Methods of detecting UBE3A protein

12467929 ยท 2025-11-11

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure provides a method of detecting the presence or amount of a UBE3A protein in a sample, such as a human sample, using mass spectrometry based techniques. The methods described herein are useful for diagnosing Angelman syndrome, as well as monitoring disease progression and treatment effectiveness.

Claims

1. A method of detecting the presence or amount of a UBE3A protein in a sample, the method comprising: contacting the sample with an antibody that binds to the UBE3A protein; removing from the sample some or all of the proteins that are not bound to the antibody, resulting in a purified protein preparation; subjecting the purified protein preparation to enzymatic digestion, resulting in a digested peptide preparation; and determining via mass spectrometry the presence or amount of one or more UBE3A peptides in the digested peptide preparation, thereby identifying the presence or amount of the UBE3A protein in the sample.

2. The method of claim 1, wherein the one or more UBE3A peptides comprise at least one peptide selected from the peptides depicted in Table 17.

3. The method of claim 1, wherein the one or more UBE3A peptides comprise at least one peptide selected from the group consisting of: VFSSAEALVQSFR (SEQ ID NO:3), NLVNDDDAIVAASK (SEQ ID NO:4), VDPLETELGVK (SEQ ID NO:5), and LEMIAMENPADLKK (SEQ ID NO:6).

4. The method of claim 3, comprising detecting one peptide selected from the group consisting of: VFSSAEALVQSFR (SEQ ID NO:3), NLVNDDDAIVAASK (SEQ ID NO: 4), VDPLETELGVK (SEQ ID NO:5), and LEMIAMENPADLKK (SEQ ID NO:6).

5. The method of claim 3, comprising detecting two or more peptides selected from the group consisting of: VFSSAEALVQSFR (SEQ ID NO:3), NLVNDDDAIVAASK (SEQ ID NO:4), VDPLETELGVK (SEQ ID NO:5), and LEMIAMENPADLKK (SEQ ID NO: 6).

6. The method of claim 3, comprising detecting peptides VFSSAEALVQSFR (SEQ ID NO:3), NLVNDDDAIVAASK (SEQ ID NO:4), VDPLETELGVK (SEQ ID NO:5), and LEMIAMENPADLKK (SEQ ID NO:6).

7. The method of claim 1, further comprising detecting one or more additional UBE3A peptides in the digested peptide preparation.

8. The method of claim 1, wherein enzymatic digestion comprises contacting the purified protein preparation with trypsin.

9. The method of claim 1, wherein the antibody that binds to the UBE3A protein competes with the 3E5 antibody for binding to the UBE3A protein.

10. The method of claim 1, wherein the antibody that binds to the UBE3A protein comprises the 3E5 antibody.

11. The method of claim 1, wherein the antibody that binds to the UBE3A protein is conjugated to beads.

12. The method of claim 1, wherein the sample is a human CSF sample obtained from a human subject with Angelman syndrome or at risk of developing Angelman syndrome.

13. The method of claim 1, wherein identifying the sample as having an undetectable level of the UBE3A protein, a level of the UBE3A protein reduced as compared to healthy subjects, or a level of the UBE3A protein within the range found in subjects with Angelman syndrome identifies a human subject from whom the sample was obtained as having Angelman syndrome or at risk of developing Angelman syndrome.

14. A method of treating a human subject that has Angelman syndrome or is at risk of developing Angelman syndrome, the method comprising: identifying the human subject as having Angelman syndrome or being at risk of developing Angelman syndrome according to the method of claim 13; and administering to the human subject a therapeutic.

15. A method for determining if a therapeutic administered to a human subject that has Angelman syndrome or is at risk of developing Angelman syndrome is an efficacious therapeutic, comprising: administering one or more doses of the therapeutic to the human subject; and measuring according to the method of claim 1 a UBE3A protein level in a biological sample obtained from the human subject after administering the one or more doses of the therapeutic, wherein if the UBE3A protein level in the biological sample is higher than the range of UBE3A protein level found in subjects with Angelman syndrome then the therapeutic is identified as being an efficacious therapeutic.

16. A method for determining if a therapeutic administered to a human subject that has Angelman syndrome or is at risk of developing Angelman syndrome is an efficacious therapeutic, comprising: measuring according to the method of claim 1 a UBE3A protein level in a first biological sample obtained from the human subject; administering one or more doses of the therapeutic to the human subject; and measuring according to the method of claim 1 a UBE3A protein level in a second biological sample obtained from the human subject after administering the one or more doses of the therapeutic, wherein if the UBE3A protein level in the second biological sample is higher than the UBE3A protein level in the first biological sample then the therapeutic is identified as being an efficacious therapeutic.

17. A method of treating a human subject that has Angelman syndrome or is at risk of developing Angelman syndrome, comprising: administering initial doses of a therapeutic to the human subject, wherein each of the initial doses is in the same amount and is administered at the same dosing interval between doses; measuring according to the method of claim 1 a UBE3A protein level in a first biological sample obtained from the human subject after administering the initial doses that is higher than (i) a UBE3A protein level measured in a second biological sample obtained from the human subject prior to administering the initial doses, or (ii) the range of UBE3A protein level found in subjects with Angelman syndrome; and administering further doses of the therapeutic to the human subject, wherein each of the further doses is in the same or lesser amount and at the same or lengthened dosing interval as compared to the initial doses.

18. A method of treating a human subject that has Angelman syndrome or is at risk of developing Angelman syndrome, comprising: administering initial doses of a therapeutic to the human subject, wherein each of the initial doses is in the same amount and is administered at the same dosing interval between doses; measuring according to the method of claim 1 a UBE3A protein level in a first biological sample obtained from the human subject after administering the initial doses that is equal to or lower than (i) a UBE3A protein level measured in a second biological sample obtained from the human subject prior to administering the initial doses, or (ii) the range of UBE3A protein level found in subjects with Angelman syndrome; and administering further doses of the therapeutic to the human subject, wherein each of the further doses is in an increased amount and/or at a shortened dosing interval as compared to the initial doses.

19. The method of claim 14, wherein the therapeutic is an antisense oligonucleotide that reduces the level of UBE3A antisense transcript (UBE3A-ATS).

20. The method of claim 19, wherein the antisense oligonucleotide is administered to the human subject via intrathecal injection.

Description

DESCRIPTION OF DRAWINGS

(1) FIG. 1A is a diagram depicting detection of recombinant UBE3A using the Singulex assay. FIG. 1B is an enlarged graph of the area marked in FIG. 1A.

(2) FIG. 2 is a diagram showing levels of the UBE3A protein detected in CSF samples subjected to various detergent conditions. Bars indicate concentration (ng/mL) and dots indicate LOD.

(3) FIG. 3 is a diagram showing levels of the UBE3A protein detected in CSF samples using the Quanterix assay.

(4) FIG. 4 shows levels of the UBE3A protein detected in CSF samples using Liquid Chromatograph-Mass Spectrometry (LC-MS).

(5) FIG. 5 shows levels of the UBE3A protein detected in aliquots of the same CSF sample using LC-MS.

(6) FIG. 6 shows LC-MS based detection of reduced levels of the UBE3A protein in cells treated with UBE3A shRNA as compared to control.

(7) FIGS. 7A and 7B show the correlation between the mass spectrometry signal and the volume of CSF samples analyzed using LC-MS.

DETAILED DESCRIPTION

(8) The present disclosure provides methods of detecting via mass spectrometry the presence or amount of a UBE3A protein in a sample. The methods described herein can be used to detect UBE3A protein in a sample that contains, e.g., less than about 1000 pg/mL (e.g., less than about 900, 800, 700, 600, 500, 400, 300, 100, 50, 20, 15, 10, 5, 1 or 0.5 pg/mL) of the UBE3A protein. The sample can be a human sample (e.g., a human CSF sample, such as a human CSF sample obtained from a human subject having or at risk for developing Angelman syndrome). In some embodiments of the methods described herein, identifying the sample as having an undetectable level of the UBE3A protein, or a level of the UBE3A protein reduced as compared to healthy subjects identifies a subject from whom that sample was obtained as having or at risk for developing Angelman syndrome. The methods provided herein are also useful for monitoring Angelman syndrome disease progression or the effectiveness of treatments for Angelman syndrome.

(9) UBE3A

(10) Ubiquitin Protein Ligase BA (UBE3A) is an E3 ubiquitin ligase that targets proteins for proteasomal degradation by conjugating ubiquitin to the target proteins. UBE3A is also known as E6AP ubiquitin-protein ligase (E6AP), ANCR, AS, EPVE6AP, HPVE6A, HECT-type ubiquitin transferase E3A, human papillomavirus E6-associated protein, and oncogenic protein-associated protein E6-AP. UBE3A protein is encoded by the UBE3A gene which in human resides within the 15q11.2-q13.3 locus that is parentally imprinted in neurons (only the maternal copy is normally active). Mutations in UBE3A can result in certain neurodevelopmental disorders. For example, Prader-Willi syndrome can result from 15q11.2-q13.3 paternal allele deletion, whereas Angelman syndrome can be caused by deletion of the maternal allele. 15q11.2-q13.3 duplication (Dup15q) syndrome, a genetic cause of autism spectrum disorder, can arise from duplications of the maternal allele.

(11) Mutations or deletions in the UBE3A gene can result in the absence of the protein in many areas of the brain.

(12) The amino acid sequence of the human UBE3A protein is shown below.

(13) TABLE-US-00001 (SEQIDNO:1) MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACT NEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENS KGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLI RVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSA AAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNE KIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPE YLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYK VISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEP IPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCRKPLIPFEEFI NEPLNEVLEMDKDYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRIR MYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAMENPAD LKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFW FNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRD LGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENG DKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLF RPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDE QKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLP EYSSKEKLKERLLKAITYAKGFGML

(14) Angelman syndrome is a neurodevelopmental disorder characterized by intellectual disability, developmental delay, speech impairment, seizures, ataxia, unusually happy demeanor, and motor deficits, among other symptoms. Angelman syndrome patients commonly carry mutations that render the maternally inherited UBE3A gene non-functional. Human genetic studies revealed that Angelman syndrome is associated with de novo maternal deletions of chromosome 15q11-q13, paternal chromosome 15 uniparental disomy, or rare imprinting defects that affect the transcription of genes within 15q11-q13 (Clayton-Smith and Laan, J Med Genet 2003; 40:87-95). More recent studies indicate that a failure to inherit a normal maternal copy of the UBE3A gene accounts for 85-90% of all Angelman Syndrome cases. In this regard, specific loss-of-function mutations in the human UBE3A locus have been identified in a subset of affected individuals (Kishino et al., Nature Genetics 15: 70-73, 1997; Matsuura et al., Nature Genetics 15: 74-77, 1997). Phenotype severity is correlated with the type of mutation, with the full deletion of 151q1-13 the most severe and point mutations in UBE3A less severe (Gentile et al., J Dev Behav Pediatr. 31(7): 592-601, 2010; Valente et al., Epilepsy Research 105: 234-239, 2013).

