Antibodies for detection of <i>Mycoplasma hyopneumoniae </i>and methods of making and using same
12497444 ยท 2025-12-16
Assignee
Inventors
- Maxim Chacko-Joseph Cheeran (Apple Valley, MN, US)
- Venkatramana Divana Krishna Bhat (St. Paul, MN, US)
- Maria Graciela Pieters Silva (Arden Hills, MN, US)
Cpc classification
G01N2469/10
PHYSICS
C07K2317/33
CHEMISTRY; METALLURGY
C07K16/1253
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
International classification
A61K39/395
HUMAN NECESSITIES
Abstract
Antibodies that detect M. hyopneumoniae, methods of making those antibodies, and methods of using those antibodies including, for example, in a diagnostic immunoassay, are described. Such a diagnostic assay may be used in pen-side testing for detection of M. hyopneumoniae.
Claims
1. An antibody that binds M. hyopneumoniae, wherein the antibody comprises: a heavy chain variable region comprising: amino acids 50-54 of SEQ ID NO:2, amino acids 69-84 of SEQ ID NO:2, and amino acids 117-126 of SEQ ID NO:2; and a light chain variable region comprising: amino acids 44-54 of SEQ ID NO:4, amino acids 70-76 of SEQ ID NO:4, and amino acids 109-117 of SEQ ID NO:4.
2. The antibody of claim 1, wherein the antibody is humanized.
3. The antibody of claim 1, wherein the antibody comprises an antibody fragment.
4. The antibody of claim 1, wherein the antibody is an IgG antibody.
5. The antibody of claim 1, wherein the antibody is a monoclonal antibody.
6. The antibody of claim 1, wherein the antibody is a chimeric antibody.
7. A method comprising using the antibody of claim 1 in an in vitro or in vivo diagnostic or therapeutic method.
8. The method of claim 7, wherein the method comprises detecting the presence of M. hyopneumoniae in a subject.
9. The method of claim 7, wherein the method comprises detecting the presence of M. hyopneumoniae in a sample obtained from a subject.
10. The method of claim 7, wherein the method comprises performing a magnetic bioassay or enzyme-linked immunosorbent assay (ELISA).
11. The method of claim 10, wherein the method comprises performing sandwich ELISA.
12. The method of claim 7, wherein the method comprises detecting a change in the magnetoresistance ratio (MR) from a giant magnetoresistance (GMR) sensor.
13. The method of claim 12, wherein the method comprises transmitting the detected change in the magnetoresistance ratio (AMR) to a smartphone, a tablet, or a computer.
14. A composition comprising the antibody of claim 1.
15. A kit or a device comprising the antibody of claim 1.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
(11) This disclosure describes antibodies that bind to M. hyopneumoniae. This disclosure further describes methods of making those antibodies and of using those antibodies including, for example, in a diagnostic immunoassay. Such a diagnostic assay may be used in pen-side testing for detection of M. hyopneumoniae.
(12) As further described herein, the antibodies that bind to M. hyopneumoniae may be used for the detection of M. hyopneumoniae. Using antibodies that bind to M. hyopneumoniae is more accurate than existing diagnostic assays for M. hyopneumoniae that detect serum antibodies. Moreover, using antibodies that bind to M. hyopneumoniae (particularly in the context of, for example, a kit) is easier than existing diagnostic assays for M. hyopneumoniae that use PCR to detect the bacterial genome; in contrast to PCR, a kit that include antibodies that bind to M. hyopneumoniae requires no specialized expertise.
(13) Antibodies
(14) In one aspect, this disclosure describes antibodies that bind to M. hyopneumoniae. As used herein, the term antibody refers generally an immunoglobulin or a fragment thereof. Thus, as used herein, the term antibody encompasses not only immunoglobulins with an intact Fc region, but also antibody fragments capable of binding to a biological molecule (such as an antigen or receptor) or a portion thereof, including but not limited to Fab, Fab, F(ab).sub.2, pFc, Fd, Fd, Fv, dAB, a single domain antibody (sdAb), a variable fragment (Fv), a single-chain variable fragment (scFv) or a disulfide-linked Fv (sdFv), a diabody or a bivalent diabody, a linear antibody, a single-chain antibody molecule, or a multispecific antibody (e.g., a tribody) formed from antibody fragments. The antibody can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2), or subclass.
(15) In one or more embodiments, the antibody can be a humanized antibody derived from an animal single domain antibody. While an scFv has a heavy variable chain component and a light variable chain component joined by a flanking sequence, a single domain antibody consists of a single monomeric variable chaini.e., a variable heavy chin or a variable light chainthat is capable of specifically engaging a target. A single domain antibody may be derived from an antibody of any suitable animal such as, for example, a camelid (e.g., a llama or camel) or a cartilaginous fish (e.g., a wobbegong or a nurse shark). A single domain antibody can provide superior physical stability, an ability to bind deep grooves, and increased production yields compared to larger antibody fragments.
(16) In one or more embodiments, an antibody that binds to M. hyopneumoniae is a monoclonal antibody. In one or more embodiments, antibodies that bind to M. hyopneumoniae include monoclonal antibodies produced by the hybridoma cell lines (also referred to herein as clones) 2C9.B3 or 4G11.A3; such antibodies are also referred to herein as MAb 2C9.B3 (or MAb2) and MAb 4G11.A3 (or MAb4), respectively.
(17) In one or more embodiments, an antibody that binds to M. hyopneumoniae preferably does not bind to other commensal or pathogenic species of swine Mycoplasma. For example, in one or more embodiments, an antibody that binds to M. hyopneumoniae preferably does not bind to M. hyorhinis or M. flocculare.
