3492 (2010). [0206] 56. Read, R. J. Improved Fourier coefficients for maps using phases from partial structures with errors. Acta Crystallogr. A 42, 140-149 (1986). [0207] 57. Eisenberg, D. S. et al. Structure-based design of peptide inhibitors of amyloid fibrillation, U.S. Pat. No. 8,754,034. [0208] 58. Eisenberg, D. S. et al. Structure-based peptide inhibitors of p53 aggregation as a new approach to cancer therapeutics; WO 2014/182961 (2014); US2014/037387. [0209] 59. The CCP4 suite: programs for protein crystallography. Acta Crystallogr D Biol [0210] Crystallogr 50, 760-3 (1994). [0211] 60. Lawrence, M. C. & Colman, P. M. Shape complementarity at protein/protein interfaces. J Mol Biol 234, 946-50 (1993). [0212] 61. Kyte J, Doolittle RF (May 1983). “A simple method for displaying the hydropathic character of a protein”. J. Mol. Biol. 157 (1): 105-32. [0213] 62. Warren L. DeLano “The PyMOL Molecular Graphics System.” DeLano Scientific LLC, San Clos, Calif., USA. http://www.pymol.org [0214] 63. Jiang, L. et al. (2013). Structure-based discovery of fiber-binding compounds that reduce the cytotoxicity of amyloid beta. ELife 2013; 2e00857
[0215] From the foregoing description, one skilled in the art can easily ascertain the essential characteristics of this invention, and without departing from the spirit and scope thereof, can make changes and modifications of the invention to adapt it to various usage and conditions and to utilize the present invention to its fullest extent. The preceding embodiments are to be construed as merely illustrative, and not limiting of the scope of the invention in any way whatsoever. The entire disclosure of all applications, patents, and publications cited herein and in the figures are hereby incorporated in their entirety by reference, particularly with regard to the information for which they are cited.