(15) Methods of Detection

(16) The present disclosure provides methods of detecting a UBE3A protein in a sample, the methods include obtaining a digested peptide preparation from a purified protein preparation, and subjecting the peptide preparation to mass spectrometry to determine the presence or amount of one or more UBE3A peptides. A purified protein preparation can be obtained by contacting the sample with an antibody that binds to the UBE3A protein and removing from the sample some or all of the proteins that are not bound to the antibody.

(17) Usage of the term antibody in this disclosure is meant to cover a whole so antibody, a bispecific antibody, a tetravalent antibody, a multispecific antibody, a minibody, a nanobody, and antibody fragments. In some embodiments, the antibody that binds to UBE3A is a whole antibody. UBE3A antibodies including but not limited to those described herein are useful for generating a purified protein preparation. The antibody can be monoclonal or polyclonal. Commercially available polyclonal anti-UBE3A antibodies include, but are not limited to, those from GeneTex (GTX101092), Abcam (ab10488, ab3519, ab235984, ab183869), Proteintech (10344-1-AP), Invitrogen (PA3-843, PA5-12038), and Millipore Sigma (HPA039410, HPA040380, SAB2102627). Commercially available monoclonal anti-UBE3A antibodies include clone 3E5 (e.g. SAB1404508 (Millipore Sigma), H00007337-M02 (Abnova)); clone EX-8 (e.g. ab195649 (abcam)); clone ERP7330 (e.g. ab126765 (abcam), ab240033 (abcam), MABC761 (Millipore Sigma)); clone 10H7.1 (e.g. MABS1683 (Millipore Sigma)); clone D10D3 (e.g. #7526 (Cell Signaling Technology)); clone 2F6 (e.g. WH0007337M1 (Millipore Sigma)); and clone 19H14L13 (703785 (Invitrogen)).

(18) The anti-UBE3A antibody 3E5 binds to the following UBE3A sub-sequence:

(19) TABLE-US-00002 (SEQIDNO:2) ETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDT NHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDC R.

(20) In some embodiments, the antibody that binds to the UBE3A protein binds to the same epitope as 3E5. In some embodiments, the antibody that binds to the UBE3A protein binds to an epitope within SEQ ID NO:2. In some embodiments, the antibody binds to a different epitope from 3E5. Methods of determining whether a particular antibody binds to the same epitope as a reference antibody are known in the art. A particularly useful method is competitive binding, wherein the ability of the antibody of interest to bind to the UBE3A protein in the presence of the reference antibody is measured. Substantial inability of both antibodies to bind simultaneously indicates that substantially the same epitope is involved. In some embodiments, the antibody competes with the 3E5 antibody for binding to UBE3A. Methods of producing antibodies that bind to a specific antigen or a specific epitope of an antigen is known in the art.

(21) The antibody can be in the form of free antibody in a solution and contacting the sample with the antibody includes mixing the antibody solution with the sample. The antibody can also be conjugated to beads, which are used to contact the sample. Beads suitable for antibody conjugation include, e.g., magnetic beads and agarose-based beads. For example, Protein A/G agarose or magnetic beads, or protein A/G sepharose beads can be used. The antibodies described herein can be bound directly to the beads, or indirectly to a pre-coated ligand on the beads. Methods of conjugating antibodies to beads are known and include, for example, use of dimethyl pimelimidate for crosslinking antibodies to beads. Commercially available kits can also be used, such as those provided by Invitrogen (Dynabeads' Antibody Coupling Kit). In some embodiments, the beads (e.g. magnetic beads) are coated with streptavidin, and a biotinylated UBE3A antibody (e.g., clone 3E5) can be coupled to the beads via streptavidin/biotin interaction.

(22) The sample containing UBE3A protein can be contacted with the UBE3A antibody for an amount of time sufficient to allow for binding between the UBE3A protein and the antibody. For example, the sample containing UBE3A protein can be incubated (e.g., at or below room temperature) with UBE3A antibody conjugated beads for an amount of time sufficient to allow binding of the UBE3A protein to the antibody conjugated beads. The ratio by volume between the antibody-conjugated beads and the sample containing UBE3A protein can between about 1:30 to about 1:80 (e.g. 1:30 to about 1:70, about 1:40 to about 1:60, or about 1:50). Some or all proteins in the sample that are not bound to the antibody can be removed, thereby resulting in a purified UBE3A protein preparation. Removal of unbound proteins can be accomplished by washing the antibody conjugated beads one or more times with a buffer. Any suitable buffer that preferably does not affect the binding between UBE3A protein and the antibody can be used.

(23) Digestion

(24) The methods described herein further include subjecting the purified protein preparation to enzymatic digestion, resulting in a digested peptide preparation that contains one or more UBE3A peptides. UBE3A peptides as used herein refers to fragments of the UBE3A protein having a length within the range of, e.g., about 3 to about 100 amino acids. The digestion reaction can be carried out at a suitable temperature (e.g., below, at, or above room temperature) for an amount of time sufficient to generate, for example, one or more UBE3A peptides listed in Table 17. Proteases such as but not limited to trypsin, chymotrypsin, carboxypeptidase, serine proteases, proteinase K, papain, and pepsin can be used for digesting the UBE3A protein. In some embodiments, a trypsin-based digestion solution that contains either free trypsin or immobilized trypsin can be used. In some embodiments, trypsin that is modified to inactivate extraneous chymotryptic activity (e.g. TPCK-treated trypsin) is used.

(25) The digested peptide preparation can contain one or more peptides listed in Table 17. In some embodiments, the digested peptide preparation contains a peptide that is at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to one of the peptides listed in Table 17. In some embodiments, the digested peptide preparation contains a peptide that is different from one of the peptides listed in Table 17 by one, two or three amino acids. In some embodiments, the digested peptide preparation contains one or more (e.g., 2, 3, or all 4) peptides selected from the group consisting of: VFSSAEALVQSFR (SEQ ID NO:3), NLVNDDDAIVAASK (SEQ ID NO:4), VDPLETELGVK (SEQ ID NO:5), and LEMIAMENPADLKK (SEQ ID NO:6). In some embodiments, the digested peptide preparation contains a peptide that is at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to one of the peptides selected from the group consisting of SEQ ID NOs 3-6. In some embodiments, the digested peptide preparation contains a peptide that is different by addition or deletion of one, two or three amino acids from one of the peptides selected from the group consisting of SEQ ID NOs 3-6.

(26) Mass Spectrometry

(27) The methods described herein further include determining via mass spectrometry the presence or amount of one or more UBE3A peptides in the digested peptide preparation, thereby identifying the presence or amount of the UBE3A protein in the sample. Any suitable mass spectrometry systems described herein or known in the art can be used. For example, Matrix Assisted Laser Desorption/Ionization-Time of Flight (MALDI-TOF), Triple Quadrupole Mass Spectrometry, Quadrupole-Trap Mass Spectrometry, Hybrid Linear Ion Trap Orbitrap Mass Spectrometry, and Quadrupole-Orbitrap Mass Spectrometry. In some embodiments, coupled chromatography-mass spectrometry systems are used, such as Liquid chromatography-mass spectrometry (LC-MS). Liquid chromatography, for example, can separate the multiple UBE3A peptides in the digested peptide preparation, which are then subjected to mass spectrometry to measure the mass-to-charge ratio of charged particles, useful for analyzing e.g. the mass of the peptides, their elemental and isotopic composition. Methods of determining the identity or amount of peptides in a sample based on mass spectrometry signal and intensity are known in the art. Mass analyzers useful in LC-MS systems include, e.g. the quadrupole, time-of-flight (TOF), ion traps, and hybrid quadrupole-TOF (QTOF) analyzers.

(28) Some embodiments of the present disclosure provide detection of the presence or amount of one or more peptides in Table 17 via mass spectrometry. Detection of additional peptides not listed in Table 17, e.g., additional UBE3A peptides are also contemplated herein. In some embodiments, the methods include detection of the presence or amount of at least one peptide (e.g., 2, 3, or all 4 peptides) selected from the group consisting of SEQ ID NOs 3-6.

(29) Sample

(30) Samples that contain UBE3A protein for use in the methods described herein include any of various types of biological samples that can be isolated and/or derived from a subject (e.g., a human subject). The sample can be isolated and/or derived from any fluid, cell or tissue. In some embodiments, the sample is blood serum, blood plasma, whole blood, lymph, saliva, urine, cerebrospinal fluid (CSF), cell lysates, vitreous fluid, or ocular fluid. Samples containing recombinant UBE3A proteins are also contemplated herein. In some embodiments, the present disclosure provides methods of detecting the presence or amount of a UBE3A protein in a CSF sample (e.g., a human CSF sample).

(31) A sample of CSF can be obtained from an individual according to known methods. For example, CSF can be collected from an individual through lumbar puncture, with or without accompanying x-ray or CT scans, as well as cisternal puncture and ventricular puncture. CSF can also be collected from a tube that has been placed in the fluid, such as a shunt or a ventricular drain. In some embodiments, the sample is obtained from a subject that is diagnosed as having Angelman syndrome or is suspected of having Angelman syndrome.

(32) The sample of the present disclosure can optionally contain about 1000 pg/mL or less (e.g., about 900, 800, 700, 600, 500, 400, 300, 200, 100, 50, 20, 10, 1, 0.5 pg/mL or less) of the UBE3A protein. In some embodiments, the sample contains about 0.1 to about 1000 pg/mL (e.g., about 0.1 to about 800, about 0.1 to about 600, about 0.1 to about 400, about 0.1 to about 300, about 0.1 to about 200, about 0.1 to about 100, about 0.1 to about 50, about 0.1 to about 20, about 0.1 to about 10, about 0.5 to about 1000, about 0.5 to about 800, about 0.5 to about 600, about 0.5 to about 400, about 0.5 to about 300, about 0.5 to about 200, about 0.5 to about 100, about 0.5 to about 50, about 0.5 to about 20, about 0.5 to about 10, about 10 to about 1000, about 10 to about 800, about 10 to about 600, about 10 to about 400, about 10 to about 300, about 10 to about 200, about 10 to about 100, about 10 to about 50, about 10 to about 20, about 20 to about 1000, about 20 to about 800, about 20 to about 600, about 20 to about 400, about 20 to about 300, about 20 to about 200, about 20 to about 100, about 20 to about 50, about 50 to about 1000, about 50 to about 800, about 50 to about 600, about 50 to about 400, about 50 to about 300, about 50 to about 200, about 50 to about 100, about 100 to about 1000, about 100 to about 800, about 100 to about 600, about 100 to about 400, about 100 to about 300, about 100 to about 200, about 200 to about 1000, about 200 to about 800, about 200 to about 600, about 200 to about 400, about 200 to about 300, about 300 to about 1000, about 300 to about 800, about 300 to about 600, about 300 to about 400, about 400 to about 1000, about 400 to about 800, about 400 to about 600, about 600 to about 1000, about 600 to about 800, about 800 to about 1000 pg/mL) of the UBE3A protein.