(18) In one or more embodiments, the antibody is an isolated antibody. In one or more embodiments, the antibodies may be isolated or purified by conventional immunoglobulin purification procedures, such as protein A-Sepharose chromatography, protein G-Sepharose chromatography, hydroxyapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
(19) In one or more embodiments, an antibody that binds to M. hyopneumoniae may include a derivative of an antibody that is modified or conjugated by the covalent attachment of any type of molecule to the antibody. Such antibody derivatives include, for example, antibodies that have been modified by glycosylation, acetylation, PEGylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, toxins, or linkage to a cellular ligand or other protein. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to, specific chemical cleavage, acetylation, formylation, and metabolic synthesis of tunicamycin. Additionally, the derivatives may contain one or more non-classical amino acids.
(20) An antibody that binds to M. hyopneumoniae may be coupled directly or indirectly to a detectable marker by techniques well known in the art. A detectable marker is an agent detectable using, for example, spectroscopic, photochemical, biochemical, immunochemical, or chemical methods. Useful detectable markers include, but are not limited to, magnetic nanoparticles, magnetic microbeads, fluorescent dyes and materials, chemiluminescent compounds and materials, bioluminescent materials, electron-dense reagents, enzymes, coenzymes, colored particles, biotin, digoxigenin, or radioactive materials that include a radioisotope. A detectable marker may generate a measurable signal, such as radioactivity, fluorescent light, color, or enzyme activity. Antibodies conjugated to detectable markers may be used for diagnostic or therapeutic purposes. The detectable marker may be coupled or conjugated either directly to the antibody or indirectly, through an intermediate such as, for example, a linker known in the art, using techniques known in the art. See, for example, U.S. Pat. No. 4,741,900, describing the conjugation of metal ions to antibodies for diagnostic use. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, and acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride and phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferin, and aequorin; and examples of suitable radioactive material include iodine (.sup.121I, .sup.123I, .sup.125I, .sup.131I), carbon (.sup.14C), sulfur (.sup.35S), tritium (.sup.3H), indium (.sup.111In, .sup.112In, .sup.113mIn, .sup.115mIn), technetium (.sup.99Tc, .sup.99mTc), thallium (.sup.201Ti) gallium (.sup.68Ga, .sup.67Ga), palladium (.sup.103Pd), molybdenum (.sup.99Mo), xenon (.sup.133Xe), fluorine (.sup.18F), .sup.153Sm, .sup.177Lu, .sup.159Gd, .sup.149Pm, .sup.140La, .sup.175Yb, .sup.166Ho, .sub.90Y, .sup.47Sc, .sup.186Re, .sup.188Re, .sup.142Pr, .sup.105Rh, and .sup.97Ru. Techniques for conjugating such moieties to antibodies are well-known.
(21) In an exemplary embodiment, the antibody may be conjugated to biotin. In another exemplary embodiment, the antibody may be directly or indirectly conjugated to a magnetic nanoparticle, such as MACS, streptavidin-coated superparamagnetic microbeads, available from Miltenyi Biotech (Bergisch Gladbach, Germany) and Miltenyi Biotec, Inc. (Auburn, California). For example, as shown in
(22) Also included in the present disclosure are monoclonal antibodies produced by progeny or derivatives of these hybridoma cell lines, monoclonal antibodies produced by equivalent or similar hybridoma cell lines, and/or recombinant derivatives made thereof. In one or more embodiments, an antibody that binds to M. hyopneumoniae includes a recombinantly derived monoclonal that includes one or more complementarity determining regions (CDRs) of MAb 2C9.B3 or MAb 4G11.A3.
(23) An intact antibody molecule has two heavy (H) chain variable regions (abbreviated herein as V.sub.H) and two light (L) chain variable regions (abbreviated herein as V.sub.L). The V.sub.H and V.sub.L regions may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs). The extent of the FRs and CDRs has been precisely defined (see, Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, and Chothia et al. (1987) J. Mol. Biol. 196: 901-917). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
(24) In one or more embodiments, an antibody that binds to M. hyopneumoniae includes the V.sub.H domain of the monoclonal antibody produced by hybridoma cell line 2C9.B3 (MAb 2C9.B3; SEQ ID NO:2) or the V.sub.H domain of the monoclonal antibody produced by hybridoma cell line 4G11.A3 (MAb 4G11.A3; SEQ ID NO:6). In one or more embodiments, an antibody that binds to M. hyopneumoniae includes the V.sub.L domain of the monoclonal antibody produced by hybridoma cell line 2C9.B3 (MAb 2C9.B3; SEQ ID NO:4) or the V.sub.L domain of the monoclonal antibody produced by hybridoma cell line 4G11.A3 (MAb 4G11.A3; SEQ ID NO:8). In one or more embodiments, an antibody that binds to M. hyopneumoniae includes the V.sub.H domain and the V.sub.L domain of MAb 2C9.B3 or the V.sub.H domain and the V.sub.L domain of MAb 4G11.A3. In one or more embodiments, an antibody that binds to M. hyopneumoniae may contain one, two, three, four, five, six, or more amino acid substitutions compared to the amino acid sequences of the V.sub.H domains and/or the V.sub.L domains identified above wherein the amino acid substitutions do not substantially affect binding of the antibody to M. hyopneumoniae. The amino acid substitutions may occur in the FRs or the CDRs.
(25) In one or more embodiments, an antibody that binds to M. hyopneumoniae includes at least one CDR of the V.sub.H domain of MAb 2C9.B3 (amino acids 50-54 of SEQ ID NO:2, amino acids 69-84 of SEQ ID NO:2, or amino acids 117-126 of SEQ ID NO:2) or at least one CDR of the V.sub.H domain of MAb 4G11.A3 (amino acids 50-54 of SEQ ID NO:6, amino acids 69-85 of SEQ ID NO:6, or amino acids 118-132 of SEQ ID NO:6). In one or more embodiments, an antibody that binds to M. hyopneumoniae includes at least two CDRs of the V.sub.H domain of MAb 2C9.B3 or at least two CDRs of the V.sub.H domain of MAb 4G11.A3. In one or more embodiments, an antibody that binds to M. hyopneumoniae includes all three CDRs of the V.sub.H domain of MAb 2C9.B3 or all three CDRs of the V.sub.H domain of MAb 4G11.A3.
(26) Additionally or alternatively, in one or more embodiments, an antibody that binds to M. hyopneumoniae includes at least one CDR of the V.sub.L domain of MAb 2C9.B3 (amino acids 44-54 of SEQ ID NO:4, amino acids 70-76 of SEQ ID NO:4, or amino acids 109-117 of SEQ ID NO:4) or at least one CDR of the V.sub.L domain of MAb 4G11.A3 (amino acids 46-55 of SEQ ID NO:8, amino acids 71-77 of SEQ ID NO:8, or amino acids 110-118 of SEQ ID NO:8). In one or more embodiments, an antibody that binds to M. hyopneumoniae includes at least two CDRs of the V.sub.L domain of MAb 2C9.B3 or at least two CDRs of the V.sub.L domain of MAb 4G11.A3. In one or more embodiments, an antibody that binds to M. an antibody that binds to M. hyopneumoniae
(27) In one or more embodiments, may contain one, two, three, four, five, six, or more amino acid substitutions in one or more CDRs identified above that do not substantially affect binding of the antibody to M. hyopneumoniae.
(28) In one or more embodiments, an antibody that binds to M. hyopneumoniae may contain one, two, three, four, five, six, or more amino acid substitutions in one or more framework regions (FRs). In one or more embodiments, the substitution or substitutions in the FRs do not substantially affect binding of the antibody to M. hyopneumoniae.
(29) In one or more embodiments, an antibody that binds to M. hyopneumoniae includes an amino acid sequence having at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to an amino acid sequence of at least one CDR of a V.sub.H domain of MAb 2C9.B3 or MAb 4G11.A3.
(30) In one or more embodiments, an antibody that binds to M. hyopneumoniae includes an amino acid sequence having at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to an amino acid sequence of at least one CDR of a V.sub.L domain of MAb 2C9.B3 or MAb 4G11.A3.
(31) In another aspect, this disclosure describes an isolated nucleic acid sequence that encodes any embodiment of an antibody that binds to M. hyopneumoniae (or fragment thereof). In one or more embodiments, the isolated nucleic acid encodes an antibody that includes one or more of the CDRs of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, or SEQ ID NO:8. Given the amino acid sequence of any antibody or antibody fragment, a person of ordinary skill in the art can determine the full scope of polynucleotides that encode that amino acid sequence using conventional, routine methods. In one or more embodiments, the isolated nucleotide can include the portion or portions of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, or SEQ ID NO:7 that encode one or more CDRs of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, or SEQ ID NO:8.
(32) As used herein, the term nucleic acid or oligonucleotide refers to polynucleotides such as deoxyribonucleic acid (DNA) or ribonucleic acid (RNA). Nucleic acids include but are not limited to genomic DNA, cDNA, mRNA, iRNA, miRNA, tRNA, ncRNA, rRNA, and recombinantly produced and chemically synthesized molecules such as aptamers, plasmids, anti-sense DNA strands, shRNA, ribozymes, nucleic acids conjugates, and oligonucleotides. A nucleic acid may be single-stranded, double-stranded, linear, or covalently circularly closed molecule. A nucleic acid can be isolated. The term isolated nucleic acid means that the nucleic acid (i) was amplified in vitro, for example via polymerase chain reaction (PCR), (ii) was produced recombinantly by cloning, (iii) was purified, for example, by cleavage and separation by gel electrophoresis, (iv) was synthesized, for example, by chemical synthesis, or (vi) extracted from a sample. A nucleic might be introducedi.e., transfectedinto cells. When RNA is used to transfect cells, the RNA may be modified by stabilizing modifications, capping, or polyadenylation.
(33) As used herein amplified DNA or PCR product refers to an amplified fragment of DNA of defined size. Various techniques are available and well known in the art to detect PCR products. PCR product detection methods include, but are not restricted to, gel electrophoresis using agarose or polyacrylamide gel and adding ethidium bromide staining (a DNA intercalant), labeled probes (radioactive or non-radioactive labels, southern blotting), labeled deoxyribonucleotides (for the direct incorporation of radioactive or non-radioactive labels) or silver staining for the direct visualization of the amplified PCR products; restriction endonuclease digestion, which relies on agarose gel electrophoresis, polyacrylamide gel electrophoresis, or high-performance liquid chromatography (HPLC); dot blots, using the hybridization of the amplified DNA on specific labeled probes (radioactive or non-radioactive labels); high-pressure liquid chromatography using ultraviolet detection; electro-chemiluminescence coupled with voltage-initiated chemical reaction/photon detection; and direct sequencing using radioactive or fluorescently labeled deoxyribonucleotides for the determination of the precise order of nucleotides with a DNA fragment of interest, oligo ligation assay (OLA), PCR, qPCR, DNA sequencing, fluorescence, gel electrophoresis, magnetic beads, allele specific primer extension (ASPE) and/or direct hybridization.