(33) The methods of detection described herein are capable of detecting with high sensitivity the presence or amount of low levels of UBE3A protein in a sample. In some embodiments, the methods of detection described herein detect the presence or amount of UBE3A protein in samples that contain 20 pg/mL or less (e.g., 15, 10, 5, 1, 0.5 pg/mL or less) of UBE3A protein.

(34) A sample that is to be subjected to analysis can optionally be spiked with an internal standard, prior to immunoprecipitation and digestion, to normalize for run to run variation and any anomalies in immunoprecipitation and digestion. For example, a known amount of a heavy UBE3A protein (e.g., an N15-labeled UBE3A protein) can be added to a sample (e.g., a CSF sample) before the sample is processed (i.e., before immunoprecipitation and digestion).

(35) In addition, a sample that is to be subjected to analysis can optionally be spiked with an internal standard, after immunoprecipitation and digestion but prior to mass spectrometry, to normalize for run to run variation and any anomalies in mass spectrometry. For example, a known amount of one or more heavy synthesized UBE3A peptides (e.g., one or more UBE3A peptides labeled with a C13/N15-C-terminal lysine, such as labeled NLVNDDDAIVAASK (SEQ ID NO:4) and/or labeled VDPLETELGVK (SEQ ID NO:5)) can be added to a sample preparation after immunoprecipitation and digestion but prior to LC/MS analysis.

(36) In some embodiments, both of the foregoing internal controls (i.e., a first internal standard added prior to immunoprecipitation and digestion combined with a second internal standard added prior to mass spectrometry) are used to maximize reliability of the assay results.

(37) Methods of Diagnosis, Treatment, and Treatment Monitoring

(38) This disclosure provides methods for determining whether a human subject has or is at risk for developing Angelman syndrome. Also provided are methods for monitoring disease progression in a subject diagnosed with Angelman syndrome, or monitoring an Angelman syndrome patient's response to a treatment. The methods rely on detection of the presence or amount of a UBE3A protein in one or more samples (e.g., any suitable sample described herein) obtained from the subject. In some embodiments, the subject has been identified as having Angelman syndrome or at risk for developing Angelman syndrome based on other diagnostic methods (including but not limited to those described herein). In some embodiments, the subject is undergoing treatment for Angelman syndrome. For example, the UBE3A protein level in the subject undergoing treatment for Angelman syndrome can be monitored by taking one or more samples at two or more different time points during treatment.

(39) The methods include obtaining or having obtained a sample and determining the presence or level of UBE3A in the sample using methods described herein. In some embodiments, the methods include comparing the presence or amount of UBE3A protein in the sample with one or more references, e.g., a control reference that represents a normal level of UBE3A (such as a level in an unaffected subject), or a disease reference that represents a level of the UBE3A protein associated with Angelman syndrome (such as a level in a subject having or at risk for developing Angelman syndrome).

(40) The subject from whom the sample was obtained can be identified as having or at risk of developing Angelman syndrome if the level of UBE3A protein in the sample is undetectable (e.g. using the methods of detection described herein), or if the level of the UBE3A protein is reduced as compared to a control reference that represents a normal level of UBE3A (such as a level in an unaffected subject). The subject can also be identified as having or at risk for developing Angelman syndrome if the level of UBE3A protein in the sample is within the range found in subjects with Angelman syndrome.

(41) Suitable reference values can be determined using methods known in the art. The reference values can have any relevant form. In some cases, the reference comprises a predetermined value for a meaningful level of UBE3A protein in a sample, e.g., a control reference level that represents a normal level of UBE3A protein, e.g., a level in an unaffected subject or a subject who is not at risk of developing Angelman syndrome, and/or a disease reference that represents a level of UBE3A associated with Angelman syndrome, e.g., a level in a subject having Angelman syndrome.

(42) In some embodiments, the level of UBE3A in a subject is comparable to the level of UBE3A in the disease reference, and the subject has one or more symptoms (e.g., any of the behavioral symptoms or physical appearances described herein) associated with Angelman syndrome, then the subject has Angelman syndrome. In some embodiments, the subject has no overt signs or symptoms of Angelman syndrome, but the level of UBE3A is comparable to the level in the disease reference, then the subject has an increased risk of developing Angelman syndrome.

(43) The predetermined level can be a single cut-off (threshold) value, such as a median or mean, or a level that defines the boundaries of an upper or lower quartile, tertile, or other segment of a clinical trial population that is determined to be statistically different from the other segments. It can be a range of cut-off (or threshold) values, such as a confidence interval. It can be established based upon comparative groups, such as where association with risk of developing Angelman syndrome or presence of Angelman syndrome in one defined group is a fold higher, or lower, (e.g., approximately 2-fold, 4-fold, 8-fold, 16-fold or more) than the risk or presence of Angelman syndrome in another defined group. It can be a range, for example, where a population of subjects (e.g., control subjects) is divided equally (or unequally) into groups, such as a low-risk group, a medium-risk group and a high-risk group, or into quartiles, the lowest quartile being subjects with the lowest risk and the highest quartile being subjects with the highest risk, or into n-quantiles (i.e., n regularly spaced intervals) the lowest of the n-quantiles being subjects with the lowest risk and the highest of the n-quantiles being subjects with the highest risk. In some embodiments, the predetermined level is a level or occurrence in the same subject, e.g., at a different time point, e.g., an earlier time point.

(44) Subjects associated with predetermined values are typically referred to as reference subjects. For example, in some embodiments, a control reference subject does not have Angelman syndrome. A disease reference subject is one who has (or has an increased risk of developing) Angelman syndrome. An increased risk is defined as a risk above the risk of subjects in the general population.

(45) Thus, in some cases the level of UBE3A in a subject being less than or equal to a reference level of UBE3A is indicative of Angelman syndrome. In other cases the level of UBE3A in a subject being greater than or equal to the reference level of UBE3A is indicative of the absence of Angelman syndrome or having low risk of developing Angelman syndrome. In cases where the level of UBE3A in a subject being equal to the reference level of UBE3A, the being equal refers to being approximately equal (e.g., not statistically different).

(46) The predetermined value can depend upon the particular population of subjects selected. For example, an apparently healthy population will have a different normal range of levels of UBE3A than will a population of subjects which have, are likely to have, or are at greater risk to have, Angelman syndrome. Accordingly, the predetermined values selected may take into account the category (e.g., sex, age, health, risk, presence of other diseases) in which a human subject falls. Appropriate ranges and categories can be selected with no more than routine experimentation by those of ordinary skill in the art. In characterizing likelihood, or risk, numerous predetermined values can be established.

(47) Additional methods of diagnosing a subject as having Angelman syndrome, or at risk for developing Angelman syndrome include genetic tests and behavioral symptom or physical appearance based diagnosis. For example, genetic tests such as chromosome analysis (e.g., fluorescent in situ hybridization (FISH) based chromosome analysis), DNA methylation test, and sequencing of the UBE3A gene are useful diagnostic tools. Behavioral symptoms or physical appearances for diagnosing Angelman syndrome include, but are not limited to, hand flapping or walking with arms in the air; jerky body movements; stiffed-leg walk; little or no speech; attention deficits; hyperactivity; feeding problems, e.g., in infancy; sleep problems and a need for less sleep than peers; delays in motor development; frequent laughter that may occur at inappropriate times; excitable personality; tongue thrusting; strabismus (crossing of the eyes); small head size with flatness in the back of the head; a lower jaw that juts out; light pigmentation in the hair skin and eyes. The methods of detecting presence or level of a UBE3A protein in a subject's sample can be used in combination with one or more of the diagnostic criteria described above for diagnosing a subject as having or at risk for developing Angelman syndrome.

(48) Once it has been determined that a person has Angelman syndrome or has an increased risk of developing Angelman syndrome, then a treatment can be administered. Treatments for Angelman syndrome can include those that treat one or more symptoms related to Angelman syndrome. Suitable therapies include those for preventing or treating seizures (e.g. anticonvulsant medication); physical therapy (e.g. for maintaining or improving joint mobility and movement); speech therapy; occupational or behavioral therapy. Other treatments include those that increase neuronal UBE3A protein expression. For example, a treatment can be a gene therapy to increase activity of UBE3A protein, e.g., by increasing levels of functional UBE3A protein and/or increasing copies of a UBE3A gene that expresses functional protein. In other examples, a treatment can be a nucleic acid molecule, e.g., an oligonucleotide, e.g., an antisense oligonucleotide, that reduces the level of UBE3A antisense transcript (UBE3A-ATS), thereby increasing UBE3A protein production. The presence or level of UBE3A protein in a patient can be monitored during treatment by obtaining one or more samples (e.g., a CSF sample) from the patient at various time points and subject the samples to the methods of detection provided herein.

(49) In some embodiments, a subject diagnosed as having or at risk for developing Angelman syndrome (e.g., using any of the methods disclosed herein, alone or in combination) is administered a treatment for Angelman syndrome (e.g., any of the therapeutic treatments described herein, e.g., gene therapy or an antisense oligonucleotide). The level of UBE3A protein in one or more samples obtained from the subject at one or more time points after initiation of treatment can be determined using the methods described herein. In some embodiments, a higher UBE3A protein level after initiation of treatment compared to a control value (e.g., the range of UBE3A protein level found in subjects with Angelman syndrome) indicates that the therapeutic treatment is efficacious. In some embodiments, a higher UBE3A protein level after initiation of treatment compared to the UBE3A protein level in the subject prior to the initiation of treatment indicates that the therapeutic treatment is efficacious. In some embodiments, the treatment is deemed efficacious if progression of the disease is reduced or halted. In some embodiments, a higher UBE3A protein level compared to a control value (or the UBE3A protein level measured in the subject prior to the initiation of treatment) indicates that the therapeutic treatment can be continued at the same or lower dosage and/or at the same or lengthened dosing interval. In some embodiments, a UBE3A protein level equal to or lower than a control value (or the UBE3A protein level measured in the subject prior to the initiation of treatment) indicates that the therapeutic treatment can be continued at a higher dosage and/or at a shortened dosing interval. Therapeutic treatments can continue until the UBE3A protein level in a subject is comparable to or higher than that of a control value (or higher than that of the UBE3A protein level measured in the subject prior to the initiation of treatment). In some embodiments, once the UBE3A protein level in a subject is comparable to or higher than that of a control value (or higher than that of the UBE3A protein level measured in the subject prior to the initiation of treatment), maintenance doses of the therapeutic treatment can be administered thereafter. A maintenance dose refers to a constant dose level at which the therapeutic treatment is administered to the subject indefinitely, e.g., after the treatment is found to be efficacious in the subject.

(50) This disclosure also provides methods for determining whether a human subject is a candidate for a UBE3A targeted therapeutic. In one embodiment, the method entails identifying a subject as a candidate for a UBE3A targeted therapeutic by measuring according to a method described herein a UBE3A protein level in a biological sample obtained from the human subject.