(34) Generally, nucleic acid can be extracted, isolated, amplified, or analyzed by a variety of techniques well-established and known to those of skill in the art. Examples of nucleic acid analysis include, but are not limited to, sequencing and DNA-protein interaction. Sequencing may be by any method known in the art. DNA sequencing techniques include classic dideoxy sequencing reactions (Sanger method) using labeled terminators or primers and gel separation in slab or capillary, and next generation sequencing methods such as sequencing by synthesis using reversibly terminated labeled nucleotides, pyrosequencing, 454 sequencing, Illumina/Solexa sequencing, allele specific hybridization to a library of labeled oligonucleotide probes, sequencing by synthesis using allele specific hybridization to a library of labeled clones that is followed by ligation, real time monitoring of the incorporation of labeled nucleotides during a polymerization step, polony sequencing, and SOLiD sequencing. Separated molecules may be sequenced by sequential or single extension reactions using polymerases or ligases as well as by single or sequential differential hybridizations with libraries of probes.
(35) In another aspect, this disclosure describes a host cell including any of the isolated nucleic acid sequences and/or proteins described herein. Thus, this disclosure encompasses translation of a nucleic acid (e.g., an mRNA) by a host cell to produce an antibody encoded by the nucleic acid.
(36) The nucleic acid constructs described herein may be introduced into a host cell, thus allowing expression of the antibody within the cell, thereby generating a genetically engineered cell. A variety of methods are known in the art and suitable for introducing a nucleic acid into a cell, including viral and non-viral mediated techniques. Examples of typical non-viral mediated techniques include, but are not limited to, electroporation, calcium phosphate mediated transfer, nucleofection, sonoporation, heat shock, magnetofection, liposome mediated transfer, microinjection, microproj ectile mediated transfer (nanoparticles), cationic polymer mediated transfer (DEAE-dextran, polyethylenimine, polyethylene glycol (PEG) and the like) or cell fusion. Other methods of transfection include proprietary transfection reagents such as LIPOFECTAMINE (Thermo Fisher Scientific, Inc., Waltham, MA), HILYMAX (Dojindo Molecular Technologies, Inc., Rockville, MD), FUGENE (Promega Corp., Madison, WI), JETPEI (Polyplus Transfection, Illkirch, France), EFFECTENE (Qiagen, Hilden, Germany) and DreamFect (OZ Biosciences, Inc. USA, San Diego, CA).
(37) The nucleic acid constructs described herein may be introduced into a host cell to be altered, thus allowing expression within the cell of the protein encoded by the nucleic acid. A variety of host cells are known in the art and suitable for protein expression. Examples of typical cell used for transfection and protein expression include, but are not limited to, a bacterial cell, a eukaryotic cell, a yeast cell, an insect cell, or a plant cell such as, for example, E. coli, Bacillus, Streptomyces, Pichia pastoris, Salmonella typhimurium, Drosophila S2, Spodoptera SJ9, CHO, COS (e.g., COS-7),3T3-F442A, HeLa, HUVEC, HUAEC, NIH 3T3, Jurkat, 293, 293H, or 293F.
(38) The antibody may be an antibody from any suitable species. In one or more embodiments, the antibody may be a mouse antibody. In one or more embodiments, the antibody may be a rat antibody. In one or more embodiments, the antibody may be a rabbit antibody.
(39) In one or more embodiments, the antibody is an IgG antibody. In one or more embodiments, the antibody may be an antibody or an IgG subclass including, for example, IgG1, IgG2, IgG3 or IgG4. In one or more embodiments, the antibody may be a mouse IgG of one of the following sub-classes: IgG1, IgG2A, IgG2B, IgG2C, and IgG3. In one or more embodiments, the antibody may be a mouse IgG1.
(40) In one or more embodiments, the antibody may include a kappa light chain. In one or more embodiments, the antibody may include a lambda light chain.
(41) In one or more embodiments, the monoclonal antibody includes an antigen-binding fragment such as, for example, a Fab fragment, a Fab fragment, an F(ab).sub.2 fragment, and/or an Fv fragment.
(42) In one or more embodiments, the antibody may be a humanized antibody. An antibody that binds to M. hyopneumoniae may be humanized by any suitable method. Techniques for producing humanized monoclonal antibodies may be found, for example, in Jones et al. (1986) Nature 321:522 and Singer et al. (1993) J. Immunol. 150:2844. For example, humanization of the antibody may include changes to the antibody to reduce the immunogenicity of the antibody when used in humans. In one or more embodiments, a humanized antibody that binds to M. hyopneumoniae may include at least a portion of an immunoglobulin constant region (Fc) of a human immunoglobulin. A humanized antibody that binds to M. hyopneumoniae may include, in one or more embodiments, a human immunoglobulin (recipient antibody) in which residues from one or more complementary determining regions (CDRs) of the recipient antibody are replaced by residues from one or more CDRs of a non-human species antibody (donor antibody), such as mouse, rat, or rabbit antibody, that binds to M. hyopneumoniae. In one or more embodiments, Fv framework residues of a human immunoglobulin may be replaced by corresponding non-human residues from an antibody that binds to M. hyopneumoniae.
(43) In one or more embodiments, a monoclonal antibody includes a chimeric antibodyi.e., an antibody in which different portions are derived from different animal species. A chimeric antibody may be obtained by any known method such as, for example, splicing the genes from a mouse antibody molecule with appropriate antigen specificity together with genes from a human antibody molecule of appropriate biological specificity. Methods for preparing chimeric antibodies are established and well-known to those of ordinary skill in the art.