(51) This disclosure also provides methods for identifying a human subject as having a lower or higher level of UBE3A protein than a reference level. In one embodiment, the method entails identifying a human subject as having a lower or higher level of UBE3A protein than a reference level by measuring according to a method described herein a UBE3A protein level in a biological sample obtained from the human subject and comparing the measured UBE3A protein level to a reference level.

(52) This disclosure also provides methods for identifying a human subject as having or being at risk of developing a disease in which UBE3A protein levels are elevated compared to a reference. In one embodiment, the method entails identifying a human subject as having or being at risk of developing a disease in which UBE3A protein levels are elevated compared to a reference by measuring according to a method described herein a UBE3A protein level in a biological sample obtained from the human subject and comparing the measured UBE3A protein level to a reference, wherein the measured UBE3A protein level is elevated compared to the reference.

(53) This disclosure also provides methods for identifying a human subject as having or being at risk of developing a disease in which UBE3A protein levels are lower compared to a reference. In one embodiment, the method entails identifying a human subject as having or being at risk of developing a disease in which UBE3A protein levels are lower compared to a reference by measuring according to a method described herein a UBE3A protein level in a biological sample obtained from the human subject and comparing the measured UBE3A protein level to a reference, wherein the measured UBE3A protein level is lower compared to the reference.

(54) In some methods described herein, e.g., where a subject is identified as having an elevated UBE3A protein level, a UBE3A targeted therapeutic is intended to reduce UBE3A protein levels or decrease UBE3A activity. Examples of such therapeutics include an inhibitor of UBE3A protein, an inhibitor of UBE3A expression, transcription, or translation, or an inhibitor of a molecule in the same pathway as UBE3A. The therapeutic can be, for example, a nucleic acid (e.g., an antisense oligonucleotide that reduces the level of a UBE3A transcript, thereby decreasing UBE3A protein production), a small molecule (e.g., a small molecule inhibitor of UBE3A activity), or an anti-UBE3A antibody (e.g., an antibody that binds to UBE3A and decreases activity of the protein).

EXAMPLES

(55) The following examples are provided to better illustrate the claimed invention and are not to be interpreted as limiting the scope of the invention. To the extent that specific materials are mentioned, it is merely for purposes of illustration and is not intended to limit the invention. One skilled in the art can develop equivalent means or reactants without the exercise of inventive capacity and without departing from the scope of the invention.

Example 1: Immunoassays for UBE3A Detection

(56) An immunoassay for UBE3A detection based on the Singulex Errena system was developed. An exemplary protocol for the Singulex Errena system based assay is described in Fischer et al. AAPS J 17(1):93-101, 2015. UBE3A standard protein (Abcam, ab125736) was used. The anti-UBE3A antibody GTX10488 (GeneTex) was used as the capture antibody, and the anti-UBE3A antibody H00007337-M02 (AbNova) was used as the detection antibody. Paramagnetic microparticles (MPs) were used as the solid phase for immune-capture and detection of the UBE3A standard protein in a microplate format. Signal generated by fluorescently labeled detection antibodies were counted as digital events, which corresponds to a single UBE3A molecule. On average an MP was coated with 12.5 g of the capture antibody, and the MPs were used at 10 g per well. The detection antibody was used at 500 ng/mL.

(57) Results from the assay showed high levels of background, as shown by the values in the DE column in Table 1 below. DE refers to all Digital Events recorded, which is used to calculate the Event Photons (EP). For reference, a typical background for this assay is between 50-100 DE.

(58) TABLE-US-00003 TABLE 1 DE EP Interpolated [UBE3A] pg/mL % % % % DE N Mean SD CV Mean SD CV Mean SD CV Recovery S/N S-N 2 13619 226 1.7 5689633 494838 8.7 2039.33 217.54 10.67 102 33.1 12961 3 9335 445 4.8 2269634 154973 6.8 661.46 53.84 8.14 95 22.7 8459 2 4907 183 3.7 926475 32982 3.6 256.41 10.16 3.96 107 11.9 4292 3 1769 164 9.3 290824 33071 11.4 78.6 9.02 11.47 94 4.3 1173 2 925 24 2.6 143334 8050 5.6 31.06 1.51 4.87 108 2.3 470 3 585 17 2.9 91306 3701 4.1 10.59 1.02 9.68 106 1.4 136 2 461 16 3.5 71838 4251 5.9 3.39 0.9 26.67 98 1.1 13 2 397 4 1.1 63527 2266 3.6 ND 1 39 2 391 4 0.9 62955 1030 1.6 ND 1 44 3 398 19 4.8 64101 4319 6.7 ND 1 53 3 420 43 10.3 69799 9001 12.9 ND 1 55 3 411 20 5 70828 6771 9.6 ND Bkgrd 411 SD 20.42 Slope 18.29 (DE/pg/mL) LoD 20.23 (pg/mL) LLoQ 10.01 (pg/mL)

(59) A further Singulex experiment was carried out using a different capture antibody, GTX101092 (GeneTex) and a different UBE3A standard protein (ab206157, Abcam). The same detection antibody, H00007337-M02 (AbNova) was used. On average an MP was coated with 25 g of the capture antibody, and the MPs were used at 25 g per well. The detection antibody was used at 125 ng/mL. FIG. 1A shows a standard curve plotted based on the concentration of UBE3A and the DE values. FIG. 1B is an enlarged graph of the area marked in FIG. 1A. The standard curve was generated based on quadruplets. Table 2 shows the concentration of recombinant UBE3A protein that was loaded into the assay and respective recovery rate which was suitable over much of the observed range. Average DE (AvgDE) represents the raw signal from the assay. 21 CSF samples tested using this setup had a signal to noise ratio of less than 2, at both neat and 1:2 dilutions. UBE3A was detected in one brain tissue sample tested using this assay setup, however the signal to noise ratio was low, at about 2.5. Additional capture antibodies were also evaluated, however, none improved the performance of the assay.

(60) TABLE-US-00004 TABLE 2 Concentration (pg/ml) AvgDE % Recovery CV 10000 12692.5 95.2 4.1 5000 10727.33 122.4 7.8 2500 6434 93.1 12.3 1250 4129.5 94.1 6.5 625 Masked Masked Masked 312.5 1611.25 103.8 10.9 156.25 922.333 100.0 9.9 78.125 559.25 104.8 14.2 39.063 289.25 88.4 11.3 19.531 207.5 113.3 6.3 9.766 112 96.3 18.6 0 62.75

(61) Next, a Quanterix Simoa assay system was used for UBE3A detection. Exemplary protocols for the Quanterix Simoa system based assay are described in e.g., Fischer et al. AAPS J 17(1):93-101, 2015 and Wilson et al. Journal of Laboratory Automation, 21(4):533-547, 2016. The two-step Quanterix format was first evaluated to identify the optimal bead antibody and detector antibody combination. The assay condition used is shown in Table 3. Three antibodies, including GTX101092 (GeneTex, referred to as GTX herein after), 2F6 (WH0007337M1-100 ug, Millipore-Sigma) and NB500-240 (Novus, referred to as Novus herein after), were tested in pairs. The sensitivity of antibody combinations were assessed using a dilution curve of a recombinant UBE3A protein. Table 4 shows results of the assessment (MS detector: Millipore-Sigma 2F6). AEB stands for the Average Enzymes per Bead and is the raw signal readout from the Quanterix Simoa assay system. The combination of GTX as the capture antibody, and Novus as the detection antibody lead to better sensitivity throughout the curve.

(62) TABLE-US-00005 TABLE 3 Incubation 2-step Assay Period conditions: Concentration Volume (minutes): Beads: 4e6 beads/well 25 ul/well 35:15 Detector: 0.6 ug/ml 20 ul/well SBG: 150 pm 100 ul/well 5:15

(63) TABLE-US-00006 TABLE 4 UBE3A Capture/Detector Concentration Ave AEB Signal to Combination (ng/ml) AEB1 AEB2 AEB CV Background GTX bead, 0 0.0559 0.0451 0.0505 15% GTX detector 0.01 0.0483 0.0494 0.0489 2% 0.97 0.1 0.0525 0.0487 0.0506 5% 1.00 1 0.0504 0.0530 0.0517 4% 1.02 10 0.0957 0.0942 0.0950 1% 1.88 GTX bead, 0 0.0082 0.0066 0.0074 15% Novus detector 0.01 0.0082 0.0072 0.0077 9% 1.04 0.1 0.0089 0.0108 0.0098 14% 1.33 1 0.0247 0.0237 0.0242 3% 3.26 10 0.1261 0.1297 0.1279 2% 17.3 GTX bead, 0 0.0925 0.0918 0.0921 0% MS detector 0.01 0.0965 0.0944 0.0955 2% 1.04 0.1 0.0906 0.0965 0.0936 4% 1.02 1 0.0965 0.0950 0.0957 1% 1.04 10 0.1092 0.1093 0.1092 0% 1.19 Novus bead, 0 0.0482 0.0519 0.0501 5% GTX detector 0.01 0.0531 0.0522 0.0527 1% 1.05 0.1 0.0516 0.0515 0.0516 0% 1.03 1 0.0503 0.0488 0.0496 2% 0.99 10 0.0616 0.0585 0.0601 4% 1.20 Novus bead, 0 0.0161 0.0172 0.0167 5% Novus detector 0.01 0.0255 0.0175 0.0215 27% 1.29 0.1 0.0167 0.0132 0.0149 16% 0.90 1 0.0174 0.0179 0.0177 2% 1.06 10 0.0441 0.0461 0.0451 3% 2.71 Novus bead, 0 0.0515 0.0474 0.0494 6% MS detector 0.01 0.0511 0.0431 0.0471 12% 0.95 0.1 0.0470 0.0451 0.0460 3% 0.93 1 0.0480 0.0444 0.0462 6% 0.93 10 0.0475 0.0450 0.0462 4% 0.92 MS bead, 0 0.0698 0.0640 0.0669 6% GTX detector 0.01 0.0481 0.0445 0.0463 6% 0.69 0.1 0.0426 0.0425 0.0426 0% 0.64 1 0.0418 0.0409 0.0413 2% 0.62 10 0.0412 0.0418 0.0415 1% 0.62 MS bead, 0 0.0160 0.0168 0.0164 3% Novus detector 0.01 0.0183 0.0162 0.0172 9% 1.05 0.1 0.0164 0.0185 0.0175 8% 1.06 1 0.0212 0.0206 0.0209 2% 1.27 10 0.0437 0.0449 0.0443 2% 2.70

(64) Further experiments were carried out to evaluate the three-step format of the Quanterix assay and identify an optimal pair of capture antibody and detection antibody. The assay conditions are shown in Table 5. Table 6 shows results of the assessment. Similar to the two-step format, the combination of GTX as the capture antibody, and Novus as the detection antibody was identified as the optimal pair.

(65) TABLE-US-00007 TABLE 5 Incubation 3-step Assay Period conditions: Concentration Volume (minutes): Beads: 4e6 beads/well 25 ul/well 30:00 Detector: 0.1 ug/ml 100 ul/well 5:15 SBG: 150 pm 100 ul/well 5:15

(66) TABLE-US-00008 TABLE 6 UBE3A Capture/Detector Concentration Ave AEB Signal to Combination (ng/ml) AEB1 AEB2 AEB CV Background GTX bead, 0 0.0213 0.0214 0.0214 1% GTX detector 0.01 0.0190 0.0210 0.0200 7% 0.94 0.1 0.0192 0.0198 0.0195 2% 0.91 1 0.0243 0.0204 0.0224 12% 1.05 10 0.0337 0.0340 0.0339 1% 1.59 GTX bead, 0 0.0068 0.0054 0.0061 16% Novus detector 0.01 0.0064 0.0053 0.0059 13% 0.96 0.1 0.0050 0.0068 0.0059 22% 0.97 1 0.0097 0.0091 0.0094 5% 1.54 10 0.0356 0.0426 0.0391 13% 6.42 GTX bead, 0 0.0449 0.0436 0.0442 2% MS detector 0.01 0.0430 0.0459 0.0445 5% 1.01 0.1 0.0432 0.0414 0.0423 3% 0.96 1 0.0409 0.0476 0.0443 11% 1.00 10 0.0470 0.0463 0.0466 1% 1.05 Novus bead, 0 0.0223 0.0227 0.0225 1% GTX detector 0.01 0.0217 0.0245 0.0231 9% 1.03 0.1 0.0223 0.0228 0.0225 2% 1.00 1 0.0264 0.0248 0.0256 4% 1.14 10 0.0258 0.0245 0.0252 4% 1.12 Novus bead, 0 0.0098 0.0112 0.0105 10% Novus detector 0.01 0.0110 0.0112 0.0111 1% 1.06 0.1 0.0140 0.0114 0.0127 14% 1.21 1 0.0125 0.0145 0.0135 10% 1.29 10 0.0168 0.0179 0.0173 5% 1.65 Novus bead, 0 0.0247 0.0231 0.0239 5% MS detector 0.01 0.0221 0.0242 0.0232 6% 0.97 0.1 0.0269 0.0251 0.0260 5% 1.09 1 0.0277 0.0240 0.0259 10% 1.08 10 0.0249 NaN 0.0249 #DIV/0! 1.04 MS bead, 0 0.0189 0.0184 0.0187 2% GTX detector 0.01 0.0162 0.0191 0.0176 12% 0.94 0.1 0.0170 0.0184 0.0177 6% 0.95 1 0.0178 0.0198 0.0188 8% 1.01 10 0.0251 0.0292 0.0271 11% 1.45 MS bead, 0 0.0098 0.0076 0.0087 17% Novus detector 0.01 0.0086 0.0101 0.0093 12% 1.07 0.1 0.0107 0.0084 0.0095 18% 1.10 1 0.0095 0.0090 0.0092 4% 1.06 10 0.0153 0.0116 0.0134 20% 1.54

(67) Using the optimal pair of antibodies identified above, a comparison between the two-step format and the three-step format was carried out. Based on the results (Table 7), the three-step format has a lower background and better dynamic range, but the two-step format has higher sensitivity, and so the two-step format was selected for further evaluation.

(68) TABLE-US-00009 TABLE 7 UBE3A Assay Capture/Detector Concentration Ave AEB Signal to Format Combination (ng/ml) Weight AEB1 AEB2 AEB CV Background LOD 2-step GTX bead, 0 1 0.0046 0.0020 0.0033 56% 0.116 Novus detector 0.122 1.000 0.0040 0.0037 0.0039 5% 1.18 0.488 1.000 0.0073 0.0069 0.0071 4% 2.16 1.95 1.00 0.0180 0.0187 0.0184 3% 5.62 7.81 1.00 0.0580 0.0481 0.0530 13% 16.2 31.3 1.0 0.1414 0.1258 0.1336 8% 40.8 125 1 0.2628 0.2413 0.2520 6% 77.1 500 1 0.3030 0.3081 0.3055 1% 93.4 3-step GTX bead, 0 1 0.0018 0.0025 0.0022 23% 0.589 Novus detector 0.122 1.000 0.0021 0.0020 0.0020 1% 0.624 0.488 1.000 0.0023 0.0026 0.0025 9% 0.759 1.95 1.00 0.0052 0.0042 0.0047 15% 1.44 7.81 1.00 0.0143 0.0128 0.0135 8% 6.20 31.3 1.0 0.0425 0.0460 0.0443 6% 20.3 125 1 0.1219 0.1218 0.1218 0% 55.8 500 1 0.2290 0.2183 0.2236 3% 102.4

(69) An additional anti-UBE3A antibody 3E5 (SAB1404508-100 ug, Millipore-Sigma) was evaluated either as a capture antibody or a detector antibody, in combination with GTX, Novus, or MS 2F6, using both the two-step and three-step formats. The same conditions as those shown in Tables 3 and 5 were used. As shown in Table 8, GTX as the capture antibody and the MS 3E5 as the detector antibody showed a strong signal throughout the curve; however, MS 2F6 as the capture antibody and MS 3E5 as the detector antibody showed better signal to background ratio for lower end of the curve. Similar results were obtained from the two-step format (Table 9). Higher AEBs were observed for the combination of GTX as the capture antibody and MS 3E5 as the detector antibody at 1 ng/mL and 10 ng/mL UBE3a levels, when compared to other combinations. However, MS 2F6 as the capture antibody and MS 3E5 as the detector antibody showed better signal to background ratio for lower end of the curve.

(70) TABLE-US-00010 TABLE 8 Sample Capture/Detector Concentration Ave AEB Signal to Combination (ng/ml) AEB1 AEB2 AEB CV Background MS3E5 bead, 0 0.0548 0.0525 0.0537 3% GTX detector 0.01 0.0515 0.0500 0.0508 2% 0.946 0.1 0.0546 0.0600 0.0573 7% 1.07 1 0.0655 0.0625 0.0640 3% 1.19 10 0.1515 0.1455 0.1485 3% 2.77 MS3E5 bead, 0 0.0035 0.0032 0.0033 6% Novus detector 0.01 0.0038 0.0032 0.0035 14% 1.05 0.1 0.0026 0.0025 0.0025 1% 0.765 1 0.0040 0.0047 0.0044 12% 1.31 10 0.0157 0.0129 0.0143 14% 4.29 MS3E5 bead, 0 0.0080 0.0072 0.0076 8% MS 2F6 detector 0.010 0.0052 0.0068 0.0060 18% 0.792 0.1 0.0078 0.0073 0.0075 5% 0.990 1 0.0090 0.0088 0.0089 1% 1.17 10 0.0203 0.0195 0.0199 3% 2.62 GTX bead, 0 0.0079 0.0091 0.0085 10% MS 3E5 detector 0.01 0.0084 0.0082 0.0083 2% 0.972 0.1 0.0204 0.0181 0.0192 9% 2.25 1 NaN 0.0774 0.0774 9.06 10 0.4035 0.4249 0.4142 4% 48.5 Novus bead, 0 0.0092 0.0098 0.0095 7% MS 3E5 detector 0.01 0.0105 0.0102 0.0104 11% 1.09 0.1 0.0142 0.0119 0.0130 10% 1.38 1 0.0276 0.0233 0.0254 2% 2.68 10 0.1586 0.1540 0.1563 4% 16.5 MS 2F6 bead, 0 0.0041 0.0037 0.0039 13% MS 3E5 detector 0.010 0.0035 0.0048 0.0042 15% 1.06 0.1 0.0063 0.0064 0.0063 13% 1.62 1 0.0206 0.0228 0.0217 4% 5.52 10 0.1775 0.1883 0.1829 1% 46.6

(71) TABLE-US-00011 TABLE 9 Sample Capture/Detector Concentration Ave AEB Signal to Combination (ng/ml) AEB1 AEB2 AEB CV Background MS3E5 bead, 0 0.1450 0.1381 0.1415 3% GTX detector 0.01 0.1294 0.1340 0.1317 2% 0.931 0.1 0.1607 0.1495 0.1551 5% 1.10 1 0.1588 0.1653 0.1621 3% 1.15 10 0.4072 0.3845 0.3959 4% 2.80 MS3E5 bead, 0 0.0075 0.0073 0.0074 2% Novus detector 0.01 0.0065 0.0070 0.0068 5% 0.908 0.1 0.0090 0.0091 0.0090 1% 1.21 1 0.0227 0.0226 0.0226 0% 3.04 10 0.1500 0.1398 0.1449 5% 19.5 MS3E5 bead, 0 0.0165 0.0167 0.0166 1% MS 2F6 detector 0.01 0.0177 0.0160 0.0168 7% 1.01 0.1 0.0191 0.0180 0.0186 4% 1.12 1 0.0234 0.0226 0.0230 2% 1.39 10 0.0582 0.0565 0.0574 2% 3.46 GTX bead, 0 NaN NaN MS 3E5 detector 0.01 0.0162 0.0168 0.0165 2% 0.1 NaN NaN 1 0.1520 0.1567 0.1544 2% 10 0.7237 NaN 0.7237 Novus bead, 0 0.0237 0.0263 0.0250 7% MS 3E5 detector 0.01 0.0302 0.0257 0.0280 11% 1.12 0.1 0.0237 0.0272 0.0255 10% 1.02 1 0.0412 0.0426 0.0419 2% 1.68 10 0.1741 0.1644 0.1693 4% 6.77 MS 2F6 bead, 0 0.0123 0.0102 0.0112 13% MS 3E5 detector 0.01 0.0113 0.0141 0.0127 15% 1.13 0.1 0.0169 0.0141 0.0155 13% 1.38 1 0.0424 0.0451 0.0437 4% 3.90 10 0.3343 0.3378 0.3361 1% 30.0

(72) A head-to-head comparison of the top performing antibody pairs in both the two-step format and the three-step format was carried out. These antibody pairs were tested against a dilution curve of recombinant UBE3A. As shown in Tables 10 and 11, the combination of GTX as the capture antibody and MS 3E5 as the detector antibody under the three-step format was identified as the optimal assay condition with the lowest assay LOD and highest sensitivity.