(44) Hybridoma Cell Lines
(45) This disclosure further describes hybridoma cell lines (also referred to herein as clones or antibody clones) 2C9 and 4G11, and their subclones 2C9.B3 and 4G11.A3 (also referred to by the internal laboratory designations M. hyo 2C9.B3 and M. hyo 4G11.A3). 2C9.B3 and 4G11.A3 express monoclonal antibodies MAb 2C9.B3 and MAb 4G11.A3, respectively. In one or more embodiments, a monoclonal antibody produced by a hybridoma cell line binds to M. hyopneumoniae.
(46) Hybridoma cell lines may be obtained by various techniques familiar to those skilled in the art. In one or more embodiments, the animal immunized to produce a hybridoma cell line is preferably a mammal. In one or more embodiments, the immunized animal is a rat including (e.g., a Wistar rat) or a mouse (e.g., a BALB/C mouse). In one or more embodiments, the cells obtained from the immunized animal to produce a hybridoma are spleen cells. In one or more embodiments, the cells obtained from the immunized animal to produce a hybridoma are preferably lymphocytes. In one or more embodiments, the hybridoma is produced using a myeloma cell such as, for example, an SP2/O cell.
(47) Other known methods of producing transformed B cell lines that produce monoclonal antibodies may also be used.
(48) Methods of Making the Antibodies
(49) In another aspect, this disclosure describes methods of making antibodies that detect M. hyopneumoniae.
(50) A monoclonal antibody may be obtained by any suitable technique.
(51) In one or more embodiments, a monoclonal antibody that binds to M. hyopneumoniae may be produced by a hybridoma cell described herein.
(52) In one or more embodiments, an antibody that binds to M. hyopneumoniae may be made by recombinant DNA methods, produced by phage display, and/or produced by combinatorial methods. DNA encoding an antibody that binds to M. hyopneumoniae may be readily isolated and sequenced using conventional procedures. In one or more embodiments, a hybridoma cell described herein may serve as a source of such DNA. Once isolated, the DNA may be transfected into a host cell (including, for example, simian COS cells, Chinese hamster ovary (CHO) cells, human embryonic kidney cells (HEK), or myeloma cells that do not otherwise produce immunoglobulin protein) or introduced into a host cell by genome editing (for example, using a CRISPR-Cas system) to obtain the synthesis of antibodies in a recombinant host cell. The DNA encoding an antibody that binds to M. hyopneumoniae may be modified to, for example, humanize the antibody.
(53) Methods of Using the Antibodies
(54) In yet another aspect, this disclosure describes methods of using antibodies that bind to M. hyopneumoniae. An antibody that binds to M. hyopneumoniae, as described herein, may be used for any suitable application. For example, a monoclonal antibody may be used in both in vitro and in vivo diagnostic and therapeutic methods. In one or more embodiments, the diagnostic methods may preferably be in vitro diagnostic methods including, for example, detecting M. hyopneumoniae in a sample from a subject.
(55) In one or more embodiments, an antibody may be used to label and/or detect M. hyopneumoniae, in vivo or in vitro.
(56) In one or more embodiments, an antibody may be used to detect the presence or absence of M. hyopneumoniae in a sample from a subject. In one or more embodiments, detecting the presence of M. hyopneumoniae may include identifying an amount of M. hyopneumoniae in a sample from a subject.
(57) As used herein, the term subject includes, but is not limited to, humans and non-human vertebrates. Non-human vertebrates include livestock animals, companion animals, and laboratory animals. Non-human subjects also include non-human primates as well as rodents, such as, but not limited to, a rat or a mouse. Non-human subjects also include, without limitation, chickens, horses, cows, pigs, goats, dogs, cats, guinea pigs, hamsters, mink, and rabbits. In an exemplary embodiment, the subject is a pig.
(58) Any suitable sample obtained from the subject may be used. Exemplary samples include a blood sample, a tissue sample, a laryngeal swab, a nasal swab, a bronchial swab, a sample obtained by deep tracheal catheter, etc. In one or more embodiments, a sample may include a tracheal fluid and/or another respiratory tract fluid. In one or more embodiments, a sample may preferably include a tracheal fluid. When the sample includes a tissue sample, the antibody that binds to M. hyopneumoniae may be used to detect M. hyopneumoniae in situ.
(59) In one or more embodiments, detecting the presence of M. hyopneumoniae may include performing an assay on a sample from a subject. Exemplary assays include a magnetic bioassay, an enzyme-linked immunosorbent assay (ELISA), Western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunoprecipitation, etc. ELISA may include direct ELISA, indirect ELISA, and sandwich ELISA.
(60) In one or more embodiments, detecting the presence of M. hyopneumoniae in a sample from a subject may be used to diagnose a subject with a M. hyopneumoniae infection.
(61) This disclosure further described a kit or a device including an antibody. For example, the kit or device may include a composition that includes an anti-M. hyopneumoniae monoclonal antibody. The antibodies in the kit or device may be labeled with one or more detectable markers, as described herein. In one or more embodiments, the device may include a giant magnetoresistance (GMR)-based diagnostic immunoassay platform. In one or more embodiments, the device may preferably be portable (that is, easily conducted outside of a laboratory), allowing for, for example, pen-side testing for M. hyopneumoniae.
(62) In an exemplary embodiment, an antibody that binds M. hyopneumoniae may be used in a diagnostic immunoassay. Such an immunoassay may be used in pen-side testing for detection of M. hyopneumoniae. Such an immunoassay may preferably be portable.