(73) TABLE-US-00012 TABLE 10 Sample Capture/Detector Concentration Ave AEB Signal to Combination (ng/ml) AEB1 AEB2 AEB CV Background LOD GTX bead, 0 0.0022 0.0019 0.0021 11% 0.0328 Novus detector 0.032 0.0035 0.0027 0.0031 17% 1.49 0.16 0.0038 0.0040 0.0039 5% 1.88 0.80 0.0085 0.0124 0.0105 26% 5.03 4.00 0.0402 0.0398 0.0400 1% 19.2 20.0 0.1320 0.1311 0.1316 1% 63.2 100 0.2934 0.2882 0.2908 1% 140 500 0.2822 0.3093 0.2957 6% 142 GTX bead, 0 0.0234 0.0221 0.0227 4% 0.0173 MS 3E5 detector 0.032 0.0310 0.0329 0.0319 4% 1.41 0.16 0.0558 0.0571 0.0564 2% 2.48 0.80 0.1439 0.1397 0.1418 2% 6.24 4.00 0.3609 0.3619 0.3614 0% 15.9 20.0 2.2568 2.4486 2.3527 6% 104 100 4.2953 4.0826 4.1890 4% 184 500 12.2579 11.6411 11.9495 4% 526 MS 2F6 bead, 0 0.0144 0.0126 0.0135 9% 0.1211 MS 3E5 detector 0.032 0.0162 0.0146 0.0154 7% 1.14 0.16 0.0183 0.0155 0.0169 12% 1.25 0.80 0.0353 0.0370 0.0361 3% 2.67 4.00 0.1320 0.1271 0.1295 3% 9.58 20.0 0.5145 0.5520 0.5333 5% 39.4 100 2.7130 2.8789 2.7960 4% 207 500 10.9601 10.9142 10.9371 0% 809

(74) TABLE-US-00013 TABLE 11 Sample Capture/Detector Concentration Ave AEB Signal to Combination (ng/ml) AEB1 AEB2 AEB CV Background LOD GTX bead, 0 0.0077 0.0087 0.0082 9% 0.0089 MS 3E5 detector 0.032 0.0127 0.0142 0.0135 8% 1.65 0.16 0.0288 0.0291 0.0289 1% 3.53 0.80 0.0916 0.0961 0.0939 3% 11.5 4.00 0.2694 0.2615 0.2655 2% 32.4 20.0 0.7803 0.8205 0.8004 4% 97.8 100 3.3487 3.5060 3.4273 3% 419 500 9.9682 10.2678 10.1180 2% 1236 MS 2F6 bead, 0 0.0038 0.0038 0.0038 1% 0.0581 MS 3E5 detector 0.032 0.0032 0.0043 0.0037 20% 0.986 0.16 0.0071 0.0078 0.0074 7% 1.96 0.80 0.0183 0.0197 0.0190 5% 5.03 4.00 0.0868 0.0803 0.0836 5% 22.1 20.0 0.3516 0.3483 0.3500 1% 92.5 100 1.7911 1.8354 1.8133 2% 479 500 8.9003 8.5973 8.7488 2% 2312

(75) Next an initial run was carried out, using the 3-step format and the GTX/MS 3E5 combination. The recombinant UBE3A solution was incubated with the GTX-conjugated beads for 120 minutes, which is followed by 5 minutes of incubation with the detector antibody, and 5 minutes of incubation with SBG. Results are shown in Table 12.

(76) TABLE-US-00014 TABLE 12 Reagent Concentration Ave AEB Signal to LOD LLOQ Combination (ng/ml) AEB1 AEB2 AEB CV Background (pg/ml) (pg/ml) GTX Bead, 0.00 0.0018 0.0016 0.0017 8% 0.662 12.0 3E5 detector 0.00640 0.0054 0.0055 0.0055 1% 3.22 0.0320 0.0115 0.0095 0.0105 13% 6.15 0.160 0.0398 0.0389 0.0393 2% 23.1 0.800 0.1511 0.1539 0.1525 1% 89.4 4.00 0.5335 0.5501 0.5418 2% 318 20.0 2.7963 2.8794 2.8378 2% 1664 100 7.8585 8.1244 7.9914 2% 4687 500 16.8093 16.7680 16.7886 0% 9847

(77) Further optimization of the protocol included modifying the concentration of the capture antibody 3E5 (Table 13). 0.1 g/mL of 3E5 was selected. Table 14 shows results from modifications of streptavidin P3-galactosidase (SBG) concentrations. 100 pm SBG was selected.

(78) TABLE-US-00015 TABLE 13 Reagent Concentration Average AEB Signal to LOD LLOQ Combination (ng/ml) AEB1 AEB2 AEB3 AEB CV Background (pg/ml) (pg/ml) GTX Bead, 0 0.0183 0.0183 0.0213 0.0193 9% 4.92 43.0 0.1 ug/ml 0.00128 0.0242 0.0239 0.0247 0.0243 2% 1.26 3E5 detector 0.00640 0.0251 0.0238 0.0256 0.0248 4% 1.29 0.0320 0.0351 0.0400 0.0401 0.0384 8% 1.99 0.160 0.0828 0.0846 0.0837 2% 4.34 0.800 0.2566 0.2695 0.2449 0.2570 5% 13.3 4.00 0.8476 0.8915 0.8783 0.8725 3% 45.3 20.0 5.1061 5.6237 5.2046 5.3115 5% 276 GTX Bead, 0 0.0384 0.0399 0.0395 0.0393 2% 14.3 56.0 0.2 ug/ml 0.00128 0.0457 0.0439 0.0421 0.0439 4% 1.12 3E5 detector 0.00640 0.0421 0.0466 0.0433 0.0440 5% 1.12 0.0320 0.0619 0.0621 0.0587 0.0609 3% 1.55 0.160 0.1253 0.1227 0.1215 0.1232 2% 3.14 0.800 0.3548 0.3780 0.3582 0.3636 3% 9.26 4.00 1.1782 2.3185 1.1776 1.5581 42% 39.7 20.0 6.3769 6.9456 6.7713 6.6979 4% 171 GTX Bead, 0 0.0618 0.0597 0.0664 0.0626 5% 15.9 68.0 0.4 ug/ml 0.00128 0.0769 0.0720 0.0724 0.0738 4% 1.18 3E5 detector 0.00640 0.0671 0.0638 0.0865 0.0725 17% 1.16 0.0320 0.0958 0.0924 0.0950 0.0944 2% 1.51 0.160 0.1722 0.1652 0.1741 0.1705 3% 2.72 0.800 0.5092 0.4801 0.4784 0.4892 4% 7.81 4.00 2.3043 2.5815 2.4009 2.4289 6% 38.8 20.0 6.8245 7.9012 7.6665 7.4641 8% 119 GTX Bead, 0 0.1184 0.1254 0.1237 0.1225 3% 60.3 102 0.8 ug/ml 0.00128 0.1090 0.1086 0.1120 0.1099 2% 0.897 3E5 detector 0.00640 0.1144 0.1270 0.1173 0.1196 6% 0.976 0.0320 0.1442 0.1379 0.1516 0.1446 5% 1.18 0.160 0.2348 0.2631 0.2257 0.2412 8% 1.97 0.800 0.5889 0.6050 0.6149 0.6029 2% 4.92 4.00 3.1803 3.3754 3.1580 3.2379 4% 26.4 20.0 9.1622 10.3127 9.3743 9.6164 6% 78.5

(79) TABLE-US-00016 TABLE 14 Cure/Detector Concentration Average AEB Signal to LOD LLOQ Combination (ng/ml) AEB1 AEB2 AEB3 AEB CV Background (pg/ml) (pg/ml) GTX Bead, 0 0.0141 0.0128 0.0129 0.0133 6% 7.77 27.0 3E5 detector, 0.00128 0.0130 0.0180 0.0134 0.0148 19% 1.12 150 pm SI 0.00640 0.0136 0.0149 0.0140 0.0142 5% 1.07 0.0320 0.0262 0.0285 0.0282 0.0276 4% 2.08 0.160 0.0773 0.0769 0.0771 0% 5.82 0.800 0.2711 0.2847 0.2786 0.2781 2% 20.97 4.00 0.9068 0.9377 0.9272 0.9239 2% 69.65 20.0 5.8704 5.5732 5.7222 5.7219 3% 431.37 GTX Bead, 0 0.0091 0.0079 0.0082 0.0084 7% 5.53 24.0 3E5 detector, 0.00128 0.0082 0.0092 0.0096 0.0090 8% 1.07 100 pm SI 0.00640 0.0098 0.0098 0.0111 0.0103 7% 1.22 0.0320 0.0199 0.0201 0.0192 0.0197 2% 2.35 0.160 0.0582 0.0586 0.0574 0.0581 1% 6.93 0.800 0.2101 0.2145 0.2111 0.2119 1% 25.27 4.00 0.7390 0.7799 0.7067 0.7419 5% 88.50 20.0 3.9620 3.9703 4.0984 4.0102 2% 478.37 GTX Bead, 0 0.0031 0.0051 0.0049 0.0044 25% 5.11 32.0 3E5 detector, 0.00128 0.0046 0.0045 0.0047 0.0046 3% 1.06 75 pm SI 0.00640 0.0059 0.0047 0.0074 0.0060 23% 1.36 0.0320 0.0091 0.0117 0.0116 0.0108 14% 2.47 0.160 0.0299 0.0294 0.0300 0.0298 1% 6.82 0.800 0.0780 0.1151 0.1256 0.1062 24% 24.34 4.00 0.4587 0.4603 0.4584 0.4591 0% 105.21 20.0 2.4444 2.8068 2.7500 2.6671 7% 611.15

(80) Addition of helper beads and varying 3E5 levels were tested in combination, and no helper beads were selected (Tables 15 and 16).

(81) TABLE-US-00017 TABLE 15 Reagent Concentration Average AEB Signal to LOD LLOQ Combination (ng/ml) AEB1 AEB2 AEB CV Background (pg/ml) (pg/ml) GTX 0 0.0059 0.0053 0.0056 7% 6.93 35.0 Bead/Helper 0.00128 0.0065 0.0083 0.0074 17% 1.29 Beads, 3E5 0.00640 0.0065 0.0045 0.0055 25% 0.962 detector 0.0320 0.0159 0.0108 0.0134 27% 2.33 (0.1 ug/ml), 0.160 0.0417 0.0425 0.0421 1% 7.34 100 pm SBG 0.800 0.1665 0.1656 0.1660 0% 29.0 4.00 0.6395 0.6055 0.6225 4% 109 20.0 3.3690 3.4771 3.4231 2% 597 0 0.0103 0.0098 0.0100 3% 4.28 31.0 GTX 0.00128 0.0127 0.0115 0.0121 7% 1.25 Bead/Helper 0.00640 0.0133 0.0127 0.0130 3% 1.34 Beads, 3E5 0.0320 0.0226 0.0236 0.0231 3% 2.39 detector 0.160 0.0751 0.0703 0.0727 5% 7.51 (0.2 ug/ml), 0.800 0.2524 0.2608 0.2566 2% 26.5 100 pm SBG 4.00 0.8925 0.8455 0.8690 4% 89.8 20.0 5.6289 5.3912 5.5100 3% 570 GTX 0 0.0190 0.0170 0.0180 8% 4.15 33.0 Bead/Helper 0.00128 0.0222 0.0178 0.0200 16% 1.02 Beads, 3E5 0.00640 0.0326 0.0263 0.0294 15% 1.51 detector 0.0320 0.0370 0.0369 0.0370 0% 1.89 (0.4 ug/ml), 0.160 0.0913 0.1052 0.0983 10% 5.03 100 pm SBG 0.800 0.3406 0.3329 0.3368 2% 17.2 4.00 1.1622 1.1241 1.1432 2% 58.5 20.0 4.4122 6.4531 5.4326 27% 278