(63) As further described in Example 4, the immunoassay may include a magnetic bioassay and, more specifically, a giant magnetoresistance (GMR)-based diagnostic immunoassay platform. Such a platform is described for the detection of Influenza A in Wu et al., ACS Sens. 2017, 2(11):1594-1601; and Su et al., Front. Microbiol. 2019; 10:1077. In one or more embodiments, the platform is preferably portable.
(64) Such a platform may allow for real-time data collection. The data collected may include real-time changes in the magnetoresistance ratio (AMR) from each GMR sensor due to binding of a magnetic tag to the sensor through capture antibody-antigen-detection antibody complex. The data may be transmitted to any suitable device including, for example, a smartphone, a tablet, or a computer (laptop or desktop). For example, data transmission may be done wirelessly thorough Bluetooth to a smartphone, a tablet, and a laptop computer or through a USB connection to a laptop or a desktop computer.
(65) Exemplary components of hand-held detection platform include a GMR sensors that includes two ferromagnetic layers separated by one or more metallic layers. Exemplary GMR sensors are described in Wu et al., ACS Sens. 2017, 2(11):1594-1601; and Su et al., Front. Microbiol. 2019; 10:1077. The surface of the GMR sensor may be functionalized so that the target antigen (e.g., M. hyopneumoniae or a specific protein of M. hyopneumoniae) specifically binds to the sensor. When a magnetic tag including, for example, a magnetic nanoparticle (MNP) binds to the target antigens (including, for example, via an antibody, as shown in
(66) Any suitable magnetic tag may be used. Exemplary magnetic tags include magnetic nanoparticles (MNP) including superparamagnetic nanoparticles or microbeads. An exemplary superparamagnetic microbead is further described in Su et al., Front. Microbiol. 2019; 10:1077.
(67) As used in the preceding description, the words preferred and preferably refer to embodiments that may afford certain benefits under certain circumstances. However, other embodiments may also be preferred under the same or different circumstances. Furthermore, an indication that one or more embodiments is preferred does not imply that other embodiments are not useful and is not intended to exclude other embodiments from the scope of the invention.
(68) In the preceding description and following claims, the term and/or means one or all of the listed elements or a combination of any two or more of the listed elements; unless otherwise specified, a, an, the, and at least one are used interchangeably and mean one or more than one; and the recitations of numerical ranges by endpoints include all numbers subsumed within that range (e.g., 1 to 5 includes 1, 1.5, 2, 2.75, 3, 3.80, 4, 5, etc.).
(69) As used herein, the terms comprises, comprising, and variations thereof are to be construed as open endedi.e., additional elements or steps are optional and may or may not be present. In contrast, use of term consisting of is meant to be limiting: consisting of indicates that the listed elements are required or mandatory, and that no other elements may be present. As used herein, the term consisting essentially of is meant to include any elements listed after the phrase, and limited to other elements that do not interfere with or contribute to the activity or action specified in the disclosure for the listed elements. Thus, the phrase consisting essentially of indicates that the listed elements are required or mandatory, but that other elements are optional and may or may not be present depending upon whether or not they materially affect the activity or action of the listed elements.
(70) For any method disclosed herein that includes discrete steps, the steps may be conducted in any feasible order. And, as appropriate, any combination of two or more steps may be conducted simultaneously.
(71) All headings are for the convenience of the reader and should not be used to limit the meaning of the text that follows the heading, unless so specified.
(72) In the preceding description, particular embodiments may be described in isolation for clarity. Reference throughout this specification to one embodiment, an embodiment, certain embodiments, one or more embodiments, or some embodiments, etc., means that a particular feature, configuration, composition, or characteristic described in connection with the embodiment is included in at least one embodiment of the disclosure. Thus, the appearances of such phrases in various places throughout this specification are not necessarily referring to the same embodiment of the disclosure. Furthermore, the particular features, configurations, compositions, or characteristics may be combined in any suitable manner in one or more embodiments. Thus, features described in the context of one embodiment may be combined with features described in the context of a different embodiment except where the features are necessarily mutually exclusive.
EXAMPLES
(73) The present invention is illustrated by the following examples. It is to be understood that the particular examples, materials, amounts, and procedures are to be interpreted broadly in accordance with the scope and spirit of the invention as set forth herein.
(74) All reagents, starting materials, and solvents used in the following examples were purchased from commercial suppliers and were used without further purification unless otherwise indicated.
Example 1
(75) Monoclonal antibodies were generated by standard hybridoma technique. (See
(76) Hybridoma cultures were screened for secretion of antibodies to M. hyopneumoniae using direct ELISA on wells coated with total cell lysate.
(77) Antibody cross reactivity to M. hyorhinis and M. flocculare was determined by ELISA and Western blotting methods.
(78) A sandwich ELISA was developed to detect M. hyopneumoniae antigens by using polyclonal rabbit anti-M. hyopneumoniae as a capture antibody and monoclonal antibody (produced by a subclone) as the detection antibody. The polyclonal rabbit anti-M. hyopneumoniae was prepared by immunizing rabbits with same membrane protein preparation of M. hyopneumoniae used for monoclonal antibody.
(79) Initial screening of hybridoma cells revealed 23 clones secreting antibodies to M. hyopneumoniae with absorbance in ELISA ranging from 0.5 to 4.00. Of these, four clones were selected for cross reactivity study and three clones that were specific to M. hyopneumoniae and which showed no cross reactivity to M. hyorhinis and M. flocculare antigens were identified. (See
(80) Two of the hybridoma clones (2C9 and 4G11) produced antibodies which exhibited an absorbance of greater than 1.00 by ELISA and which demonstrated reactivity to different proteins of M. hyopneumoniae by Western blot were sub-cloned by limiting dilution and used for further characterization, resulting in 2C9.B3 (which produces antibodies referred to herein as MAb 2C9.B3 or MAb 2) and 4G11.A3 (which produces antibodies also referred to herein as MAb 4G11.A3 or MAb 4).