(82) TABLE-US-00018 TABLE 16 Reagent Concentration Average AEB Signal to LOD LLOQ Combination (ng/ml) AEB1 AEB2 AEB CV Background (pg/ml) (pg/ml) GTX Bead, 0 0.0054 0.0061 0.0057 8% 4.18 32.0 3E5 detector 0.00128 0.0050 0.0075 0.0062 29% 1.09 (0.1 ug/ml), 0.00640 0.0087 0.0092 0.0089 4% 1.56 100 pm SBG 0.0320 0.0108 0.0159 0.0133 27% 2.33 0.160 0.0402 0.0395 0.0399 1% 6.95 0.800 0.1636 0.1568 0.1602 3% 27.9 4.00 0.6073 0.6025 0.6049 1% 106 20.0 3.5717 3.2145 3.3931 7% 592 GTX Bead, 0 0.0094 0.0099 0.0097 4% 4.38 24.0 3E5 detector 0.00128 0.0099 0.0139 0.0119 24% 1.23 (0.2 ug/ml), 0.00640 0.0120 0.0120 1.24 100 pm SBG 0.0320 0.0229 0.0244 0.0236 4% 2.44 0.160 0.0675 0.0686 0.0680 1% 7.03 0.800 0.2503 0.2472 0.2487 1% 25.7 4.00 0.8779 0.8509 0.8644 2% 89.4 20.0 4.9554 4.9954 4.9754 1% 514 GTX Bead, 0 0.0196 0.0194 0.0195 1% 8.00 29.0 3E5 detector 0.00128 0.0195 0.0213 0.0204 6% 1.04 (0.4 ug/ml), 0.00640 0.0228 0.0232 0.0230 1% 1.18 100 pm SBG 0.0320 0.0366 0.0370 0.0368 1% 1.88 0.160 0.1004 0.1080 0.1042 5% 5.33 0.800 0.3352 0.3384 0.3368 1% 17.2 4.00 1.1023 1.1150 1.1086 1% 56.7 20.0 6.8013 6.3243 6.5628 5% 336

(83) Next, CSF samples were subjected to various detergent conditions, including 0.5% Tween, 1% Triton X-100, 0.5% Triton X-100, 1% SDS, 0.5% SDS, and 0.1% SDS (FIG. 2). Ionic detergents such as SDS was shown to not be compatible with the assay. 1% Triton X-100 showed improved performance, with 3 of the 5 samples above limit of detection (LOD; 0.0308 ng/mL), and 2 above lower limit of quantitation (LLOQ; 0.118 ng/mL). 1% Triton X-100 was therefore selected as the optimal detergent condition.

(84) With the optimized antibody pair and assay conditions, 10 CSF samples were tested. 40 L of CSF from 10 independent donors were ran in triplicates. The results (FIG. 3) showed that all 10 samples were below the LLOQ of the assay. Therefore, it was concluded that the assay was not suitable for detection of UBE3A in human CSF samples.

Example 2: LC-MS Based Detection of UBE3A

(85) A liquid chromatography-mass spectrometry (LC-MS) protocol was developed for detecting UBE3A.

(86) Sigma anti-UBE3A monoclonal antibody (clone 3E5, cat. SAB1404508-100 ug) was biotinylated using a Thermo Fisher biotinylation kit and then labeled onto M280 Streptavidin coated magnetic beads. 500 L sample (including 500 L CSF, or recombinant UBE3A) were placed in Eppendorf LoBind tubes. 50 L of 10RIPA lysis buffer (EMD Millipore cat. 20-188) was added to each sample. 10 L of antibody-conjugated beads were added to each sample. Samples were incubated with beads on end over end mixer (HulaMixer) for 2 hours at 4 C. Samples were placed on a tube magnet and liquid was discarded. 1 mL PBS+Tween-20 (0.01%) was added to each tube and then mixed on an end over end mixer (Hulamixer) at room temperature for 1 minute. Samples were put on a magnet and liquid was discarded. 1 mL PBS was added to each tube and then mixed on an end over end mixer (Hulamixer) at room temperature for 1 minute. Samples were put on a magnet and liquid was discarded. 0.5 mL PBS was added to each tube and then mixed on an end over end mixer (Hulamixer) at room temperature for 1 minute. Samples were put on a magnet and liquid was discarded. TPCK-treated trypsin (Worthington cat. LS003740) was made up to 1 mg/mL in PBS. Trypsin was then diluted by adding 3 L/450 L of PBS to make the digestion solution. 45 L of the digestion solution was added to each tube with beads. Samples were placed on ThermoMixer at 40 C. for 1.5 hrs. 5 L of 20% acetonitrile and 1% formic acid were added to each sample. Samples were put on a magnet and final solution (50 L) was added to plate for LC-MS analysis. Detectable peptides in the human UBE3A protein, and the relative abundance of these peptides can be found in Table 17. The detectable peptides are listed in the column sequence and the relative abundance can be found in the area column. A2 refers to detection confidence, and represents the confidence of the mass spectrometry system for detection of the particular peptide.