(81) Cross-reactivity analysis by both Western blot and ELISA confirmed both MAb 2C9.B3 and MAb 4G11.A3 are specific to M. hyopneumoniae. Isotyping showed both MAb 2C9.B3 and MAb 4G11.A3 are IgG1 isotype.
(82) The monoclonal antibodies produced by 2C9.B3 and 4G11.A3 (MAb 2C9.B3 and MAb 4G11.A3) were used as the detection antibody in a sandwich ELISA to detect different field isolates of M. hyopneumoniae. Results are shown in
Example 2
(83) This Example describes the development of an ELISA assay that may accurately detect the presence of M. hyopneumoniae at concentrations as low as 1 g/mL.
(84) A sandwich ELISA assay (as described in Example 1) was used to test for lab-grown M. hyopneumoniae diluted in buffer or M. hyopneumoniae isolated from swine lung tissue. Varying concentrations (2 g/mL, 3 g/mL, 5 g/mL, or 10 g/mL) of the capture antibody were used. Varying amounts (1% and 3%) bovine serum albumin (BSA) in blocking buffer (PBS and 1% normal goat serum) was tested. Inclusion of detergents (NP40 and Tween 20) was also tested.
(85) Anti-mouse IgG (R&D Systems, Minneapolis, MN) was used as the enzyme-linked secondary antibody.
(86) Undiluted culture supernatant from hybridoma cultures was used as the detection antibody.
(87) Detection was performed using 3,3,5,5-Tetramethylbenzidine (TMB) substrate (Thermo Fisher Scientific, Waltham, MA). 2M HCl was used as a stop solution
(88) Results were measured using endpoint absorption at 450 nm with a delay of 100 milliseconds. The sensitivity and specificity of MAb 2 and MAb 4 were examined. Exemplary results are shown in
(89) A capture antibody concentration of 3 g/mL was found to be optimal among those tested (2 g/mL, 3 g/mL, 5 g/mL, and 10 g/mL).
(90) 3% BSA in blocking buffer was found to provide less background signal relative to 1% BSA in blocking buffer.
(91) Use of a detergent was found to be preferred, and NP40 allowed for more sensitive detection than Tween 20.
(92) M. hyopneumoniae was detectable at concentrations in a range of 1 g/mL to 200 g/mL.
Example 3
(93) Total RNA was isolated from the hybridoma cells following the manufacturer's instructions. Total RNA was then reverse-transcribed into cDNA using either isotype-specific anti-sense primers or universal primers following the technical manual of SMARTScribe Reverse Transcriptase (Takara Bio Inc., San Jose, CA). Antibody fragments of heavy chain and light chain were amplified according to the standard operating procedure (SOP) of rapid amplification of cDNA ends (RACE) (GenScript Biotech Corp., Piscataway, NJ). Amplified antibody fragments were cloned into a standard cloning vector separately. Colony PCR was performed to screen for clones with inserts of correct sizes. The consensus sequence was provided.
Example 4
(94) This Example describes the planned development of a giant magnetoresistance (GMR)-based portable diagnostic immunoassay platform for pen-side detection of M. hyopneumoniae directly from swine respiratory samples. An exemplary system that may be used is shown in
(95) The complete disclosure of all patents, patent applications, and publications, and electronically available material (including, for instance, nucleotide sequence submissions in, e.g., GenBank and RefSeq, and amino acid sequence submissions in, e.g., SwissProt, PIR, PRF, PDB, and translations from annotated coding regions in GenBank and RefSeq) cited herein are incorporated by reference. In the event that any inconsistency exists between the disclosure of the present application and the disclosure(s) of any document incorporated herein by reference, the disclosure of the present application shall govern. The foregoing detailed description and examples have been given for clarity of understanding only. No unnecessary limitations are to be understood therefrom. The invention is not limited to the exact details shown and described, for variations obvious to one skilled in the art will be included within the invention defined by the claims.
(96) TABLE-US-00001 SequenceListingFreeText MAb2C9.B3heavychainDNAsequence SEQIDNO:1 ATGGCTGTCTTGGGGCTGCTCTTCTGCCTG GTGACATTCCCAAGCTGTGTCCTATCCCAG GTGCAGCTGAAGCAGTCAGGACCTGGCCTA GTGCAGCCCTCACAGAGCCTGTCCATCACC TGCACAGTCTCTGGTTTCTCATTAACTACC TATGCTATACACTGGGTTCGCCAGTCTCCA GGAAAGGGTCTAGAGTGGCTGGGAGTGATA TGGAGTGGTGGAAACACAGACTATAATGCA GCTTTCATATCCAGACTGAGCATCACTAAG GACAATTCCAAGAGCCAAGTTTTCTTTAAA ATGAACAGTCTGCAACCTAATGACACAGCC ATATATTATTGTGCCAGAGAGGCCTCTACT ATGATAACGACGGACTACTGGGGCCAAGGC ACCACTCTCACAGTCTCCTCA Signalsequence:1-57 FR1:58-147 CDR1:148-162 FR2:163-204 CDR2:205-252 FR3:253-348 CDR3:349-378 FR4:379-411 MAb2C9.B3heavychainaminoacidsequence SEQIDNO:2 MAVLGLLFCLVTFPSCVLSQVQLKQSGPGL VQPSQSLSITCTVSGFSLTTYAIHWVRQSP GKGLEWLGVIWSGGNTDYNAAFISRLSITK DNSKSQVFFKMNSLQPNDTAIYYCAREAST MITTDYWGQGTTLTVSS Signalpeptide:1-19 FR1:20-49 CDR1:50-54 FR2:55-68 CDR2:69-84 FR3:85-116 CDR3:117-126 FR4:127-137 MAb2C9.B3lightchainDNAsequence SEQIDNO:3 ATGGAGTCACAGATTCAGGCATTTGTATTC GTGTTTCTCTGGTTGTCTGGTGTTGACGGA GACATTGTGATGACCCAGTCTCACAAATTC ATGTCCACATCAGTAGGAGATAGGGTCACC ATCACCTGCAGGGCCAGTCAGGATGTGAGT ACTGCTGTAGCCTGGTATCAACAAAAACCA GGCCAATCTCCTAAACTACTGATTTACTGG GCATCCATCCGGCACACTGGAGTCCCTGAT CGCTTCACAGGCAGTGGATCTGGGACAGAT TATACTCTCACCATCAGCAGTGTGCAGGCT GAAGACCTGGCACTTTATTACTGTCAGCAA CATTATTTCACTCCGCTCACGTTCGGTGCT GGGACCAAGCTGGAGCTGAAA Signalsequence:1-60 FR1:61-129 CDR1:130-162 FR2:163-207 CDR2:208-228 FR3:229-324 CDR3:325-351 FR4:352-381 MAb2C9.B3lightchainaminoacidsequence SEQIDNO:4 MESQIQAFVFVFLWLSGVDGDIVMTQSHKF MSTSVGDRVTITCRASQDVSTAVAWYQQKP GQSPKLLIYWASIRHTGVPDRFTGSGSGTD YTLTISSVQAEDLALYYCQQHYFTPLTFGA GTKLELK Signalpeptide:1-20 FR1:21-43 CDR1:44-54 FR2:55-69 CDR2:70-76 FR3:77-108 CDR3:109-117 FR4:118-127 MAb4G11.A3heavychainDNAsequence SEQIDNO:5 ATGGAATGGCCTTGGATCTTTCTCTTCCTC CTGTCAGTAACTGAAGGTGTCCACTCCCAG GTTCAGCTGCAGCAGTCTGGGGCTGAGCTG GTGAGGCCTGGGTCCTCAGTGAAGATTTCC TGCAGGGCTTCTGGCTATTTATTCAGTACC TTCTGGATAAACTGGGTGAAGCAGAGGCCT GGACAGGGTCTTGAGTGGATTGGACAGATT TATCCTGGAGATGGTGATACTAACTACAAT GGAAAGTTCAGGGGTAAAGCCACACTGACT GCAGACAAATCCTCCAGCACAGCCTACATG CAGCTCAGCAGCCTAACATCTGAGGACTCT GCGGTCTATTTCTGTGCAAGAAGGGAAGTT TTGATCTATGATGATTACTACGATGCTCTG GACTACTGGGGTCAAGGAACCTCAGTCACC GTCTCCTCA Signalsequence:1-57 FR1:58-147 CDR1:148-162 FR2:163-204 CDR2:205-255 FR3:256-351 CDR3:352-396 FR4:397-429 MAb4G11.A3heavychainaminoacidsequence SEQIDNO:6 MEWPWIFLFLLSVTEGVHSQVQLQQSGAEL VRPGSSVKISCRASGYLESTFWINWVKQRP GQGLEWIGQIYPGDGDTNYNGKFRGKATLT ADKSSSTAYMQLSSLTSEDSAVYFCARREV LIYDDYYDALDYWGQGTSVTVSS Signalpeptide:1-19 FR1:20-49 CDR1:50-54 FR2:55-68 CDR2:69-85 FR3:86-117 CDR3:118-132 FR4:133-143 MAb4G11.A3lightchainDNAsequence SEQIDNO:7 ATGGATTTTCAAGTGCAGATTTTCAGCTTC CTGCTAATCAGTGCCTCAGTCATAATATCC AGAGGACAAATTGTTCTCACCCAGTCTCCA GCAATCATGTCTGCATCTCCAGGGGAGAAG GTCACCATGACCTGCAGTGCCAGCTCAAGT GTAAATTCCATGCACTGGTACCAACAAAAG TCAGGCACCTCCCCCAAAAGATGGATTTAT GACACATCCAAATTGGCTTCTGGAGTCCCT GCTCGCTTCAGTGGCAGTGGGTCTGGGACC TCTTACTCTCTCACAATCAGCAACATGGAG GCTGAAGATGCTGCCACTTATTACTGCCAG CAGTGGAGTAGTAACCCGCTCACGTTCGGT GCTGGGACCAAGCTGGACCTGAAA Signalsequence:1-66 FR1:67-135 CDR1:136-165 FR2:166-210 CDR2:211-231 FR3:232-327 CDR3:328-354 FR4:355-384 MAb4G11.A3lightchainaminoacidsequence SEQIDNO:8 MDFQVQIFSFLLISASVIISRGQIVLTQSP AIMSASPGEKVTMTCSASSSVNSMHWYQQK SGTSPKRWIYDTSKLASGVPARFSGSGSGT SYSLTISNMEAEDAATYYCQQWSSNPLTFG AGTKLDLK Signalpeptide:1-22 FR1:23-45 CDR1:46-55 FR2:56-70 CDR2:71-77 FR3:78-109 CDR3:110-118 FR4:119-128