(87) TABLE-US-00019 TABLE17 # Peptide spectrum # matches # Modifi- Missed A2 Sequence (PSMs) Proteins cations Area Charge MH+[Da] Cleavages High KPLIPFEEFINEP 10 1 5.024E10 3 3445.73325 1 LNEVLEMDKDYTF FK High LEMIAMENPADLK 8 1 3.550E10 2 1602.82329 1 K High NLVNDDDAIVAAS 12 1 3.430E10 2 1444.73296 0 K High DHIIDDALVR 12 1 2.436E10 3 1166.61893 0 High VFSSAEALVQSFR 24 1 2.407E10 2 1440.74529 0 High MMETFQQLITYK 13 1 2.341E10 2 1532.74224 0 High VDPLETELGVK 9 1 2.043E10 1 1199.65247 0 High LGPDDVSVDIDAI 12 1 1.968E10 2 1484.75810 0 R High EFVNLYSDYILNK 20 1 1.777E10 2 1617.82781 0 High DVTYLTEEK 7 1 1.493E10 2 1097.54485 0 High NLDFQALEETTEY 18 1 1.446E10 2 2222.00127 0 DGGYTR High EREDYSPLIR 8 1 1.288E10 2 1277.64910 1 High NLGLYYDNR 19 1 1.266E10 1 1127.54614 0 High GFHMVTNESPLK 8 1 1.234E10 1 1359.67273 0 High DLGDSHPVLYQSL 7 1 1.206E10 1 1571.81067 0 K High LEMIAMENPADLK 4 1 1.096E10 1 1474.72864 0 High LFLQHTTGIDR 33 1 1.052E10 2 1298.68401 0 High EFWEIVHSFTDEQ 9 1 9.371E9 3 1950.93546 1 KR Low GFGML 3 1 7.608E9 1 524.25494 0 High RGFHMVTNESPLK 6 1 6.039E9 3 1515.77451 1 High EFWEIVHSFTDEQ 5 1 5.927E9 2 1794.83733 0 K High LGPDDVSVDIDAI 2 1 5.824E9 3 1640.86429 1 RR High DPNYLNLFIIVME 18 1 5.347E9 2 1850.95610 0 NR High RDHIIDDALVR 7 1 5.007E9 3 1322.71186 1 High KPLIPFEEFINEP 2 1 3.963E9 2 2644.33794 0 LNEVLEMDK High QLYVEFEGEQGVD 74 1 3.754E9 2 2069.97612 0 EGGVSK High ENGDKIPITNENR 5 1 3.688E9 2 1499.74541 1 High EDYSPLIR 5 1 3.498E9 2 992.50609 0 High LFLQHTTGTDRAP 2 1 1.627E9 2 1978.07500 1 VGGLGK High EFFQLVVEEIFNP 29 1 1.451E9 3 2998.42453 0 DIGMFTYDESTK Low GFGmL 1 1 M4(Oxi- 1.383E9 1 540.24927 0 dation) High VISNEFNSR 2 1 1.312E9 2 1065.53398 0 High DLLEYEGNVEDDM 27 1 1.136E9 3 4015.78708 0 MITFQISQTDLFG NPMMYDLK High RMMETFQQLITYK 3 1 1.050E9 2 1688.84917 1 High KPLIPFEEFINEP 2 1 1.042E9 3 4146.07175 2 LNEVLEMDKDYTF FKVETENK High RLFLQFTTGTDR 1 1 6.141E8 3 1454.77530 1 High KPLIPFEEFInEP 8 1 N11 5.963E8 3 3447.68772 1 LnEVLEMDKDYTF (Deami- FK dated); N15 (Deami- dated) High KPLIPFEEFINEP 1 1 M20(Oxi- 5.790E8 4 3461.74257 1 LNEVLEmDKDYTF dation) FK Low DYTFFK 2 1 5.233E8 1 820.38733 0 High MVYYANVVGGEVD 24 1 N17 4.991E8 3 4651.07956 0 TNHnEEDDEEPIP (Deami- ESSELTLqELLGE dated); ER Q34 (Deami- dated) High ITVLYSLVQGQQL 2 1 4.270E8 2 2105.17485 0 NPYLR High vFSSAEALVQSFR 2 1 N-Term 4.112E8 2 1482.76067 0 (Acetyl) High KQLYVEFEGEQGV 3 1 3.619E8 3 2198.06137 1 DEGGVSK High eFVNLYSDYILNK 1 1 N-Term 3.319E8 2 1659.82842 0 (Acetyl) High AMSKLPLAAQGKd 4 1 2.498E8 1 1214.69373 1 High HIIDDALVR 2 1 N-Term 2.498E8 2 1208.62480 0 (Acetyl) High KEFVNLYSDYILN 2 1 2.449E8 2 1745.90849 1 K High LEMIAmENPADLK 8 1 M6(Oxi- 2.425E8 2 1618.82292 1 K dation) High EnGDKIPITNENR 3 1 N2 2.235E8 2 1500.72893 1 (Deami- dated) High eFWEIVHSFTDEQ 2 1 N-Term 2.123E8 3 1992.94443 1 KR (Acetyl) High eREDYSPLIR 2 1 N-Term 2.108E8 2 1319.65788 1 (Acetyl) High IFLQHTTGTDR 2 1 N-Term 1.743E8 2 1340.68913 0 (Acetyl) Low dSVLIR 2 1 N-Term 1.344E8 2 744.42674 0 (Acetyl) High MmETFQQLITYK 2 1 M2(Oxi- 1.308E8 2 1548.75102 0 dation) High mMETFQQLITYK 2 1 N-Term 1.259E8 2 1574.75066 0 (Acetyl) High GFHmVTNESPLK 4 1 M4(Oxi- 1.258E8 2 1375.66850 0 dation) High NLDFqALEETTEY 26 1 Q5 1.191E8 2 2222.99150 0 DGGYTR (Deami- dated) High enGDKIPITNENR 8 1 N-Term 1.032E8 3 1670.83957 2 K (Acetyl); N2 (Deami- dated) High SGEPQSDDIEASR 1 1 N-Term 8.131E7 2 1432.61882 0 (Acetyl) High nLVNDDDAIVAAS 4 1 N1 8.056E7 2 1445.72197 0 K (Deami- dated) High GFHMVTnESPLK 3 1 N7 6.287E7 3 1360.66944 0 (Deami- dated) Medium RGFHmVTNESPLK 4 1 M5(Oxi- 6.278E7 4 1531.77468 1 dation) High RLFLQHTTGTDRA 1 1 5.906E7 3 2134.18540 2 PVGGLGK High eNGDKIPITNENR 3 1 N-Term 5.650E7 4 1669.85354 2 K (Acetyl) Medium ENGDKIPITnENR 6 1 N10 5.440E7 3 1628.83097 2 K (Deami- dated) Low aLELYK 2 1 N-Term 5.338E7 2 778.43724 0 (Acetyl) High eNGDKIPITNENR 2 1 N-Term 5.244E7 2 1541.74846 1 (Acetyl) High rDHIIDDALVR 2 1 N-Term 4.708E7 3 1364.73520 1 (Acetyl) High SGEPQSDDIEASR 1 1 4.263E7 2 1390.61089 0 High LEmIAmENPADLK 2 1 M3(Oxi- 4.099E7 3 1634.81687 1 K dation); M6(Oxi- dation) High nLGLYYDNR 1 1 N-Term 3.866E7 2 1169.56377 0 (Acetyl) Low mVYYAnVVGGEVD 3 1 M1(Oxi- 3.862E7 4 4666.12417 0 TNHNEEDDEEPIP dation); ESSELTLQELLG N6 EER (Deami- dated) High KQLYVEFEGEqGV 2 1 Q11 3.558E7 3 2199.06479 1 DEGGVSK (Deami- dated) High IEMIAMENPADLK 1 1 N-Term 3.486E7 3 1644.83530 1 K (Acetyl) High dLGDSHPVLYQSL 1 1 N-Term 3.432E7 2 1613.81536 0 K (Acetyl) High eFFQLWEEIFnPD 2 1 N-Term 3.418E7 3 3057.40921 0 IGmFTYDESTK (Acetyl); N12 (Deami- dated); M17(Oxi- dation) High MVYYAnVVGGEVD 14 1 N6 3.277E7 3 4652.08408 0 TnHnEEDDEEPIP (Deami- ESSELTLQELLGE dated); ER N15 (Deami- dated); N17 (Deami- dated) High EFFQLVVEEIFnP 6 1 N12 2.915E7 3 3015.41159 0 IGmFTYDESTKD (Deami- dated); M17(Oxi- dation) High DLLEYEGNVEDDM 8 1 Q18 2.762E7 3 4017.77414 0 MITFqISqTDLFG (Deami- NPMMYDLK dated); Q21 (Deami- dated) High DLLEYEGNVEDDM 2 1 Q18 2.323E7 3 4016.82236 0 MITFqISQTDLFG (Deami- NPMMYDLK dated) High EFFQLVVEEIFnP 38 1 N12 2.248E7 2 2999.41362 0 DIGMFTYDESTK (Deami- dated) High vISNEFNSR 1 1 N-Term 2.181E7 2 1107.54521 0 (Acetyl) High DLLEYEGNVEDDM 18 1 M14(Oxi- 2.119E7 3 4032.80600 0 mITFqISQTDLFG dation) NPMMYDLK Q18 (Deami- dated) High dVTYLTEEK 1 1 N-Term 2.039E7 2 1139.54619 0 (Acetyl) High EFVnLYSDYILNK 4 1 N4 1.748E7 2 1618.80608 0 (Deami- dated) Low gFGML 1 1 N-Term 1.707E7 1 566.26758 0 (Acetyl) High qLYVEFEGEQGV 30 1 Q1 1.657E7 2 2070.96465 0 DEGGVSK (Deami- dated) High KPLIPFEEFInEP 18 1 N11 1.652E7 3 3446.74472 1 LNEVLEMDKDYTF (Deami- FK dated) High EFFqLVVEEIFnP 9 1 Q4 1.375E7 3 3000.40354 0 DIGMFTYDESTK (Deami- dated); N12 (Deami- dated) High VISnEFNSR 2 1 N4 1.324E7 2 1066.51714 0 (Deami- dated) High eFFQLVVEEIFnP 4 1 N-Term 1.219E7 2 3041.40117 0 DIGMFTYDESTK (Acetyl); N12 (Deami- dated) High eDYSPLIR 1 1 N-Term 1.183E7 2 1034.51506 0 (Acetyl) High enGDKIPITNENR 1 1 N-Term 9.546E6 2 1542.74932 1 (Acetyl); N2 (Deami- dated) High DLLEYEGNVEDDM 3 1 M14(Oxi- 6.616E6 3 4034.78061 0 mITFqISqTDLFG dation) nPMMYDLK Q18 (Deami- dated); Q21 (Deami- dated); N27 (Deami- dated) High mVYYANVVGGEVD 2 1 M1(Oxi- 5.120E6 4 4667.05825 0 TnHnEEDDEEPIP dation); ESSELTLQELLGE N15 ER (Deami- dated); N17 (Deami- dated) Low RGFHmVTnESPLK 1 1 M5(Oxi- 4.924E6 3 1532.76688 1 dation); N8 (Deami- dated) Low ENGDKIPITNENR 3 1 3.125E6 3 1627.84146 2 K Low HLIER 2 1 3.092E6 2 667.39018 0 High IGDSSQGDNNLQK 1 1 2.137E6 2 1375.64824 0 Medium YNADQIR 1 1 1.506E6 2 879.43297 0 Low NGPDTER 1 1 1.442E6 2 788.35484 0 Low MYSER 1 1 5.242E5 2 685.29863 0 Low KGTFR 1 1 9.978E4 2 608.35253 1 High EFFQLWEEIFNPD 13 1 M17(Oxi- 0.000E0 3 3014.39463 0 IGmFTYDESTK dation) High KPLIPFEEFInEP 4 1 N11 0.000E0 3 2645.35709 0 LNEVLEMDK (Deami- dated) High DPNYLnLFIIVME 4 1 N6 0.000E0 1 1851.94519 0 NR (Deami- dated) High eFWEIVHSFTDEQ 3 1 N-Term 0.000E0 2 1836.84673 0 K (Acetyl) Low VFSSAEALVqSFR 3 1 Q10 0.000E0 2 1441.72222 0 (Deami- dated) High KPLIPFEEFInEP 2 1 N11 0.000E0 3 3462.73130 1 LNEVLEmDKDYTF (Deami- FK dated); M20(Oxi- dation) High DLLEYEGNVEDDM 2 1 Q18 0.000E0 3 4018.71860 0 MITFqISqTDLFG (Deami- nPMMYDLK dated); Q21 (Deami- dated); N27 (Deami- dated) High mVYYAnVVGGEVD 2 1 M1(Oxi- 0.000E0 4 4668.09194 0 TnHnEEDDEEPIP dation); ESSELTLQELLGE N6 ER (Deami- dated); N15 (Deami- dated); N17 (Deami- dated) High dLLEYEGNVEDDM 2 1 N-Term 0.000E0 3 4059.80710 0 MITFqISqTDLFG (Acetyl); NPMMYDLK Q18 (Deami- dated); Q21 (Deami- dated) High LEmIAMEnPADLK 2 1 M3(Oxi- 0.000E0 2 1491.71733 0 dation); N8 (Deami- dated) Low mIIAK 2 1 N-Term 0.000E0 2 617.37084 0 (Acetyl) Low DLLEYEGNVEDDM 2 1 M14(Oxi- 0.000E0 3 4064.78061 0 mITFQISQTDLFG dation) nPmmYDLK N27 (Deami- dated); M29(Oxi- dation) M30(Oxi- dation) High nLDFqALEETTEY 1 1 N1 0.000E0 2 2223.94829 0 DGGYTR (Deami- dated); Q5 (Deami- dated) High eDYSPLIRVIGRV 1 1 N-Term 0.000E0 3 2881.49594 2 FSSAEALVQSFRe (Acetyl) High FFqLVVEEIFnPD 1 1 N-Term 0.000E0 2 3042.36577 0 IGMFTYDESTK (Acetyl); Q4 (Deami- dated); N12 (Deami- dated) High MDNNAAAIK 1 1 0.000E0 2 947.46037 0 High EFFqLWEEIFnPD 1 1 Q4 0.000E0 3 3016.38443 0 IGmFTYDESTK (Deami- dated); N12 (Deami- dated); M17(Oxi- dation)

(88) The most abundant detectable peptides included: VFSSAEALVQSFR (SEQ ID NO:3), NLVNDDDAIVAASK (SEQ ID NO:4), VDPLETELGVK (SEQ ID NO:5), and LEMIAMENPADLKK (SEQ ID NO:6). These peptides are bolded in the sequence of UBE3A below:

(89) TABLE-US-00020 (SEQIDNO:1) MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIER YYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAI KALELYKINAKLCDPHPSKKGASSAYLENSKGAPN NSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELC REREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTK EELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEAS SSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTR LLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRD PNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSK LPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYK VISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVG GEVDTNHNEEDDEEPIPESSELTLQELLGEERRNK KGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLN EVLEMDKDYTFFKVETENKFSFMTCPFILNAVTKN LGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRL KVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFE GEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDES TKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILD VHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDL LEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENG DKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRR GFHMVTNESPLKYLFRPEEIELLICGSRNLDFQAL EETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLF LQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTS HTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML

(90) CSF samples from 14 independent donors were collected and subjected to the above protocol. In 12 out of the 14 samples, UBE3A was detected (FIG. 4). The assay was also highly reproducible. Pooled CSF was split into 6 aliquots of 500 L each and subjected to the above protocol with 5% CV in 6 replicates ran in parallel (FIG. 5).

(91) To further evaluate assay specificity, UBE3A in HEK293T cells was knocked down by UBE3A shRNA prior to running the detection assay. Specifically, HEK293T cells were either treated with control shRNA or 1 of 4 UBE3A shRNAs. Cells were lysed and the LC-MS assay described above was performed on these lysates. As shown in FIG. 6, a reduction in the UBE3A signals were observed in cells where UBE3A was knocked down.

(92) To see if the UBE3A signal detected using the assay correlated with the CSF volume, different volumes of CSF (1 mL, 500 L, 250 L, 125 L, 0 L) from a single source were tested. As shown in FIGS. 7A and 7B, good parallelism between the mass spectrometry signal and the volume of CSF samples were observed.

(93) These results demonstrate that the LC-MS assay allows specific detection of the UBE3A protein in patient CSF samples. The detection was selective, based on recombinant linearity, endogenous parallelism, and tissue KD.

Other Embodiments

(94) While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.